Reviewed,
UniProtKB/Swiss-Prot P29376 (LTK_HUMAN)
Last modified
June 16, 2009.
Version 96.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Leukocyte tyrosine kinase receptor EC=2.7.10.1 Alternative name(s): Protein tyrosine kinase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 864 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The exact function of this protein is not known. It is probably a receptor with a tyrosine-protein kinase activity. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subcellular location | |
| Tissue specificity | Expressed in non-hematopoietic cell lines and T- and B-cell lines. Ref.4 |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Receptor Transferase Tyrosine-protein kinase |
| PTM | Glycoprotein Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Ref.1 Traceable author statement. Source: ProtInc transmembrane receptor protein tyrosine kinase signaling pathwayInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to plasma membrane Ref.1 Traceable author statement. Source: ProtInc soluble fraction Ref.1Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW transmembrane receptor protein tyrosine kinase activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform Lambda P2 (identifier: P29376-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Lambda P1 (identifier: P29376-2) The sequence of this isoform differs from the canonical sequence as follows: 170-170: G → VAAASGDGAAPAPGARAAWGPGERAFLGAGSPAQRGEAPGPRRFPPPLPAG 171-864: Missing. | ||||||
| Isoform Lambda P3 (identifier: P29376-3) The sequence of this isoform differs from the canonical sequence as follows: 448-448: L → GTKRLAGTVDSRLLLSSELGWVSAAGSRRQ 449-864: Missing. | ||||||
| Isoform 2 (identifier: P29376-4) The sequence of this isoform differs from the canonical sequence as follows: 274-334: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||
| Chain | 17 – 864 | 848 | Leukocyte tyrosine kinase receptor | PRO_0000016738 | |||||
Regions | |||||||||
| Topological domain | 17 – 424 | 408 | Extracellular Potential | ||||||
| Transmembrane | 425 – 449 | 25 | Potential | ||||||
| Topological domain | 450 – 864 | 415 | Cytoplasmic Potential | ||||||
| Domain | 510 – 786 | 277 | Protein kinase | ||||||
| Nucleotide binding | 516 – 524 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 643 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 544 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 672 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 676 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||
| Modified residue | 677 | 1 | Phosphotyrosine Ref.5 | ||||||
| Glycosylation | 257 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 380 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 412 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 170 | 1 | G → VAAASGDGAAPAPGARAAWG PGERAFLGAGSPAQRGEAPG PRRFPPPLPAG in isoform Lambda P1. | VSP_002946 | |||||
| Alternative sequence | 171 – 864 | 694 | Missing in isoform Lambda P1. | VSP_002947 | |||||
| Alternative sequence | 274 – 334 | 61 | Missing in isoform 2. | VSP_035109 | |||||
| Alternative sequence | 448 | 1 | L → GTKRLAGTVDSRLLLSSELG WVSAAGSRRQ in isoform Lambda P3. | VSP_002948 | |||||
| Alternative sequence | 449 – 864 | 416 | Missing in isoform Lambda P3. | VSP_002949 | |||||
| Natural variant | 42 | 1 | R → Q: dbSNP rs2305030. Ref.1 Ref.6 | VAR_031569 | |||||
| Natural variant | 384 | 1 | C → R Ref.6 | VAR_046106 | |||||
| Natural variant | 535 | 1 | D → N Ref.6 | VAR_046107 | |||||
| Natural variant | 569 | 1 | R → S Ref.6 | VAR_046108 | |||||
| Natural variant | 673 | 1 | R → Q Ref.6 | VAR_046109 | |||||
| Natural variant | 745 | 1 | P → S Ref.6 | VAR_046110 | |||||
| Natural variant | 838 | 1 | P → S Ref.6 | VAR_046111 | |||||
Experimental info | |||||||||
| Sequence conflict | 220 | 1 | V → L in CAA43113. Ref.2 | ||||||
| Sequence conflict | 274 – 334 | 61 | Missing in CAA43113. Ref.2 | ||||||
| Sequence conflict | 449 | 1 | V → GTKRLAGTVDSRLLLSM in CAA36460. Ref.3 | ||||||
| Sequence conflict | 652 – 654 | 3 | SCA → MR in CAA36460. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differently spliced cDNAs of human leukocyte tyrosine kinase receptor tyrosine kinase predict receptor proteins with and without a tyrosine kinase domain and a soluble receptor protein." Toyoshima H., Kozutsumi H., Maru Y., Hagiwara K., Furaya A., Mioh H., Hanai N., Takaku F., Yazaki Y., Hirai H. Proc. Natl. Acad. Sci. U.S.A. 90:5404-5408(1993) [PubMed: 7685902] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT GLN-42. Tissue: Placenta. |
| [2] | "The ltk gene encodes a novel receptor-type protein tyrosine kinase." Krolewski J.J., Dalla-Favera R. EMBO J. 10:2911-2919(1991) [PubMed: 1655406] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Human ltk: gene structure and preferential expression in human leukemic cells." Maru Y., Hirai H., Takaku F. Oncogene Res. 5:199-204(1990) [PubMed: 2320375] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 416-864. |
| [4] | "Identification and chromosomal mapping of new human tyrosine kinase genes." Krolewski J.J., Lee R., Eddy R., Shows T.B., Dalla-Favera R. Oncogene 5:277-282(1990) [PubMed: 2156206] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 608-716, TISSUE SPECIFICITY. |
| [5] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-672; TYR-676 AND TYR-677, MASS SPECTROMETRY. |
| [6] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-42; ARG-384; ASN-535; SER-569; GLN-673; SER-745 AND SER-838. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| D16105 mRNA. Translation: BAA03679.1. X60702 mRNA. Translation: CAA43113.1. X52213 mRNA. Translation: CAA36460.1. | |
| IPI | IPI00007716. IPI00021365. IPI00218841. IPI00218843. |
| PIR | A48266. |
| RefSeq | NP_002335.2. |
| UniGene | Hs.434481 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FMK based on UniProtKB P12931. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P29376. |
Genome annotation databases | |
| Ensembl | ENSG00000062524. Homo sapiens. [Contig view] |
| GeneID | 4058. |
Organism-specific databases | |
| GeneCards | GC15M039583. |
| H-InvDB | HIX0038138. |
| HGNC | HGNC:6721. LTK. |
| MIM | 151520. gene. |
| PharmGKB | PA30483. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P29376. |
| HOVERGEN | P29376. |
| OMA | P29376. GPAQSWP. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.1. 247. |
Gene expression databases | |
| Bgee | P29376. |
| CleanEx | HS_LTK. |
| GermOnline | ENSG00000062524. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR002011. Recept_tyr_kinase-II_CS. IPR001245. Tyr_pkinase. IPR008266. Tyr_pkinase_AS. [Graphical view] |
| Pfam | PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR00109. TYRKINASE. |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00219. TyrKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00239. RECEPTOR_TYR_KIN_II. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 15900. |
| SOURCE | Search... |
Entry information
| Entry name | LTK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29376 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


