P29218 (IMPA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inositol monophosphatase 1 Short name=IMP 1 Short name=IMPase 1 EC=3.1.3.25 Alternative name(s): Inositol-1(or 4)-monophosphatase 1 Lithium-sensitive myo-inositol monophosphatase A1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 277 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. Can use myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Ref.9 |
| Catalytic activity | Myo-inositol phosphate + H2O = myo-inositol + phosphate. |
| Cofactor | Magnesium. Ref.9 |
| Enzyme regulation | Inhibited by Li+. Ref.9 |
| Pathway | Polyol metabolism; myo-inositol biosynthesis; myo-inositol from D-glucose 6-phosphate: step 2/2. |
| Subunit structure | Homodimer. |
| Subcellular location | |
| Sequence similarities | Belongs to the inositol monophosphatase family. |
| Biophysicochemical properties | pH dependence: Optimum pH is 7.0-7.5. Ref.9 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-752410,EBI-752410 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P29218-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P29218-2) The sequence of this isoform differs from the canonical sequence as follows: 153-277: DITKSLLVTE...VIPLQRDDED → GSGVLEQQLL...ALLLLKLVAC | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P29218-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGQRPGPVLPAVAVLGQVAKRKVAWLLRWKAVTRTETAGNSSGVYGFGKMKIFVKYFQKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 277 | 277 | Inositol monophosphatase 1 | PRO_0000142513 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 92 – 95 | 4 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 194 – 196 | 3 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 70 | 1 | Magnesium 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 90 | 1 | Magnesium 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 90 | 1 | Magnesium 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 92 | 1 | Magnesium 1; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 93 | 1 | Magnesium 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 220 | 1 | Magnesium 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 70 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 213 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 220 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGQRPGPVLPAVAVLGQVAK RKVAWLLRWKAVTRTETAGN SSGVYGFGKMKIFVKYFQKM in isoform 3. | VSP_046308 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 153 – 277 | 125 | DITKS…RDDED → GSGVLEQQLLICALWQLAEQ MHIMKWEFTAGMLQELALLL LKLVAC in isoform 2. | VSP_042521 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 109 | 1 | I → V. Corresponds to variant rs204781 [ dbSNP | Ensembl ]. | VAR_049600 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 36 | 1 | K → Q: 50-fold reduction in activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 93 | 1 | D → N: Loss of activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform 3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 17 | 1 | Q → R in BAH13340. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 4 – 26 | 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 38 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 43 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 45 – 61 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 69 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 70 – 74 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 93 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 95 – 100 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 113 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 124 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 125 – 128 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 134 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 135 – 137 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 138 – 141 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 154 – 156 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 158 – 160 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 183 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 184 – 186 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 192 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 196 – 204 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 207 – 215 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 218 – 230 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 234 – 236 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 240 – 242 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 247 – 255 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 265 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of human and rat brain myo-inositol monophosphatase. Expression and characterization of the human recombinant enzyme." McAllister G., Whiting P., Hammond E.A., Knowles M.R., Atack J.R., Bailey F.J., Maigetter R., Ragan C.I. Biochem. J. 284:749-754(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [2] | "Genomic structure and chromosomal localization of a human myo-inositol monophosphatase gene (IMPA)." Sjoeholt G., Molven A., Loevlie R., Wilcox A., Sikela J.M., Steen V.M. Genomics 45:113-122(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Molecular cloning and expression of human cerebral cortex myo-inositol monophosphatase A1 cDNA." Parthasarathy R., Parthasarathy L., Vadnal R.E. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Thymus and Umbilical cord blood. |
| [5] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Urinary bladder. |
| [8] | "Molecular cloning, genomic organization and promoter analysis of the human brain lithium-sensitive myo-inositol monophosphatase A1 isoenzyme." Parthasarathy L., Parthasarathy R. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20. |
| [9] | "Spatial expression patterns and biochemical properties distinguish a second myo-inositol monophosphatase IMPA2 from IMPA1." Ohnishi T., Ohba H., Seo K.-C., Im J., Sato Y., Iwayama Y., Furuichi T., Chung S.-K., Yoshikawa T. J. Biol. Chem. 282:637-646(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, MUTAGENESIS OF ASP-93. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Structure of inositol monophosphatase, the putative target of lithium therapy." Bone R., Springer J.P., Atack J.R. Proc. Natl. Acad. Sci. U.S.A. 89:10031-10035(1992) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) IN COMPLEX WITH MAGNESIUM IONS. |
| [14] | "Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis." Bone R., Frank L., Springer J.P., Atack J.R. Biochemistry 33:9468-9476(1994) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) IN COMPLEX WITH SUBSTRATE. |
| [15] | "The contribution of lysine-36 to catalysis by human myo-inositol monophosphatase." Ganzhorn A.J., Lepage P., Pelton P.D., Strasser F., Vincendon P., Rondeau J.-M. Biochemistry 35:10957-10966(1996) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF MUTANT GLN-36, MUTAGENESIS OF LYS-36. |
| [16] | "Structure of an enzyme-substrate complex and the catalytic mechanism of human brain myo-inositol monophosphatase." Ganzhorn A.J., Rondeau J.-M. Protein Eng. 10:61-70(1997) Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X66922 mRNA. Translation: CAA47359.1. Y11360 Y11366 Genomic DNA. Translation: CAA72195.1.AF042729 mRNA. Translation: AAB97468.1. AK297078 mRNA. Translation: BAG59595.1. AK300750 mRNA. Translation: BAH13340.1. AK312823 mRNA. Translation: BAG35680.1. AC090255 Genomic DNA. No translation available. CH471068 Genomic DNA. Translation: EAW87095.1. BC008381 mRNA. Translation: AAH08381.1. BC009565 mRNA. Translation: AAH09565.1. AF178754 Genomic DNA. Translation: AAD52997.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00020906. IPI00791997. IPI00921428. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S23130. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001138350.1. NM_001144878.1. NP_001138351.1. NM_001144879.1. NP_005527.1. NM_005536.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.656694. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1480285. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000408526. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 127717. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00020906. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCD-2DPAGE | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 3612. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000256108; ENSP00000256108; ENSG00000133731. ENST00000311489; ENSP00000311803; ENSG00000133731. ENST00000449740; ENSP00000408526; ENSG00000133731. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3612. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3612. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003ych.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3612. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M082569. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6050. IMPA1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA037489. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602064. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29860. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0483. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000282238. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG052123. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K01092. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG42FSJ2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:HS05783-MONOMER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 3.1.3.25. 3474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SABIO-RK | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00823; UER00788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_IMPA1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000133731. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR020583. Inositol_monoP_metal-BS. IPR020552. Inositol_monoPase_Li-sen. IPR000760. Inositol_monophosphatase. IPR020550. Inositol_monophosphatase_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR20854. PTHR20854. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00459. Inositol_P. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00377. IMPHPHTASES. PR00378. LIIMPHPHTASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00629. IMP_1. 1 hit. PS00630. IMP_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL1786. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | IMPA1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB01356. Lithium. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P29218. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3612. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 14127. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | IMPA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29218 Secondary accession number(s): B2R733 Q9UK71 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
