Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein tau

Gene

MAPT

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-BTA-264870. Caspase-mediated cleavage of cytoskeletal proteins.

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein tau
Alternative name(s):
Neurofibrillary tangle protein
Paired helical filament-tau
Short name:
PHF-tau
Gene namesi
Name:MAPT
Synonyms:TAU
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 19

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Microtubule

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3638363.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000727362 – 448Microtubule-associated protein tauAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei19Phosphotyrosine; by FYNBy similarity1
Cross-linki33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei35PhosphoserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei58PhosphothreonineBy similarity1
Modified residuei60PhosphothreonineBy similarity1
Modified residuei100PhosphothreonineBy similarity1
Modified residuei144PhosphothreonineBy similarity1
Modified residuei146Omega-N-methylarginineBy similarity1
Modified residuei154N6,N6-dimethyllysine; alternateBy similarity1
Modified residuei154N6-acetyllysine; alternateBy similarity1
Modified residuei160PhosphothreonineBy similarity1
Modified residuei166PhosphothreonineBy similarity1
Modified residuei167PhosphothreonineBy similarity1
Modified residuei172PhosphothreonineBy similarity1
Modified residuei198PhosphoserineBy similarity1
Modified residuei202PhosphoserineBy similarity1
Modified residuei204PhosphotyrosineBy similarity1
Modified residuei205PhosphoserineBy similarity1
Modified residuei206PhosphoserineBy similarity1
Modified residuei209Phosphoserine; by CK1, PDPK1 and TTBK1By similarity1
Modified residuei212Phosphothreonine; by CK1 and PDPK1By similarity1
Modified residuei219Phosphothreonine; by BRSK1, BRSK2, DYRK2 and PDPK1By similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei224PhosphothreonineBy similarity1
Modified residuei232N6-acetyllysineBy similarity1
Modified residuei238Phosphothreonine; by GSK3-beta and PDPK1By similarity1
Modified residuei242PhosphoserineBy similarity1
Modified residuei244Phosphoserine; by PHKBy similarity1
Cross-linki261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei266N6-acetyllysine; alternateBy similarity1
Modified residuei266N6-methyllysine; alternateBy similarity1
Cross-linki266Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei269Phosphoserine; by MARK1, BRSK1, BRSK2 and PHKBy similarity1
Cross-linki274Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei288N6-acetyllysine; alternateBy similarity1
Cross-linki288Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei292Phosphoserine; by PHKBy similarity1
Modified residuei296Phosphoserine; by PHKBy similarity1
Modified residuei297N6-acetyllysineBy similarity1
Disulfide bondi298 ↔ 329By similarity
Modified residuei300PhosphoserineBy similarity1
Modified residuei305N6-acetyllysine; alternateBy similarity1
Cross-linki305Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei312PhosphoserineBy similarity1
Modified residuei318N6,N6-dimethyllysine; alternateBy similarity1
Modified residuei318N6-acetyllysine; alternateBy similarity1
Cross-linki318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei324N6-acetyllysine; alternateBy similarity1
Cross-linki324Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei328N6-acetyllysine; alternateBy similarity1
Cross-linki328Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei331PhosphoserineBy similarity1
Modified residuei338N6-acetyllysine; alternateBy similarity1
Cross-linki338Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei350N6-acetyllysine; alternateBy similarity1
Cross-linki350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei354N6-acetyllysine; alternateBy similarity1
Cross-linki354Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei356Omega-N-methylarginineBy similarity1
Modified residuei359Phosphoserine; by PHKBy similarity1
Cross-linki360Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei363PhosphoserineBy similarity1
Modified residuei376N6-acetyllysine; alternateBy similarity1
Cross-linki376Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Cross-linki382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei392N6-acetyllysine; alternateBy similarity1
Cross-linki392Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei401PhosphotyrosineBy similarity1
Modified residuei403Phosphoserine; by CK1 and PDPK1By similarity1
Modified residuei407PhosphoserineBy similarity1
Modified residuei410PhosphothreonineBy similarity1
Modified residuei411Phosphoserine; by CK1 and PDPK1By similarity1
Modified residuei416PhosphoserineBy similarity1
Modified residuei423PhosphoserineBy similarity1
Modified residuei429PhosphoserineBy similarity1
Modified residuei434PhosphothreonineBy similarity1

Post-translational modificationi

Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome (By similarity).By similarity
Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. Phosphorylation at Ser-269 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK. Dephosphorylation at several serine and threonine residues by the serine/threonine phosphatase PPP5C (By similarity).By similarity
O-glycosylated; contains at least 4 GlcNAc. Site-specific or stoichiometric changes in glycosylation may modulate tau function and also play a role in PHF's formation.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP29172.
PRIDEiP29172.

PTM databases

iPTMnetiP29172.

Expressioni

Tissue specificityi

Expressed in neurons.

Inductioni

During neurite outgrowth.

Gene expression databases

BgeeiENSBTAG00000017512.
ExpressionAtlasiP29172. differential.

Interactioni

Subunit structurei

Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 (By similarity). Interacts with FKBP4. Binds to CSNK1D (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631042EBI-7291149,EBI-347088From a different organism.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi158649. 3 interactors.
IntActiP29172. 4 interactors.
STRINGi9913.ENSBTAP00000054412.

Chemistry databases

BindingDBiP29172.

Structurei

3D structure databases

ProteinModelPortaliP29172.
SMRiP29172.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati251 – 281Tau/MAP 1Add BLAST31
Repeati282 – 312Tau/MAP 2Add BLAST31
Repeati313 – 343Tau/MAP 3Add BLAST31
Repeati344 – 375Tau/MAP 4Add BLAST32

Domaini

The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.

Sequence similaritiesi

Contains 4 Tau/MAP repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2418. Eukaryota.
ENOG4111J07. LUCA.
GeneTreeiENSGT00530000063491.
HOVERGENiHBG000991.
InParanoidiP29172.
KOiK04380.
OrthoDBiEOG091G0AHK.
TreeFamiTF316358.

Family and domain databases

InterProiIPR027324. MAP2/MAP4/Tau.
IPR001084. MAP_tubulin-bd_rpt.
IPR002955. Tau.
[Graphical view]
PANTHERiPTHR11501. PTHR11501. 1 hit.
PfamiPF00418. Tubulin-binding. 4 hits.
[Graphical view]
PRINTSiPR01261. TAUPROTEIN.
PROSITEiPS00229. TAU_MAP_1. 4 hits.
PS51491. TAU_MAP_2. 4 hits.
[Graphical view]

Sequences (20)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 20 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 6 of the 14 exons. One of these optional exons contains the additional tau/MAP repeat. Tau-A cDNA has been constructed from two overlapping cDNAs by PubMed:2498649: Tau-G and Tau-H sequences begin with exon 6 or a part of it (exon 6 is missing in isoforms that begin with exon 1). 3 different C-termini are obtained either by the retention or the splicing of intron 13/14 (2 different 5' splice donors).
Isoform Tau-A (identifier: P29172-1) [UniParc]FASTAAdd to basket
Also known as: PBT43I12

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPRQEFDV MEDHAQGDYT LQDQEGDMDP GLKESPLQTP ADDGSEEPGS
60 70 80 90 100
ETSDAKSTPT AEDATAPLVD EGAPGEQAAA QAPAEIPEGT AAEEAGIGDT
110 120 130 140 150
SNLEDQAAGH VTQARMVSKG KDGTGPDDKK TKGADGKPGT KIATPRGAAP
160 170 180 190 200
PGQKGQANAT RIPAKTTPTP KTSPATMQVQ KKPPPAGAKS ERGESGKSGD
210 220 230 240 250
RSGYSSPGSP GTPGSRSRTP SLPTPPTREP KKVAVVRTPP KSPSAAKSRL
260 270 280 290 300
QAAPGPMPDL KNVKSKIGST ENLKHQPGGG KVQIINKKLD LSNVQSKCGS
310 320 330 340 350
KDNIKHVPGG GSVQIVYKPV DLSKVTSKCG SLGNIHHKPG GGQVEVKSEK
360 370 380 390 400
LDFKDRVQSK IGSLDNITHV PGGGNKKIET HKLTFRENAK AKTDHGAEIV
410 420 430 440
YKSPVVSGDT SPRHLSNVSS TGSIDMVDSP QLATLADEVS ASLAKQGL
Length:448
Mass (Da):46,333
Last modified:January 23, 2007 - v3
Checksum:i821638A9C4809602
GO
Isoform Tau-B (identifier: P29172-2) [UniParc]FASTAAdd to basket
Also known as: PBT43-12

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.

Show »
Length:430
Mass (Da):44,426
Checksum:i9A7A06EFB6895ACD
GO
Isoform Tau-C (identifier: P29172-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.
     282-312: Missing.

Show »
Length:399
Mass (Da):41,180
Checksum:i6D446DCDC0AA66F2
GO
Isoform Tau-D (identifier: P29172-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.

Show »
Length:419
Mass (Da):43,603
Checksum:iA45E9316169C57BC
GO
Isoform Tau-E (identifier: P29172-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.

Show »
Length:401
Mass (Da):41,696
Checksum:iEF098A6D436C5450
GO
Isoform Tau-F (identifier: P29172-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.

Show »
Length:370
Mass (Da):38,450
Checksum:i225B352519AAC090
GO
Isoform Tau-G (identifier: P29172-7) [UniParc]FASTAAdd to basket
Also known as: PBT4

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: MAEPRQEFDV...DGTGPDDKKT → MPLNHYLPYL...NSGAKEMKVK
     175-192: Missing.

Show »
Length:403
Mass (Da):42,361
Checksum:iF36BAF6A1BFCF36D
GO
Isoform Tau-H (identifier: P29172-8) [UniParc]FASTAAdd to basket
Also known as: PBT7

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: MAEPRQEFDV...DGTGPDDKKT → MKVK
     175-192: Missing.

Show »
Length:303
Mass (Da):31,420
Checksum:i7DF858C2EAD31A03
GO
Isoform Tau-I (identifier: P29172-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:477
Mass (Da):49,383
Checksum:i1B0AC87B27070C23
GO
Isoform Tau-J (identifier: P29172-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:430
Mass (Da):44,747
Checksum:iD75BD68C7085B7B7
GO
Isoform Tau-K (identifier: P29172-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:399
Mass (Da):41,500
Checksum:iE2CF718753CE169A
GO
Isoform Tau-L (identifier: P29172-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:426
Mass (Da):44,458
Checksum:iB2ABCB5CD3DC4B82
GO
Isoform Tau-M (identifier: P29172-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:408
Mass (Da):42,552
Checksum:i27B9A11F85B4E29A
GO
Isoform Tau-N (identifier: P29172-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:377
Mass (Da):39,305
Checksum:iFF2F16682EF06E96
GO
Isoform Tau-O (identifier: P29172-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:516
Mass (Da):53,884
Checksum:iE73FCB53C3678CCA
GO
Isoform Tau-P (identifier: P29172-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:469
Mass (Da):49,248
Checksum:i913E117E5F1BC2A5
GO
Isoform Tau-Q (identifier: P29172-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:438
Mass (Da):46,002
Checksum:i438E48674EB03EEB
GO
Isoform Tau-R (identifier: P29172-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:465
Mass (Da):48,959
Checksum:iCD8C23689F259F95
GO
Isoform Tau-S (identifier: P29172-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:447
Mass (Da):47,053
Checksum:iCB410E5C23BC1AA1
GO
Isoform Tau-T (identifier: P29172-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:416
Mass (Da):43,806
Checksum:i430F6DB600ECFEA7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0031651 – 131MAEPR…DDKKT → MPLNHYLPYLFLVSVLFQFV PFSHVLTFILILFMFMFKPS TPSSAKTLKNRPCLSPKRPT PGSSDPLIKPSSPAVCPEPS SSPKHVSSVTPRTGNSGAKE MKVK in isoform Tau-G. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_0031661 – 131MAEPR…DDKKT → MKVK in isoform Tau-H. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_00316763 – 91Missing in isoform Tau-D, isoform Tau-E, isoform Tau-F, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_00316892 – 113Missing in isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedAdd BLAST22
Alternative sequenceiVSP_003169175 – 192Missing in isoform Tau-B, isoform Tau-C, isoform Tau-E, isoform Tau-F, isoform Tau-G, isoform Tau-H, isoform Tau-J, isoform Tau-K, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-S and isoform Tau-T. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_003170282 – 312Missing in isoform Tau-C, isoform Tau-F, isoform Tau-K, isoform Tau-N, isoform Tau-Q and isoform Tau-T. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_003171439 – 448VSASLAKQGL → PCVCPHHACVSAVRSLVTAC PLTTSCCPEFPASPPTPSR in isoform Tau-I, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M and isoform Tau-N. Curated10
Alternative sequenceiVSP_003172447 – 448GL → ALRLPPPRLCVCRAEPGHCL SPHYVMLSRVPRLATHPFSV MDIVPMGRHLLYTKGEVKEG EVQTPGPPSL in isoform Tau-O, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. Curated2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34953
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA. Translation: AAA51609.1.
M26157 mRNA. Translation: AAA30770.1.
M26158 mRNA. Translation: AAA30771.1.
M26178
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51601.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51602.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51603.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51604.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51605.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51606.1. Sequence problems.
BC109941 mRNA. Translation: AAI09942.1.
PIRiA31939. QRBOT1.
B31939. QRBOT2.
RefSeqiNP_776531.1. NM_174106.2. [P29172-1]
UniGeneiBt.34217.

Genome annotation databases

EnsembliENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512. [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512. [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512. [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512. [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512. [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512. [P29172-18]
GeneIDi281296.
KEGGibta:281296.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34953
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA. Translation: AAA51609.1.
M26157 mRNA. Translation: AAA30770.1.
M26158 mRNA. Translation: AAA30771.1.
M26178
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51601.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51602.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51603.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51604.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51605.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51606.1. Sequence problems.
BC109941 mRNA. Translation: AAI09942.1.
PIRiA31939. QRBOT1.
B31939. QRBOT2.
RefSeqiNP_776531.1. NM_174106.2. [P29172-1]
UniGeneiBt.34217.

3D structure databases

ProteinModelPortaliP29172.
SMRiP29172.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi158649. 3 interactors.
IntActiP29172. 4 interactors.
STRINGi9913.ENSBTAP00000054412.

Chemistry databases

BindingDBiP29172.
ChEMBLiCHEMBL3638363.

PTM databases

iPTMnetiP29172.

Proteomic databases

PaxDbiP29172.
PRIDEiP29172.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512. [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512. [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512. [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512. [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512. [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512. [P29172-18]
GeneIDi281296.
KEGGibta:281296.

Organism-specific databases

CTDi4137.

Phylogenomic databases

eggNOGiKOG2418. Eukaryota.
ENOG4111J07. LUCA.
GeneTreeiENSGT00530000063491.
HOVERGENiHBG000991.
InParanoidiP29172.
KOiK04380.
OrthoDBiEOG091G0AHK.
TreeFamiTF316358.

Enzyme and pathway databases

ReactomeiR-BTA-264870. Caspase-mediated cleavage of cytoskeletal proteins.

Gene expression databases

BgeeiENSBTAG00000017512.
ExpressionAtlasiP29172. differential.

Family and domain databases

InterProiIPR027324. MAP2/MAP4/Tau.
IPR001084. MAP_tubulin-bd_rpt.
IPR002955. Tau.
[Graphical view]
PANTHERiPTHR11501. PTHR11501. 1 hit.
PfamiPF00418. Tubulin-binding. 4 hits.
[Graphical view]
PRINTSiPR01261. TAUPROTEIN.
PROSITEiPS00229. TAU_MAP_1. 4 hits.
PS51491. TAU_MAP_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTAU_BOVIN
AccessioniPrimary (citable) accession number: P29172
Secondary accession number(s): P29173
, Q28185, Q28186, Q28187, Q28188, Q28189, Q28190, Q32KT2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 138 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.