SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P29349

- CSW_DROME

UniProt

P29349 - CSW_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tyrosine-protein phosphatase corkscrew

Gene
csw, CG3954
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required in all receptor tyrosine kinase signaling pathways. Functions downstream of the receptor tyrosine kinase torso, acting in concert with D-Raf via tailless. Also functions downstream of Egfr (epidermal growth factor receptor) and btl (fibroblast growth factor receptor). The SH2 domain suggests that csw effects its role by mediating heteromeric protein interactions. Maternally required for normal determination of cell fates at the termini of the embryo. Required for cell fate specification of the ventral ectoderm, in the developing embryonic CNS and for embryonic tracheal cell migration. Functions during imaginal development for proper formation of adult structures such as eyes, aristae, L5 wing vein and the tarsal claw.2 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei545 – 5451Substrate By similarity
Active sitei583 – 5831Phosphocysteine intermediate By similarity
Binding sitei630 – 6301Substrate By similarity

GO - Molecular functioni

  1. non-membrane spanning protein tyrosine phosphatase activity Source: UniProtKB
  2. protein binding Source: FlyBase
  3. protein tyrosine phosphatase activity Source: FlyBase
  4. receptor signaling protein tyrosine phosphatase activity Source: FlyBase

GO - Biological processi

  1. anterior/posterior axis specification, embryo Source: FlyBase
  2. dephosphorylation Source: FlyBase
  3. dorsal/ventral axis specification, ovarian follicular epithelium Source: FlyBase
  4. epidermal growth factor receptor signaling pathway Source: FlyBase
  5. epithelial cell migration, open tracheal system Source: FlyBase
  6. fibroblast growth factor receptor signaling pathway Source: FlyBase
  7. imaginal disc development Source: FlyBase
  8. mesoderm development Source: FlyBase
  9. mitotic cell cycle Source: FlyBase
  10. negative regulation of apoptotic process Source: FlyBase
  11. open tracheal system development Source: FlyBase
  12. peptidyl-tyrosine dephosphorylation Source: GOC
  13. phagocytosis, engulfment Source: FlyBase
  14. primary branching, open tracheal system Source: FlyBase
  15. protein dephosphorylation Source: FlyBase
  16. R7 cell fate commitment Source: FlyBase
  17. regulation of compound eye photoreceptor development Source: FlyBase
  18. sevenless signaling pathway Source: FlyBase
  19. signal transduction by phosphorylation Source: GOC
  20. terminal region determination Source: UniProtKB
  21. torso signaling pathway Source: UniProtKB
  22. ventral midline development Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Hydrolase, Protein phosphatase

Enzyme and pathway databases

ReactomeiREACT_180238. Spry regulation of FGF signaling.
REACT_180240. Negative regulation of FGFR signaling.
REACT_181975. GAB1 signalosome.
REACT_184384. Constitutive PI3K/AKT Signaling in Cancer.
REACT_217505. FRS2-mediated cascade.
REACT_226659. PI3K Cascade.
REACT_85224. Interleukin-3, 5 and GM-CSF signaling.
REACT_86289. Netrin mediated repulsion signals.
SignaLinkiP29349.

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase corkscrew (EC:3.1.3.48)
Gene namesi
Name:csw
ORF Names:CG3954
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000382. csw.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 845845Tyrosine-protein phosphatase corkscrewPRO_0000094850Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei419 – 4191Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP29349.

Expressioni

Tissue specificityi

Expressed uniformly throughout all tissues during embryogenesis.1 Publication

Developmental stagei

Expressed throughout development.1 Publication

Gene expression databases

BgeeiP29349.

Interactioni

Protein-protein interaction databases

BioGridi69557. 24 interactions.
IntActiP29349. 3 interactions.
MINTiMINT-783734.

Structurei

3D structure databases

ProteinModelPortaliP29349.
SMRiP29349. Positions 3-289, 415-649.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 10196SH2 1Add
BLAST
Domaini111 – 20595SH2 2Add
BLAST
Domaini227 – 645419Tyrosine-protein phosphataseAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni289 – 444156PTPase insert (Cys/Ser-rich)Add
BLAST
Regioni583 – 5897Substrate binding By similarity

Sequence similaritiesi

Contains 2 SH2 domains.

Keywords - Domaini

Repeat, SH2 domain

Phylogenomic databases

eggNOGiCOG5599.
InParanoidiP29349.
KOiK07293.
OrthoDBiEOG7NPFST.
PhylomeDBiP29349.

Family and domain databases

Gene3Di3.30.505.10. 2 hits.
3.90.190.10. 2 hits.
InterProiIPR029021. Prot-tyrosine_phosphatase-like.
IPR000980. SH2.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00017. SH2. 2 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
PR00401. SH2DOMAIN.
SMARTiSM00194. PTPc. 1 hit.
SM00252. SH2. 2 hits.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
SSF55550. SSF55550. 2 hits.
PROSITEiPS50001. SH2. 2 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 2 (identifier: P29349-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSRRWFHPT ISGIEAEKLL QEQGFDGSFL ARLSSSNPGA FTLSVRRGNE    50
VTHIKIQNNG DFFDLYGGEK FATLPELVQY YMENGELKEK NGQAIELKQP 100
LICAEPTTER WFHGNLSGKE AEKLILERGK NGSFLVRESQ SKPGDFVLSV 150
RTDDKVTHVM IRWQDKKYDV GGGESFGTLS ELIDHYKRNP MVETCGTVVH 200
LRQPFNATRI TAAGINARVE QLVKGGFWEE FESLQQDSRD TFSRNEGYKQ 250
ENRLKNRYRN ILPYDHTRVK LLDVEHSVAG AEYINANYIR LPTDGDLYNM 300
SSSSESLNSS VPSCPACTAA QTQRNCSNCQ LQNKTCVQCA VKSAILPYSN 350
CATCSRKSDS LSKHKRSESS ASSSPSSGSG SGPGSSGTSG VSSVNGPGTP 400
TNLTSGTAGC LVGLLKRHSN DSSGAVSISM AERERERERE MFKTYIATQG 450
CLLTQQVNTV TDFWNMVWQE NTRVIVMTTK EYERGKEKCA RYWPDEGRSE 500
QFGHARIQCV SENSTSDYTL REFLVSWRDQ PARRIFHYHF QVWPDHGVPA 550
DPGCVLNFLQ DVNTRQSHLA QAGEKPGPIC VHCSAGIGRT GTFIVIDMIL 600
DQIVRNGLDT EIDIQRTIQM VRSQRSGLVQ TEAQYKFVYY AVQHYIQTLI 650
ARKRAEEQSL QVGREYTNIK YTGEIGNDSQ RSPLPPAISS ISLVPSKTPL 700
TPTSADLGTG MGLSMGVGMG VGNKHASKQQ PPLPVVNCNN NNNGIGNSGC 750
SNGGGSSTTS SSNGSSNGNI NALLGGIGLG LGGNMRKSNF YSDSLKQQQQ 800
REEQAPAGAG KMQQPAPPLR PRPGILKLLT SPVIFQQNSK TFPKT 845
Length:845
Mass (Da):92,975
Last modified:June 1, 2001 - v2
Checksum:i2147F0F2576202CC
GO
Isoform 1 (identifier: P29349-2) [UniParc]FASTAAdd to Basket

Also known as: Y1229, A

The sequence of this isoform differs from the canonical sequence as follows:
     810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT

Show »
Length:841
Mass (Da):92,431
Checksum:i03295DA37A8DA824
GO
Isoform 3 (identifier: P29349-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT

Show »
Length:682
Mass (Da):74,528
Checksum:iCA4F23438AC61598
GO
Isoform 4 (identifier: P29349-4) [UniParc]FASTAAdd to Basket

Also known as: 4A, B

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: MSSRRWFHPT...LICAEPTTER → MLFNKCLEKL...TMRVQLHGYT

Show »
Length:945
Mass (Da):103,768
Checksum:iCB95C38AB3038342
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti119 – 1191K → T in strain: Kenya-HLa3, Kenya-HLa6, Kakamega-b1 and Makindu-b1. 1 Publication
Natural varianti749 – 7491G → S in strain: Ann Arbor1, DP CN BW, Kakamega-b1, Kakamega-b3, Kakamega-b4, Kenya-HLa3, Kenya-HLa6, Makindu-b5 and Reids2. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 3. VSP_005139Add
BLAST
Alternative sequencei1 – 110110MSSRR…PTTER → MLFNKCLEKLSSSLGNVVNH KLQEKQVYNNNNINNNNNNT LNNNNAYNNQRNFEYERAIQ AHYGSKGRRSEERERSGKFK ASKGRKAKVTPPTETPEAQE PACKNCMTHDELAQIIKGVA KGADAQRNRDNRLQRRRRPL SAQPSAAASASTSTESLHRL TPSPQASYPATPTSWTATPP QFPAAFGGASCSNSTLSLLA TMRVQLHGYT in isoform 4. VSP_005140Add
BLAST
Alternative sequencei810 – 84536GKMQQ…TFPKT → AKFKNIPKDMIGLRPPSHAP ALPPPPTPPRKT in isoform 1 and isoform 3. VSP_005141Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti815 – 8151P → S in AAB02544. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M94730 mRNA. Translation: AAA28433.1.
U19909 Genomic DNA. Translation: AAB02543.1.
U19909 Genomic DNA. Translation: AAB02544.1.
AY135117 Genomic DNA. Translation: AAN17607.1.
AY135117 Genomic DNA. Translation: AAN17608.1.
AY135118 Genomic DNA. Translation: AAN17609.1.
AY135118 Genomic DNA. Translation: AAN17610.1.
AY135119 Genomic DNA. Translation: AAN17611.1.
AY135119 Genomic DNA. Translation: AAN17612.1.
AY135120 Genomic DNA. Translation: AAN17613.1.
AY135120 Genomic DNA. Translation: AAN17614.1.
AY135121 Genomic DNA. Translation: AAN17615.1.
AY135121 Genomic DNA. Translation: AAN17616.1.
AY135122 Genomic DNA. Translation: AAN17617.1.
AY135122 Genomic DNA. Translation: AAN17618.1.
AY135123 Genomic DNA. Translation: AAN17619.1.
AY135123 Genomic DNA. Translation: AAN17620.1.
AY135124 Genomic DNA. Translation: AAN17621.1.
AY135124 Genomic DNA. Translation: AAN17622.1.
AY135125 Genomic DNA. Translation: AAN17623.1.
AY135125 Genomic DNA. Translation: AAN17624.1.
AY135126 Genomic DNA. Translation: AAN17625.1.
AY135126 Genomic DNA. Translation: AAN17626.1.
AY135127 Genomic DNA. Translation: AAN17627.1.
AY135127 Genomic DNA. Translation: AAN17628.1.
AY135128 Genomic DNA. Translation: AAN17629.1.
AY135128 Genomic DNA. Translation: AAN17630.1.
AY135129 Genomic DNA. Translation: AAN17631.1.
AY135129 Genomic DNA. Translation: AAN17632.1.
AY135130 Genomic DNA. Translation: AAN17633.1.
AY135130 Genomic DNA. Translation: AAN17634.1.
AY135131 Genomic DNA. Translation: AAN17635.1.
AY135131 Genomic DNA. Translation: AAN17636.1.
AY135132 Genomic DNA. Translation: AAN17637.1.
AY135132 Genomic DNA. Translation: AAN17638.1.
AY135133 Genomic DNA. Translation: AAN17639.1.
AY135133 Genomic DNA. Translation: AAN17640.1.
AY135134 Genomic DNA. Translation: AAN17641.1.
AY135134 Genomic DNA. Translation: AAN17642.1.
AE014298 Genomic DNA. Translation: AAF45724.2.
AE014298 Genomic DNA. Translation: AAG22389.2.
AE014298 Genomic DNA. Translation: AAF45725.1.
AL132797 Genomic DNA. Translation: CAB65870.1.
AL132797 Genomic DNA. Translation: CAB65871.1.
BT001484 mRNA. Translation: AAN71239.1.
PIRiA43254.
RefSeqiNP_477130.1. NM_057782.4. [P29349-2]
NP_477131.1. NM_057783.3. [P29349-4]
NP_726793.1. NM_166928.1. [P29349-3]
UniGeneiDm.5129.

Genome annotation databases

GeneIDi45278.
KEGGidme:Dmel_CG3954.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M94730 mRNA. Translation: AAA28433.1 .
U19909 Genomic DNA. Translation: AAB02543.1 .
U19909 Genomic DNA. Translation: AAB02544.1 .
AY135117 Genomic DNA. Translation: AAN17607.1 .
AY135117 Genomic DNA. Translation: AAN17608.1 .
AY135118 Genomic DNA. Translation: AAN17609.1 .
AY135118 Genomic DNA. Translation: AAN17610.1 .
AY135119 Genomic DNA. Translation: AAN17611.1 .
AY135119 Genomic DNA. Translation: AAN17612.1 .
AY135120 Genomic DNA. Translation: AAN17613.1 .
AY135120 Genomic DNA. Translation: AAN17614.1 .
AY135121 Genomic DNA. Translation: AAN17615.1 .
AY135121 Genomic DNA. Translation: AAN17616.1 .
AY135122 Genomic DNA. Translation: AAN17617.1 .
AY135122 Genomic DNA. Translation: AAN17618.1 .
AY135123 Genomic DNA. Translation: AAN17619.1 .
AY135123 Genomic DNA. Translation: AAN17620.1 .
AY135124 Genomic DNA. Translation: AAN17621.1 .
AY135124 Genomic DNA. Translation: AAN17622.1 .
AY135125 Genomic DNA. Translation: AAN17623.1 .
AY135125 Genomic DNA. Translation: AAN17624.1 .
AY135126 Genomic DNA. Translation: AAN17625.1 .
AY135126 Genomic DNA. Translation: AAN17626.1 .
AY135127 Genomic DNA. Translation: AAN17627.1 .
AY135127 Genomic DNA. Translation: AAN17628.1 .
AY135128 Genomic DNA. Translation: AAN17629.1 .
AY135128 Genomic DNA. Translation: AAN17630.1 .
AY135129 Genomic DNA. Translation: AAN17631.1 .
AY135129 Genomic DNA. Translation: AAN17632.1 .
AY135130 Genomic DNA. Translation: AAN17633.1 .
AY135130 Genomic DNA. Translation: AAN17634.1 .
AY135131 Genomic DNA. Translation: AAN17635.1 .
AY135131 Genomic DNA. Translation: AAN17636.1 .
AY135132 Genomic DNA. Translation: AAN17637.1 .
AY135132 Genomic DNA. Translation: AAN17638.1 .
AY135133 Genomic DNA. Translation: AAN17639.1 .
AY135133 Genomic DNA. Translation: AAN17640.1 .
AY135134 Genomic DNA. Translation: AAN17641.1 .
AY135134 Genomic DNA. Translation: AAN17642.1 .
AE014298 Genomic DNA. Translation: AAF45724.2 .
AE014298 Genomic DNA. Translation: AAG22389.2 .
AE014298 Genomic DNA. Translation: AAF45725.1 .
AL132797 Genomic DNA. Translation: CAB65870.1 .
AL132797 Genomic DNA. Translation: CAB65871.1 .
BT001484 mRNA. Translation: AAN71239.1 .
PIRi A43254.
RefSeqi NP_477130.1. NM_057782.4. [P29349-2 ]
NP_477131.1. NM_057783.3. [P29349-4 ]
NP_726793.1. NM_166928.1. [P29349-3 ]
UniGenei Dm.5129.

3D structure databases

ProteinModelPortali P29349.
SMRi P29349. Positions 3-289, 415-649.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 69557. 24 interactions.
IntActi P29349. 3 interactions.
MINTi MINT-783734.

Proteomic databases

PaxDbi P29349.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 45278.
KEGGi dme:Dmel_CG3954.

Organism-specific databases

CTDi 45278.
FlyBasei FBgn0000382. csw.

Phylogenomic databases

eggNOGi COG5599.
InParanoidi P29349.
KOi K07293.
OrthoDBi EOG7NPFST.
PhylomeDBi P29349.

Enzyme and pathway databases

Reactomei REACT_180238. Spry regulation of FGF signaling.
REACT_180240. Negative regulation of FGFR signaling.
REACT_181975. GAB1 signalosome.
REACT_184384. Constitutive PI3K/AKT Signaling in Cancer.
REACT_217505. FRS2-mediated cascade.
REACT_226659. PI3K Cascade.
REACT_85224. Interleukin-3, 5 and GM-CSF signaling.
REACT_86289. Netrin mediated repulsion signals.
SignaLinki P29349.

Miscellaneous databases

GenomeRNAii 45278.
NextBioi 837970.
PROi P29349.

Gene expression databases

Bgeei P29349.

Family and domain databases

Gene3Di 3.30.505.10. 2 hits.
3.90.190.10. 2 hits.
InterProi IPR029021. Prot-tyrosine_phosphatase-like.
IPR000980. SH2.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00017. SH2. 2 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
PR00401. SH2DOMAIN.
SMARTi SM00194. PTPc. 1 hit.
SM00252. SH2. 2 hits.
[Graphical view ]
SUPFAMi SSF52799. SSF52799. 2 hits.
SSF55550. SSF55550. 2 hits.
PROSITEi PS50001. SH2. 2 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Corkscrew encodes a putative protein tyrosine phosphatase that functions to transduce the terminal signal from the receptor tyrosine kinase torso."
    Perkins L.A., Larsen I., Perrimon N.
    Cell 70:225-236(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Embryo.
  2. "The role of the Drosophila corkscrew protein as a transducer downstream of receptor tyrosine kinases is functionally conserved."
    Melnick M.B., Melnick C.B., Larsen I., Perrimon N., Perkins L.A.
    Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 4).
    Strain: DP CN BW.
  3. "Contrasting selection pressures on components of the Ras-mediated signal transduction pathway in Drosophila."
    Riley R.M., Jin W., Gibson G.
    Mol. Ecol. 12:1315-1323(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 2 AND 4), VARIANTS THR-119 AND SER-749.
    Strain: 10A, Ann Arbor1, Ann Arbor20, Ann Arbor3, Ann Arbor6, Kakamega-b1, Kakamega-b3, Kakamega-b4, Kenya-HLa3, Kenya-HLa6, Kenya-HLb1, M2, Makindu-b1, Makindu-b5, Nairobi-a, PYR2, Reids2 and Sapporo.
  4. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1; 2 AND 4).
    Strain: Berkeley.
  5. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1 AND 4).
    Strain: Oregon-R.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Berkeley.
    Tissue: Ovary.
  8. "The nonreceptor protein tyrosine phosphatase corkscrew functions in multiple receptor tyrosine kinase pathways in Drosophila."
    Perkins L.A., Johnson M.R., Melnick M.B., Perrimon N.
    Dev. Biol. 180:63-81(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Phosphoproteome analysis of Drosophila melanogaster embryos."
    Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
    J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-419, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiCSW_DROME
AccessioniPrimary (citable) accession number: P29349
Secondary accession number(s): Q24032
, Q24033, Q8I074, Q8I0H8, Q8I0S4, Q8ISD5, Q8ISD6, Q9V3H1, Q9W524
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: June 1, 2001
Last modified: September 3, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Miscellaneous

The PTPase domain is interrupted by a PTPase insert which shares no homologies with other PTPase proteins. This PTPase insert is reminiscent of the kinase insert within the kinase catalytic domains of several receptor tyrosine kinases.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi