Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tyrosine-protein phosphatase corkscrew

Gene

csw

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required in all receptor tyrosine kinase signaling pathways. Functions downstream of the receptor tyrosine kinase torso, acting in concert with D-Raf via tailless. Also functions downstream of Egfr (epidermal growth factor receptor) and btl (fibroblast growth factor receptor). The SH2 domain suggests that csw effects its role by mediating heteromeric protein interactions. Maternally required for normal determination of cell fates at the termini of the embryo. Required for cell fate specification of the ventral ectoderm, in the developing embryonic CNS and for embryonic tracheal cell migration. Functions during imaginal development for proper formation of adult structures such as eyes, aristae, L5 wing vein and the tarsal claw. Dephosphorylates drpr isoform A which is required for the inhibition by drpr isoform A of glial cell engulfment of axonal debris produced following axonal injury (PubMed:22426252).3 Publications

Miscellaneous

The PTPase domain is interrupted by a PTPase insert which shares no homologies with other PTPase proteins. This PTPase insert is reminiscent of the kinase insert within the kinase catalytic domains of several receptor tyrosine kinases.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei545SubstrateBy similarity1
Active sitei583Phosphocysteine intermediatePROSITE-ProRule annotation1
Binding sitei630SubstrateBy similarity1

GO - Molecular functioni

  • non-membrane spanning protein tyrosine phosphatase activity Source: FlyBase
  • protein tyrosine phosphatase activity Source: FlyBase

GO - Biological processi

  • anterior/posterior axis specification, embryo Source: FlyBase
  • dephosphorylation Source: FlyBase
  • dorsal/ventral axis specification, ovarian follicular epithelium Source: FlyBase
  • epidermal growth factor receptor signaling pathway Source: FlyBase
  • epithelial cell migration, open tracheal system Source: FlyBase
  • fibroblast growth factor receptor signaling pathway Source: FlyBase
  • imaginal disc development Source: FlyBase
  • mesoderm development Source: FlyBase
  • mitotic cell cycle Source: FlyBase
  • negative regulation of apoptotic process Source: FlyBase
  • open tracheal system development Source: FlyBase
  • phagocytosis, engulfment Source: FlyBase
  • primary branching, open tracheal system Source: FlyBase
  • protein dephosphorylation Source: FlyBase
  • R7 cell fate commitment Source: FlyBase
  • regulation of compound eye photoreceptor development Source: FlyBase
  • sevenless signaling pathway Source: FlyBase
  • terminal region determination Source: UniProtKB
  • torso signaling pathway Source: UniProtKB
  • ventral midline development Source: FlyBase

Keywordsi

Molecular functionDevelopmental protein, Hydrolase, Protein phosphatase

Enzyme and pathway databases

ReactomeiR-DME-109704 PI3K Cascade
R-DME-1257604 PIP3 activates AKT signaling
R-DME-1295596 Spry regulation of FGF signaling
R-DME-1433557 Signaling by SCF-KIT
R-DME-180292 GAB1 signalosome
R-DME-210993 Tie2 Signaling
R-DME-5654689 PI-3K cascade:FGFR1
R-DME-5654693 FRS-mediated FGFR1 signaling
R-DME-5654695 PI-3K cascade:FGFR2
R-DME-5654700 FRS-mediated FGFR2 signaling
R-DME-5654706 FRS-mediated FGFR3 signaling
R-DME-5654710 PI-3K cascade:FGFR3
R-DME-5654712 FRS-mediated FGFR4 signaling
R-DME-5654720 PI-3K cascade:FGFR4
R-DME-5654726 Negative regulation of FGFR1 signaling
R-DME-5654727 Negative regulation of FGFR2 signaling
R-DME-5654732 Negative regulation of FGFR3 signaling
R-DME-5654733 Negative regulation of FGFR4 signaling
R-DME-6798695 Neutrophil degranulation
R-DME-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-DME-8934593 Regulation of RUNX1 Expression and Activity
SignaLinkiP29349

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase corkscrew (EC:3.1.3.48)
Gene namesi
Name:csw
ORF Names:CG3954
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000382 csw

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

RNAi-mediated knockdown in glia results in significantly reduced inhibitory activity of drpr isoform A on glial cell engulfment of axonal debris.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948501 – 845Tyrosine-protein phosphatase corkscrewAdd BLAST845

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei419Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP29349
PRIDEiP29349

PTM databases

iPTMnetiP29349

Expressioni

Tissue specificityi

Expressed uniformly throughout all tissues during embryogenesis.1 Publication

Developmental stagei

Expressed throughout development.1 Publication

Gene expression databases

BgeeiFBgn0000382
ExpressionAtlasiP29349 baseline and differential
GenevisibleiP29349 DM

Interactioni

Subunit structurei

Interacts with drpr isoform A.1 Publication

Protein-protein interaction databases

BioGridi69557, 63 interactors
IntActiP29349, 3 interactors
STRINGi7227.FBpp0070363

Structurei

3D structure databases

ProteinModelPortaliP29349
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 101SH2 1PROSITE-ProRule annotationAdd BLAST96
Domaini111 – 205SH2 2PROSITE-ProRule annotationAdd BLAST95
Domaini227 – 645Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST419

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni289 – 444PTPase insert (Cys/Ser-rich)Add BLAST156
Regioni583 – 589Substrate bindingBy similarity7

Sequence similaritiesi

Keywords - Domaini

Repeat, SH2 domain

Phylogenomic databases

eggNOGiKOG0790 Eukaryota
COG5599 LUCA
GeneTreeiENSGT00910000144001
InParanoidiP29349
KOiK07293
OMAiCAVKSAT
OrthoDBiEOG091G0VZ3
PhylomeDBiP29349

Family and domain databases

Gene3Di3.30.505.10, 2 hits
3.90.190.10, 2 hits
InterProiView protein in InterPro
IPR029021 Prot-tyrosine_phosphatase-like
IPR000242 PTPase_domain
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00017 SH2, 2 hits
PF00102 Y_phosphatase, 2 hits
PRINTSiPR00700 PRTYPHPHTASE
PR00401 SH2DOMAIN
SMARTiView protein in SMART
SM00194 PTPc, 1 hit
SM00404 PTPc_motif, 1 hit
SM00252 SH2, 2 hits
SUPFAMiSSF52799 SSF52799, 2 hits
SSF55550 SSF55550, 2 hits
PROSITEiView protein in PROSITE
PS50001 SH2, 2 hits
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50055 TYR_PHOSPHATASE_PTP, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 2 (identifier: P29349-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSRRWFHPT ISGIEAEKLL QEQGFDGSFL ARLSSSNPGA FTLSVRRGNE
60 70 80 90 100
VTHIKIQNNG DFFDLYGGEK FATLPELVQY YMENGELKEK NGQAIELKQP
110 120 130 140 150
LICAEPTTER WFHGNLSGKE AEKLILERGK NGSFLVRESQ SKPGDFVLSV
160 170 180 190 200
RTDDKVTHVM IRWQDKKYDV GGGESFGTLS ELIDHYKRNP MVETCGTVVH
210 220 230 240 250
LRQPFNATRI TAAGINARVE QLVKGGFWEE FESLQQDSRD TFSRNEGYKQ
260 270 280 290 300
ENRLKNRYRN ILPYDHTRVK LLDVEHSVAG AEYINANYIR LPTDGDLYNM
310 320 330 340 350
SSSSESLNSS VPSCPACTAA QTQRNCSNCQ LQNKTCVQCA VKSAILPYSN
360 370 380 390 400
CATCSRKSDS LSKHKRSESS ASSSPSSGSG SGPGSSGTSG VSSVNGPGTP
410 420 430 440 450
TNLTSGTAGC LVGLLKRHSN DSSGAVSISM AERERERERE MFKTYIATQG
460 470 480 490 500
CLLTQQVNTV TDFWNMVWQE NTRVIVMTTK EYERGKEKCA RYWPDEGRSE
510 520 530 540 550
QFGHARIQCV SENSTSDYTL REFLVSWRDQ PARRIFHYHF QVWPDHGVPA
560 570 580 590 600
DPGCVLNFLQ DVNTRQSHLA QAGEKPGPIC VHCSAGIGRT GTFIVIDMIL
610 620 630 640 650
DQIVRNGLDT EIDIQRTIQM VRSQRSGLVQ TEAQYKFVYY AVQHYIQTLI
660 670 680 690 700
ARKRAEEQSL QVGREYTNIK YTGEIGNDSQ RSPLPPAISS ISLVPSKTPL
710 720 730 740 750
TPTSADLGTG MGLSMGVGMG VGNKHASKQQ PPLPVVNCNN NNNGIGNSGC
760 770 780 790 800
SNGGGSSTTS SSNGSSNGNI NALLGGIGLG LGGNMRKSNF YSDSLKQQQQ
810 820 830 840
REEQAPAGAG KMQQPAPPLR PRPGILKLLT SPVIFQQNSK TFPKT
Length:845
Mass (Da):92,975
Last modified:June 1, 2001 - v2
Checksum:i2147F0F2576202CC
GO
Isoform 1 (identifier: P29349-2) [UniParc]FASTAAdd to basket
Also known as: Y1229, A

The sequence of this isoform differs from the canonical sequence as follows:
     810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT

Show »
Length:841
Mass (Da):92,431
Checksum:i03295DA37A8DA824
GO
Isoform 3 (identifier: P29349-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT

Show »
Length:682
Mass (Da):74,528
Checksum:iCA4F23438AC61598
GO
Isoform 4 (identifier: P29349-4) [UniParc]FASTAAdd to basket
Also known as: 4A, B

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: MSSRRWFHPT...LICAEPTTER → MLFNKCLEKL...TMRVQLHGYT

Show »
Length:945
Mass (Da):103,768
Checksum:iCB95C38AB3038342
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti815P → S in AAB02544 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti119K → T in strain: Kenya-HLa3, Kenya-HLa6, Kakamega-b1 and Makindu-b1. 1 Publication1
Natural varianti749G → S in strain: Ann Arbor1, DP CN BW, Kakamega-b1, Kakamega-b3, Kakamega-b4, Kenya-HLa3, Kenya-HLa6, Makindu-b5 and Reids2. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0051391 – 159Missing in isoform 3. CuratedAdd BLAST159
Alternative sequenceiVSP_0051401 – 110MSSRR…PTTER → MLFNKCLEKLSSSLGNVVNH KLQEKQVYNNNNINNNNNNT LNNNNAYNNQRNFEYERAIQ AHYGSKGRRSEERERSGKFK ASKGRKAKVTPPTETPEAQE PACKNCMTHDELAQIIKGVA KGADAQRNRDNRLQRRRRPL SAQPSAAASASTSTESLHRL TPSPQASYPATPTSWTATPP QFPAAFGGASCSNSTLSLLA TMRVQLHGYT in isoform 4. CuratedAdd BLAST110
Alternative sequenceiVSP_005141810 – 845GKMQQ…TFPKT → AKFKNIPKDMIGLRPPSHAP ALPPPPTPPRKT in isoform 1 and isoform 3. 2 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94730 mRNA Translation: AAA28433.1
U19909 Genomic DNA Translation: AAB02543.1
U19909 Genomic DNA Translation: AAB02544.1
AY135117 Genomic DNA Translation: AAN17607.1
AY135117 Genomic DNA Translation: AAN17608.1
AY135118 Genomic DNA Translation: AAN17609.1
AY135118 Genomic DNA Translation: AAN17610.1
AY135119 Genomic DNA Translation: AAN17611.1
AY135119 Genomic DNA Translation: AAN17612.1
AY135120 Genomic DNA Translation: AAN17613.1
AY135120 Genomic DNA Translation: AAN17614.1
AY135121 Genomic DNA Translation: AAN17615.1
AY135121 Genomic DNA Translation: AAN17616.1
AY135122 Genomic DNA Translation: AAN17617.1
AY135122 Genomic DNA Translation: AAN17618.1
AY135123 Genomic DNA Translation: AAN17619.1
AY135123 Genomic DNA Translation: AAN17620.1
AY135124 Genomic DNA Translation: AAN17621.1
AY135124 Genomic DNA Translation: AAN17622.1
AY135125 Genomic DNA Translation: AAN17623.1
AY135125 Genomic DNA Translation: AAN17624.1
AY135126 Genomic DNA Translation: AAN17625.1
AY135126 Genomic DNA Translation: AAN17626.1
AY135127 Genomic DNA Translation: AAN17627.1
AY135127 Genomic DNA Translation: AAN17628.1
AY135128 Genomic DNA Translation: AAN17629.1
AY135128 Genomic DNA Translation: AAN17630.1
AY135129 Genomic DNA Translation: AAN17631.1
AY135129 Genomic DNA Translation: AAN17632.1
AY135130 Genomic DNA Translation: AAN17633.1
AY135130 Genomic DNA Translation: AAN17634.1
AY135131 Genomic DNA Translation: AAN17635.1
AY135131 Genomic DNA Translation: AAN17636.1
AY135132 Genomic DNA Translation: AAN17637.1
AY135132 Genomic DNA Translation: AAN17638.1
AY135133 Genomic DNA Translation: AAN17639.1
AY135133 Genomic DNA Translation: AAN17640.1
AY135134 Genomic DNA Translation: AAN17641.1
AY135134 Genomic DNA Translation: AAN17642.1
AE014298 Genomic DNA Translation: AAF45724.2
AE014298 Genomic DNA Translation: AAG22389.2
AE014298 Genomic DNA Translation: AAF45725.1
AL132797 Genomic DNA Translation: CAB65870.1
AL132797 Genomic DNA Translation: CAB65871.1
BT001484 mRNA Translation: AAN71239.1
PIRiA43254
RefSeqiNP_477130.1, NM_057782.5 [P29349-2]
NP_477131.1, NM_057783.3 [P29349-4]
NP_726793.1, NM_166928.2 [P29349-3]
UniGeneiDm.5129

Genome annotation databases

EnsemblMetazoaiFBtr0070378; FBpp0070362; FBgn0000382 [P29349-2]
FBtr0070379; FBpp0070363; FBgn0000382 [P29349-4]
FBtr0070380; FBpp0070364; FBgn0000382 [P29349-3]
GeneIDi45278
KEGGidme:Dmel_CG3954

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCSW_DROME
AccessioniPrimary (citable) accession number: P29349
Secondary accession number(s): Q24032
, Q24033, Q8I074, Q8I0H8, Q8I0S4, Q8ISD5, Q8ISD6, Q9V3H1, Q9W524
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: June 1, 2001
Last modified: May 23, 2018
This is version 183 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health