Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P29376

- LTK_HUMAN

UniProt

P29376 - LTK_HUMAN

Protein

Leukocyte tyrosine kinase receptor

Gene

LTK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 153 (01 Oct 2014)
      Sequence version 3 (03 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Orphan receptor with a tyrosine-protein kinase activity. The exact function of this protein is not known. Studies with chimeric proteins (replacing its extracellular region with that of several known growth factor receptors, such as EGFR and CSFIR) demonstrate its ability to promote growth and specifically neurite outgrowth, and cell survival. Signaling appears to involve the PI3 kinase pathway. Involved in regulation of the secretory pathway involving endoplasmic reticulum (ER) export sites (ERESs) and ER to Golgi transport.1 Publication

    Catalytic activityi

    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.1 PublicationPROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei544 – 5441ATPPROSITE-ProRule annotation
    Active sitei643 – 6431Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi516 – 5249ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein kinase activity Source: UniProtKB
    3. protein tyrosine kinase activity Source: ProtInc
    4. transmembrane receptor protein tyrosine kinase activity Source: ProtInc

    GO - Biological processi

    1. cell proliferation Source: UniProtKB
    2. cellular response to retinoic acid Source: BHF-UCL
    3. negative regulation of apoptotic process Source: UniProtKB
    4. peptidyl-tyrosine phosphorylation Source: GOC
    5. phosphatidylinositol 3-kinase signaling Source: UniProtKB
    6. positive regulation of cardiac muscle cell apoptotic process Source: UniProtKB
    7. positive regulation of neuron projection development Source: BHF-UCL
    8. protein phosphorylation Source: UniProtKB
    9. signal transduction Source: ProtInc
    10. transmembrane receptor protein tyrosine kinase signaling pathway Source: InterPro

    Keywords - Molecular functioni

    Kinase, Receptor, Transferase, Tyrosine-protein kinase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.10.1. 2681.
    SignaLinkiP29376.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leukocyte tyrosine kinase receptor (EC:2.7.10.1)
    Alternative name(s):
    Protein tyrosine kinase 1
    Gene namesi
    Name:LTK
    Synonyms:TYK1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:6721. LTK.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: UniProtKB
    3. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Genetic variations in LTK that cause up-regulation of the PI3K pathway may possibly contribute to susceptibility to abnormal proliferation of self-reactive B-cells and, therefore, to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue, thought to represent a failure of the regulatory mechanisms of the autoimmune system.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi544 – 5441K → M: Loss of interaction with PLCG1, PI3-kinase subunit p85, Ras GTPase-activating protein and RAF1. 1 Publication
    Mutagenesisi750 – 7501G → E: Increases autophosphorylation and interaction with PI3-kinase subunit p85 (demonstrated with chimeric EGFR-LTK). 1 Publication
    Mutagenesisi753 – 7531Y → F: Abolishes interaction with PI3-kinase subunit p85, impairs PI3 kinase activity and leads to apoptosis (demonstrated with chimeric EGFR-LTK). 1 Publication
    Mutagenesisi862 – 8621Y → F: Impairs phosphorylation of CBLC (demonstrated with chimeric EGFR-LTK). 1 Publication

    Keywords - Diseasei

    Systemic lupus erythematosus

    Organism-specific databases

    PharmGKBiPA30483.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 864848Leukocyte tyrosine kinase receptorPRO_0000016738Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi380 – 3801N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi412 – 4121N-linked (GlcNAc...)Sequence Analysis
    Modified residuei676 – 6761Phosphotyrosine; by autocatalysisBy similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP29376.
    PRIDEiP29376.

    PTM databases

    PhosphoSiteiP29376.

    Expressioni

    Tissue specificityi

    Expressed in non-hematopoietic cell lines and T- and B-cell lines.1 Publication

    Gene expression databases

    ArrayExpressiP29376.
    BgeeiP29376.
    CleanExiHS_LTK.
    GenevestigatoriP29376.

    Organism-specific databases

    HPAiHPA059545.

    Interactioni

    Subunit structurei

    Homodimer when bound to ligand Probable. Part of a complex including LTK, TNK2 and GRB2, in which GRB2 promotes LTK recruitment by TNK2.Curated

    Protein-protein interaction databases

    BioGridi110236. 7 interactions.
    IntActiP29376. 3 interactions.
    MINTiMINT-6744900.
    STRINGi9606.ENSP00000263800.

    Structurei

    3D structure databases

    ProteinModelPortaliP29376.
    SMRiP29376. Positions 465-793.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini17 – 424408ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini450 – 864415CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei425 – 44925HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini510 – 786277Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000231766.
    HOVERGENiHBG052371.
    InParanoidiP29376.
    KOiK05118.
    OMAiAEGGQGC.
    OrthoDBiEOG7GN2KT.
    PhylomeDBiP29376.
    TreeFamiTF351636.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR026984. LTK.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view]
    PANTHERiPTHR24416:SF138. PTHR24416:SF138. 1 hit.
    PfamiPF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    PRINTSiPR00109. TYRKINASE.
    SMARTiSM00219. TyrKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform Lambda P2 (identifier: P29376-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGCWGQLLVW FGAAGAILCS SPGSQETFLR SSPLPLASPS PRDPKVSAPP    50
    SILEPASPLN SPGTEGSWLF STCGASGRHG PTQTQCDGAY AGTSVVVTVG 100
    AAGQLRGVQL WRVPGPGQYL ISAYGAAGGK GAKNHLSRAH GVFVSAIFSL 150
    GLGESLYILV GQQGEDACPG GSPESQLVCL GESRAVEEHA AMDGSEGVPG 200
    SRRWAGGGGG GGGATYVFRV RAGELEPLLV AAGGGGRAYL RPRDRGRTQA 250
    SPEKLENRSE APGSGGRGGA AGGGGGWTSR APSPQAGRSL QEGAEGGQGC 300
    SEAWATLGWA AAGGFGGGGG ACTAGGGGGG YRGGDASETD NLWADGEDGV 350
    SFIHPSSELF LQPLAVTENH GEVEIRRHLN CSHCPLRDCQ WQAELQLAEC 400
    LCPEGMELAV DNVTCMDLHK PPGPLVLMVA VVATSTLSLL MVCGVLILVK 450
    QKKWQGLQEM RLPSPELELS KLRTSAIRTA PNPYYCQVGL GPAQSWPLPP 500
    GVTEVSPANV TLLRALGHGA FGEVYEGLVI GLPGDSSPLQ VAIKTLPELC 550
    SPQDELDFLM EALIISKFRH QNIVRCVGLS LRATPRLILL ELMSGGDMKS 600
    FLRHSRPHLG QPSPLVMRDL LQLAQDIAQG CHYLEENHFI HRDIAARNCL 650
    LSCAGPSRVA KIGDFGMARD IYRASYYRRG DRALLPVKWM PPEAFLEGIF 700
    TSKTDSWSFG VLLWEIFSLG YMPYPGRTNQ EVLDFVVGGG RMDPPRGCPG 750
    PVYRIMTQCW QHEPELRPSF ASILERLQYC TQDPDVLNSL LPMELGPTPE 800
    EEGTSGLGNR SLECLRPPQP QELSPEKLKS WGGSPLGPWL SSGLKPLKSR 850
    GLQPQNLWNP TYRS 864
    Length:864
    Mass (Da):91,681
    Last modified:April 3, 2007 - v3
    Checksum:i0617F378AA04298E
    GO
    Isoform Lambda P1 (identifier: P29376-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         170-170: G → VAAASGDGAAPAPGARAAWGPGERAFLGAGSPAQRGEAPGPRRFPPPLPAG
         171-864: Missing.

    Show »
    Length:220
    Mass (Da):21,952
    Checksum:iEC71C9296310B1AA
    GO
    Isoform Lambda P3 (identifier: P29376-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         448-448: L → GTKRLAGTVDSRLLLSSELGWVSAAGSRRQ
         449-864: Missing.

    Show »
    Length:477
    Mass (Da):48,354
    Checksum:i55867ECA5C4A4CF4
    GO
    Isoform 2 (identifier: P29376-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         274-334: Missing.

    Show »
    Length:803
    Mass (Da):86,213
    Checksum:i3877888B402CE78A
    GO
    Isoform 5 (identifier: P29376-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         274-334: Missing.
         449-544: VKQKKWQGLQ...DSSPLQVAIK → GGAWPGPVLASATRCHRGFPSQCYSAQ

    Show »
    Length:734
    Mass (Da):78,714
    Checksum:iAAB41D3555D6DF93
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti106 – 1061R → G in BAG59451. (PubMed:14702039)Curated
    Sequence conflicti220 – 2201V → L in CAA43113. (PubMed:1655406)Curated
    Sequence conflicti449 – 4491V → GTKRLAGTVDSRLLLSM in CAA36460. (PubMed:2320375)Curated
    Sequence conflicti652 – 6543SCA → MR in CAA36460. (PubMed:2320375)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti42 – 421R → Q.2 Publications
    Corresponds to variant rs2305030 [ dbSNP | Ensembl ].
    VAR_031569
    Natural varianti384 – 3841C → R.1 Publication
    Corresponds to variant rs55683312 [ dbSNP | Ensembl ].
    VAR_046106
    Natural varianti535 – 5351D → N.1 Publication
    Corresponds to variant rs35932273 [ dbSNP | Ensembl ].
    VAR_046107
    Natural varianti569 – 5691R → S.1 Publication
    Corresponds to variant rs148513655 [ dbSNP | Ensembl ].
    VAR_046108
    Natural varianti673 – 6731R → Q.1 Publication
    Corresponds to variant rs55876255 [ dbSNP | Ensembl ].
    VAR_046109
    Natural varianti745 – 7451P → S.1 Publication
    Corresponds to variant rs55900837 [ dbSNP | Ensembl ].
    VAR_046110
    Natural varianti763 – 7631E → K May possibly contribute to susceptibility to systemic lupus erythematosus; increases autophosphorylation and interaction with PI3-kinase subunit p85. 1 Publication
    Corresponds to variant rs76282169 [ dbSNP | Ensembl ].
    VAR_065465
    Natural varianti838 – 8381P → S.1 Publication
    Corresponds to variant rs56367146 [ dbSNP | Ensembl ].
    VAR_046111

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei170 – 1701G → VAAASGDGAAPAPGARAAWG PGERAFLGAGSPAQRGEAPG PRRFPPPLPAG in isoform Lambda P1. CuratedVSP_002946
    Alternative sequencei171 – 864694Missing in isoform Lambda P1. CuratedVSP_002947Add
    BLAST
    Alternative sequencei274 – 33461Missing in isoform 2 and isoform 5. 2 PublicationsVSP_035109Add
    BLAST
    Alternative sequencei448 – 4481L → GTKRLAGTVDSRLLLSSELG WVSAAGSRRQ in isoform Lambda P3. CuratedVSP_002948
    Alternative sequencei449 – 864416Missing in isoform Lambda P3. CuratedVSP_002949Add
    BLAST
    Alternative sequencei449 – 54496VKQKK…QVAIK → GGAWPGPVLASATRCHRGFP SQCYSAQ in isoform 5. 1 PublicationVSP_044521Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D16105 mRNA. Translation: BAA03679.1.
    X60702 mRNA. Translation: CAA43113.1.
    AK296892 mRNA. Translation: BAG59451.1.
    AC016134 Genomic DNA. No translation available.
    AC087721 Genomic DNA. No translation available.
    CH471125 Genomic DNA. Translation: EAW92496.1.
    X52213 mRNA. Translation: CAA36460.1.
    CCDSiCCDS10077.1. [P29376-1]
    CCDS10078.1. [P29376-4]
    CCDS45237.1. [P29376-5]
    PIRiA48266.
    RefSeqiNP_001129157.1. NM_001135685.1. [P29376-5]
    NP_002335.2. NM_002344.5. [P29376-1]
    NP_996844.1. NM_206961.3. [P29376-4]
    UniGeneiHs.434481.

    Genome annotation databases

    EnsembliENST00000263800; ENSP00000263800; ENSG00000062524. [P29376-1]
    ENST00000355166; ENSP00000347293; ENSG00000062524. [P29376-4]
    ENST00000453182; ENSP00000392196; ENSG00000062524. [P29376-5]
    GeneIDi4058.
    KEGGihsa:4058.
    UCSCiuc001zoa.3. human. [P29376-1]
    uc001zob.3. human. [P29376-4]
    uc010ucx.1. human. [P29376-5]

    Polymorphism databases

    DMDMi143811416.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D16105 mRNA. Translation: BAA03679.1 .
    X60702 mRNA. Translation: CAA43113.1 .
    AK296892 mRNA. Translation: BAG59451.1 .
    AC016134 Genomic DNA. No translation available.
    AC087721 Genomic DNA. No translation available.
    CH471125 Genomic DNA. Translation: EAW92496.1 .
    X52213 mRNA. Translation: CAA36460.1 .
    CCDSi CCDS10077.1. [P29376-1 ]
    CCDS10078.1. [P29376-4 ]
    CCDS45237.1. [P29376-5 ]
    PIRi A48266.
    RefSeqi NP_001129157.1. NM_001135685.1. [P29376-5 ]
    NP_002335.2. NM_002344.5. [P29376-1 ]
    NP_996844.1. NM_206961.3. [P29376-4 ]
    UniGenei Hs.434481.

    3D structure databases

    ProteinModelPortali P29376.
    SMRi P29376. Positions 465-793.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110236. 7 interactions.
    IntActi P29376. 3 interactions.
    MINTi MINT-6744900.
    STRINGi 9606.ENSP00000263800.

    Chemistry

    BindingDBi P29376.
    ChEMBLi CHEMBL5627.
    GuidetoPHARMACOLOGYi 1838.

    PTM databases

    PhosphoSitei P29376.

    Polymorphism databases

    DMDMi 143811416.

    Proteomic databases

    PaxDbi P29376.
    PRIDEi P29376.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263800 ; ENSP00000263800 ; ENSG00000062524 . [P29376-1 ]
    ENST00000355166 ; ENSP00000347293 ; ENSG00000062524 . [P29376-4 ]
    ENST00000453182 ; ENSP00000392196 ; ENSG00000062524 . [P29376-5 ]
    GeneIDi 4058.
    KEGGi hsa:4058.
    UCSCi uc001zoa.3. human. [P29376-1 ]
    uc001zob.3. human. [P29376-4 ]
    uc010ucx.1. human. [P29376-5 ]

    Organism-specific databases

    CTDi 4058.
    GeneCardsi GC15M041795.
    H-InvDB HIX0038138.
    HGNCi HGNC:6721. LTK.
    HPAi HPA059545.
    MIMi 151520. gene.
    neXtProti NX_P29376.
    PharmGKBi PA30483.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000231766.
    HOVERGENi HBG052371.
    InParanoidi P29376.
    KOi K05118.
    OMAi AEGGQGC.
    OrthoDBi EOG7GN2KT.
    PhylomeDBi P29376.
    TreeFami TF351636.

    Enzyme and pathway databases

    BRENDAi 2.7.10.1. 2681.
    SignaLinki P29376.

    Miscellaneous databases

    GeneWikii Leukocyte_receptor_tyrosine_kinase.
    GenomeRNAii 4058.
    NextBioi 15900.
    PROi P29376.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P29376.
    Bgeei P29376.
    CleanExi HS_LTK.
    Genevestigatori P29376.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR026984. LTK.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view ]
    PANTHERi PTHR24416:SF138. PTHR24416:SF138. 1 hit.
    Pfami PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    PRINTSi PR00109. TYRKINASE.
    SMARTi SM00219. TyrKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Differently spliced cDNAs of human leukocyte tyrosine kinase receptor tyrosine kinase predict receptor proteins with and without a tyrosine kinase domain and a soluble receptor protein."
      Toyoshima H., Kozutsumi H., Maru Y., Hagiwara K., Furaya A., Mioh H., Hanai N., Takaku F., Yazaki Y., Hirai H.
      Proc. Natl. Acad. Sci. U.S.A. 90:5404-5408(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT GLN-42.
      Tissue: Placenta.
    2. "The ltk gene encodes a novel receptor-type protein tyrosine kinase."
      Krolewski J.J., Dalla-Favera R.
      EMBO J. 10:2911-2919(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Tongue.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Human ltk: gene structure and preferential expression in human leukemic cells."
      Maru Y., Hirai H., Takaku F.
      Oncogene Res. 5:199-204(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 416-864.
    7. "Identification and chromosomal mapping of new human tyrosine kinase genes."
      Krolewski J.J., Lee R., Eddy R., Shows T.B., Dalla-Favera R.
      Oncogene 5:277-282(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 608-716, TISSUE SPECIFICITY.
    8. "Human ltk receptor tyrosine kinase binds to PLC-gamma 1, PI3-K, GAP and Raf-1 in vivo."
      Kozutsumi H., Toyoshima H., Hagiwara K., Yazaki Y., Hirai H.
      Oncogene 9:2991-2998(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION, MUTAGENESIS OF LYS-544.
    9. "The phosphatidylinositol 3' kinase pathway is required for the survival signal of leukocyte tyrosine kinase."
      Ueno H., Honda H., Nakamoto T., Yamagata T., Sasaki K., Miyagawa K., Mitani K., Yazaki Y., Hirai H.
      Oncogene 14:3067-3072(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: POSSIBLE FUNCTION, MUTAGENESIS OF TYR-753 AND TYR-862.
    10. "Heart-specific activation of LTK results in cardiac hypertrophy, cardiomyocyte degeneration and gene reprogramming in transgenic mice."
      Honda H., Harada K., Komuro I., Terasaki F., Ueno H., Tanaka Y., Kawamura K., Yazaki Y., Hirai H.
      Oncogene 18:3821-3830(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: CATALYTIC ACTIVITY.
    11. "Gain-of-function polymorphism in mouse and human Ltk: implications for the pathogenesis of systemic lupus erythematosus."
      Li N., Nakamura K., Jiang Y., Tsurui H., Matsuoka S., Abe M., Ohtsuji M., Nishimura H., Kato K., Kawai T., Atsumi T., Koike T., Shirai T., Ueno H., Hirose S.
      Hum. Mol. Genet. 13:171-179(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: POSSIBLE INVOLVEMENT IN SUSCEPTIBILITY TO SYSTEMIC LUPUS ERYTHEMATOSUS, VARIANT LYS-763, CHARACTERIZATION OF VARIANT LYS-763, AUTOPHOSPHORYLATION, MUTAGENESIS OF GLY-750.
    12. "Expression of a chimeric CSF1R-LTK mediates ligand-dependent neurite outgrowth."
      Yamada S., Nomura T., Takano K., Fujita S., Miyake M., Miyake J.
      NeuroReport 19:1733-1738(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: POSSIBLE FUNCTION.
    13. "Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling."
      Pao-Chun L., Chan P.M., Chan W., Manser E.
      J. Biol. Chem. 284:34954-34963(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH GRB2 AND TNK2.
    14. "MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening."
      Farhan H., Wendeler M.W., Mitrovic S., Fava E., Silberberg Y., Sharan R., Zerial M., Hauri H.P.
      J. Cell Biol. 189:997-1011(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN REGULATION OF THE SECRETORY PATHWAY.
    15. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-42; ARG-384; ASN-535; SER-569; GLN-673; SER-745 AND SER-838.

    Entry informationi

    Entry nameiLTK_HUMAN
    AccessioniPrimary (citable) accession number: P29376
    Secondary accession number(s): A6NNJ8, B4DL89, E9PFX4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 1992
    Last sequence update: April 3, 2007
    Last modified: October 1, 2014
    This is version 153 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Transgenic mice expressing human LTK show specific activation (tyrosine phosphorylation, kinase activity, membrane localization and homooligomerization) in heart combined with cardiac hypertrophy, cardiomyocyte degeneration.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3