P29349 (CSW_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase corkscrew EC=3.1.3.48 | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 845 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required in all receptor tyrosine kinase signaling pathways. Functions downstream of the receptor tyrosine kinase torso, acting in concert with D-Raf via tailless. Also functions downstream of Egfr (epidermal growth factor receptor) and btl (fibroblast growth factor receptor). The SH2 domain suggests that csw effects its role by mediating heteromeric protein interactions. Maternally required for normal determination of cell fates at the termini of the embryo. Required for cell fate specification of the ventral ectoderm, in the developing embryonic CNS and for embryonic tracheal cell migration. Functions during imaginal development for proper formation of adult structures such as eyes, aristae, L5 wing vein and the tarsal claw. Ref.1 Ref.8 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subcellular location | |
| Tissue specificity | Expressed uniformly throughout all tissues during embryogenesis. Ref.1 |
| Developmental stage | Expressed throughout development. Ref.1 |
| Miscellaneous | The PTPase domain is interrupted by a PTPase insert which shares no homologies with other PTPase proteins. This PTPase insert is reminiscent of the kinase insert within the kinase catalytic domains of several receptor tyrosine kinases. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily. Contains 2 SH2 domains. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 2 (identifier: P29349-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P29349-2) Also known as: Y1229; A; The sequence of this isoform differs from the canonical sequence as follows: 810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT | ||||||
| Isoform 3 (identifier: P29349-3) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 1-159: Missing. 810-845: GKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT → AKFKNIPKDMIGLRPPSHAPALPPPPTPPRKT | ||||||
| Isoform 4 (identifier: P29349-4) Also known as: 4A; B; The sequence of this isoform differs from the canonical sequence as follows: 1-110: MSSRRWFHPT...LICAEPTTER → MLFNKCLEKL...TMRVQLHGYT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 845 | 845 | Tyrosine-protein phosphatase corkscrew | PRO_0000094850 | |||||
Regions | |||||||||
| Domain | 6 – 101 | 96 | SH2 1 | ||||||
| Domain | 111 – 205 | 95 | SH2 2 | ||||||
| Domain | 227 – 645 | 419 | Tyrosine-protein phosphatase | ||||||
| Region | 289 – 444 | 156 | PTPase insert (Cys/Ser-rich) | ||||||
| Region | 583 – 589 | 7 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 583 | 1 | Phosphocysteine intermediate By similarity | ||||||
| Binding site | 545 | 1 | Substrate By similarity | ||||||
| Binding site | 630 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 419 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 159 | 159 | Missing in isoform 3. | VSP_005139 | |||||
| Alternative sequence | 1 – 110 | 110 | MSSRR…PTTER → MLFNKCLEKLSSSLGNVVNH KLQEKQVYNNNNINNNNNNT LNNNNAYNNQRNFEYERAIQ AHYGSKGRRSEERERSGKFK ASKGRKAKVTPPTETPEAQE PACKNCMTHDELAQIIKGVA KGADAQRNRDNRLQRRRRPL SAQPSAAASASTSTESLHRL TPSPQASYPATPTSWTATPP QFPAAFGGASCSNSTLSLLA TMRVQLHGYT in isoform 4. | VSP_005140 | |||||
| Alternative sequence | 810 – 845 | 36 | GKMQQ…TFPKT → AKFKNIPKDMIGLRPPSHAP ALPPPPTPPRKT in isoform 1 and isoform 3. | VSP_005141 | |||||
| Natural variant | 119 | 1 | K → T in strain: Kenya-HLa3, Kenya-HLa6, Kakamega-b1 and Makindu-b1. Ref.3 | ||||||
| Natural variant | 749 | 1 | G → S in strain: Ann Arbor1, DP CN BW, Kakamega-b1, Kakamega-b3, Kakamega-b4, Kenya-HLa3, Kenya-HLa6, Makindu-b5 and Reids2. Ref.3 | ||||||
Experimental info | |||||||||
| Sequence conflict | 815 | 1 | P → S in AAB02544. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Corkscrew encodes a putative protein tyrosine phosphatase that functions to transduce the terminal signal from the receptor tyrosine kinase torso." Perkins L.A., Larsen I., Perrimon N. Cell 70:225-236(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Embryo. |
| [2] | "The role of the Drosophila corkscrew protein as a transducer downstream of receptor tyrosine kinases is functionally conserved." Melnick M.B., Melnick C.B., Larsen I., Perrimon N., Perkins L.A. Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 4). Strain: DP CN BW. |
| [3] | "Contrasting selection pressures on components of the Ras-mediated signal transduction pathway in Drosophila." Riley R.M., Jin W., Gibson G. Mol. Ecol. 12:1315-1323(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 2 AND 4), VARIANTS THR-119 AND SER-749. Strain: 10A, Ann Arbor1, Ann Arbor20, Ann Arbor3, Ann Arbor6, Kakamega-b1, Kakamega-b3, Kakamega-b4, Kenya-HLa3, Kenya-HLa6, Kenya-HLb1, M2, Makindu-b1, Makindu-b5, Nairobi-a, PYR2, Reids2 and Sapporo. |
| [4] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1; 2 AND 4). Strain: Berkeley. |
| [5] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [6] | "From sequence to chromosome: the tip of the X chromosome of D. melanogaster." Benos P.V., Gatt M.K., Ashburner M., Murphy L., Harris D., Barrell B.G., Ferraz C., Vidal S., Brun C., Demailles J., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Borkova D., Minana B. Glover D.M.Science 287:2220-2222(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1 AND 4). Strain: Oregon-R. |
| [7] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Berkeley. Tissue: Ovary. |
| [8] | "The nonreceptor protein tyrosine phosphatase corkscrew functions in multiple receptor tyrosine kinase pathways in Drosophila." Perkins L.A., Johnson M.R., Melnick M.B., Perrimon N. Dev. Biol. 180:63-81(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-419, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M94730 mRNA. Translation: AAA28433.1. U19909 Genomic DNA. Translation: AAB02543.1. U19909 Genomic DNA. Translation: AAB02544.1. AY135117 Genomic DNA. Translation: AAN17607.1. AY135117 Genomic DNA. Translation: AAN17608.1. AY135118 Genomic DNA. Translation: AAN17609.1. AY135118 Genomic DNA. Translation: AAN17610.1. AY135119 Genomic DNA. Translation: AAN17611.1. AY135119 Genomic DNA. Translation: AAN17612.1. AY135120 Genomic DNA. Translation: AAN17613.1. AY135120 Genomic DNA. Translation: AAN17614.1. AY135121 Genomic DNA. Translation: AAN17615.1. AY135121 Genomic DNA. Translation: AAN17616.1. AY135122 Genomic DNA. Translation: AAN17617.1. AY135122 Genomic DNA. Translation: AAN17618.1. AY135123 Genomic DNA. Translation: AAN17619.1. AY135123 Genomic DNA. Translation: AAN17620.1. AY135124 Genomic DNA. Translation: AAN17621.1. AY135124 Genomic DNA. Translation: AAN17622.1. AY135125 Genomic DNA. Translation: AAN17623.1. AY135125 Genomic DNA. Translation: AAN17624.1. AY135126 Genomic DNA. Translation: AAN17625.1. AY135126 Genomic DNA. Translation: AAN17626.1. AY135127 Genomic DNA. Translation: AAN17627.1. AY135127 Genomic DNA. Translation: AAN17628.1. AY135128 Genomic DNA. Translation: AAN17629.1. AY135128 Genomic DNA. Translation: AAN17630.1. AY135129 Genomic DNA. Translation: AAN17631.1. AY135129 Genomic DNA. Translation: AAN17632.1. AY135130 Genomic DNA. Translation: AAN17633.1. AY135130 Genomic DNA. Translation: AAN17634.1. AY135131 Genomic DNA. Translation: AAN17635.1. AY135131 Genomic DNA. Translation: AAN17636.1. AY135132 Genomic DNA. Translation: AAN17637.1. AY135132 Genomic DNA. Translation: AAN17638.1. AY135133 Genomic DNA. Translation: AAN17639.1. AY135133 Genomic DNA. Translation: AAN17640.1. AY135134 Genomic DNA. Translation: AAN17641.1. AY135134 Genomic DNA. Translation: AAN17642.1. AE014298 Genomic DNA. Translation: AAF45724.2. AE014298 Genomic DNA. Translation: AAG22389.2. AE014298 Genomic DNA. Translation: AAF45725.1. AL132797 Genomic DNA. Translation: CAB65870.1. AL132797 Genomic DNA. Translation: CAB65871.1. BT001484 mRNA. Translation: AAN71239.1. |
| PIR | A43254. |
| RefSeq | NP_477130.1. NM_057782.4. NP_477131.1. NM_057783.3. NP_726793.1. NM_166928.1. |
| UniGene | Dm.5129. |
3D structure databases | |
| ProteinModelPortal | P29349. |
| SMR | P29349. Positions 3-649. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P29349. 3 interactions. |
| MINT | MINT-783734. |
Proteomic databases | |
| PaxDb | P29349. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 45278. |
| KEGG | dme:Dmel_CG3954. |
Organism-specific databases | |
| CTD | 45278. |
| FlyBase | FBgn0000382. csw. |
Phylogenomic databases | |
| eggNOG | COG5599. |
| InParanoid | P29349. |
| KO | K07293. |
| OMA | CAVKSAT. |
| OrthoDB | EOG4PVMDK. |
Enzyme and pathway databases | |
| SignaLink | P29349. |
Gene expression databases | |
| Bgee | P29349. |
| GermOnline | CG3954. Drosophila melanogaster. |
Family and domain databases | |
| Gene3D | 3.30.505.10. 2 hits. |
| InterPro | IPR000980. SH2. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] |
| Pfam | PF00017. SH2. 2 hits. PF00102. Y_phosphatase. 2 hits. [Graphical view] |
| PRINTS | PR00700. PRTYPHPHTASE. PR00401. SH2DOMAIN. |
| SMART | SM00194. PTPc. 1 hit. SM00252. SH2. 2 hits. [Graphical view] |
| PROSITE | PS50001. SH2. 2 hits. PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 45278. |
| NextBio | 837970. |
Entry information
| Entry name | CSW_DROME | ||||||||
| Accession | Primary (citable) accession number: P29349 Secondary accession number(s): Q24032 Q9W524 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
