Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P29172 (TAU_BOVIN) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Microtubule-associated protein tau
Alternative name(s):
Neurofibrillary tangle protein
Paired helical filament-tau
Short name=PHF-tau
Gene names
Name:MAPT
Synonyms:TAU
OrganismBos taurus (Bovine) [Reference proteome]
Taxonomic identifier9913 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos

Protein attributes

Sequence length448 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

Subunit structure

Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 By similarity. Interacts with FKBP4. Binds to CSNK1D By similarity.

Subcellular location

Cytoplasmcytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmcytoskeleton. Cell projectionaxon. Note: Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

Tissue specificity

Expressed in neurons.

Induction

During neurite outgrowth.

Domain

The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.

Post-translational modification

Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome By similarity.

Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. Phosphorylation at Ser-269 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK. Dephosphorylation at several serine and threonine residues by the serine/threonine phosphatase PPP5C By similarity.

O-glycosylated; contains at least 4 GlcNAc. Site-specific or stoichiometric changes in glycosylation may modulate tau function and also play a role in PHF's formation. Ref.4

Sequence similarities

Contains 4 Tau/MAP repeats.

Ontologies

Keywords
   Cellular componentCell membrane
Cell projection
Cytoplasm
Cytoskeleton
Membrane
Microtubule
   Coding sequence diversityAlternative splicing
   DomainRepeat
   PTMAcetylation
Disulfide bond
Glycoprotein
Phosphoprotein
Ubl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processadult walking behavior

Inferred from electronic annotation. Source: Ensembl

axon cargo transport

Inferred from electronic annotation. Source: Ensembl

axon extension

Inferred from electronic annotation. Source: Ensembl

microtubule cytoskeleton organization

Inferred from electronic annotation. Source: Ensembl

mitochondrion transport along microtubule

Inferred from electronic annotation. Source: Ensembl

negative regulation of intracellular transport

Inferred from electronic annotation. Source: Ensembl

neuron migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of axon extension

Inferred from electronic annotation. Source: Ensembl

positive regulation of microtubule polymerization

Inferred from electronic annotation. Source: Ensembl

regulation of autophagy

Inferred from electronic annotation. Source: Ensembl

regulation of microtubule-based movement

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentaxon

Inferred from electronic annotation. Source: UniProtKB-SubCell

cytosol

Inferred from electronic annotation. Source: UniProtKB-SubCell

growth cone

Inferred from electronic annotation. Source: Ensembl

microtubule

Inferred from electronic annotation. Source: UniProtKB-KW

nuclear periphery

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

tubulin complex

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionlipoprotein particle binding

Inferred from electronic annotation. Source: Ensembl

protein binding

Inferred from physical interaction PubMed 11264299. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

YWHAZP631042EBI-7291149,EBI-347088From a different organism.

Alternative products

This entry describes 20 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 6 of the 14 exons. One of these optional exons contains the additional tau/MAP repeat. Tau-A cDNA has been constructed from two overlapping cDNAs by PubMed:2498649: Tau-G and Tau-H sequences begin with exon 6 or a part of it (exon 6 is missing in isoforms that begin with exon 1). 3 different C-termini are obtained either by the retention or the splicing of intron 13/14 (2 different 5' splice donors).
Isoform Tau-A (identifier: P29172-1)

Also known as: PBT43I12;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Tau-B (identifier: P29172-2)

Also known as: PBT43-12;

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.
Isoform Tau-C (identifier: P29172-3)

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.
     282-312: Missing.
Isoform Tau-D (identifier: P29172-4)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
Isoform Tau-E (identifier: P29172-5)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
Isoform Tau-F (identifier: P29172-6)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
Isoform Tau-G (identifier: P29172-7)

Also known as: PBT4;

The sequence of this isoform differs from the canonical sequence as follows:
     2-131: AEPRQEFDVM...DGTGPDDKKT → MPLNHYLPYL...NSGAKEMKVK
     175-192: Missing.
Isoform Tau-H (identifier: P29172-8)

Also known as: PBT7;

The sequence of this isoform differs from the canonical sequence as follows:
     2-131: AEPRQEFDVM...DGTGPDDKKT → MKVK
     175-192: Missing.
Isoform Tau-I (identifier: P29172-9)

The sequence of this isoform differs from the canonical sequence as follows:
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-J (identifier: P29172-10)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-K (identifier: P29172-11)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-L (identifier: P29172-12)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-M (identifier: P29172-13)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-N (identifier: P29172-14)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR
Isoform Tau-O (identifier: P29172-15)

The sequence of this isoform differs from the canonical sequence as follows:
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL
Isoform Tau-P (identifier: P29172-16)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL
Isoform Tau-Q (identifier: P29172-17)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL
Isoform Tau-R (identifier: P29172-18)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL
Isoform Tau-S (identifier: P29172-19)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL
Isoform Tau-T (identifier: P29172-20)

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 448447Microtubule-associated protein tau
PRO_0000072736

Regions

Repeat251 – 28131Tau/MAP 1
Repeat282 – 31231Tau/MAP 2
Repeat313 – 34331Tau/MAP 3
Repeat344 – 37532Tau/MAP 4

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue191Phosphotyrosine; by FYN By similarity
Modified residue351Phosphoserine By similarity
Modified residue391Phosphothreonine By similarity
Modified residue1441Phosphothreonine By similarity
Modified residue1661Phosphothreonine By similarity
Modified residue1721Phosphothreonine By similarity
Modified residue2041Phosphotyrosine By similarity
Modified residue2051Phosphoserine By similarity
Modified residue2061Phosphoserine By similarity
Modified residue2091Phosphoserine; by CK1, PDPK1 and TTBK1 By similarity
Modified residue2121Phosphothreonine; by CK1 and PDPK1 By similarity
Modified residue2191Phosphothreonine; by BRSK1, BRSK2, DYRK2 and PDPK1 By similarity
Modified residue2211Phosphoserine By similarity
Modified residue2241Phosphothreonine By similarity
Modified residue2381Phosphothreonine; by GSK3-beta and PDPK1 By similarity
Modified residue2421Phosphoserine By similarity
Modified residue2441Phosphoserine; by PHK By similarity
Modified residue2691Phosphoserine; by MARK1, BRSK1, BRSK2 and PHK By similarity
Modified residue2921Phosphoserine; by PHK By similarity
Modified residue2961Phosphoserine; by PHK By similarity
Modified residue3001Phosphoserine By similarity
Modified residue3121Phosphoserine By similarity
Modified residue3311Phosphoserine By similarity
Modified residue3591Phosphoserine; by PHK By similarity
Modified residue3631Phosphoserine By similarity
Modified residue4031Phosphoserine; by CK1 and PDPK1 By similarity
Modified residue4071Phosphoserine By similarity
Modified residue4101Phosphothreonine By similarity
Modified residue4111Phosphoserine; by CK1 and PDPK1 By similarity
Modified residue4161Phosphoserine By similarity
Modified residue4231Phosphoserine By similarity
Modified residue4291Phosphoserine By similarity
Modified residue4341Phosphothreonine By similarity
Disulfide bond298 ↔ 329 By similarity

Natural variations

Alternative sequence2 – 131130AEPRQ…DDKKT → MPLNHYLPYLFLVSVLFQFV PFSHVLTFILILFMFMFKPS TPSSAKTLKNRPCLSPKRPT PGSSDPLIKPSSPAVCPEPS SSPKHVSSVTPRTGNSGAKE MKVK in isoform Tau-G.
VSP_003165
Alternative sequence2 – 131130AEPRQ…DDKKT → MKVK in isoform Tau-H.
VSP_003166
Alternative sequence63 – 9129Missing in isoform Tau-D, isoform Tau-E, isoform Tau-F, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T.
VSP_003167
Alternative sequence92 – 11322Missing in isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-R, isoform Tau-S and isoform Tau-T.
VSP_003168
Alternative sequence175 – 19218Missing in isoform Tau-B, isoform Tau-C, isoform Tau-E, isoform Tau-F, isoform Tau-G, isoform Tau-H, isoform Tau-J, isoform Tau-K, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-S and isoform Tau-T.
VSP_003169
Alternative sequence282 – 31231Missing in isoform Tau-C, isoform Tau-F, isoform Tau-K, isoform Tau-N, isoform Tau-Q and isoform Tau-T.
VSP_003170
Alternative sequence439 – 44810VSASLAKQGL → PCVCPHHACVSAVRSLVTAC PLTTSCCPEFPASPPTPSR in isoform Tau-I, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M and isoform Tau-N.
VSP_003171
Alternative sequence447 – 4482GL → ALRLPPPRLCVCRAEPGHCL SPHYVMLSRVPRLATHPFSV MDIVPMGRHLLYTKGEVKEG EVQTPGPPSL in isoform Tau-O, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T.
VSP_003172

Sequences

Sequence LengthMass (Da)Tools
Isoform Tau-A (PBT43I12) [UniParc].

Last modified January 23, 2007. Version 3.
Checksum: 821638A9C4809602

FASTA44846,333
        10         20         30         40         50         60 
MAEPRQEFDV MEDHAQGDYT LQDQEGDMDP GLKESPLQTP ADDGSEEPGS ETSDAKSTPT 

        70         80         90        100        110        120 
AEDATAPLVD EGAPGEQAAA QAPAEIPEGT AAEEAGIGDT SNLEDQAAGH VTQARMVSKG 

       130        140        150        160        170        180 
KDGTGPDDKK TKGADGKPGT KIATPRGAAP PGQKGQANAT RIPAKTTPTP KTSPATMQVQ 

       190        200        210        220        230        240 
KKPPPAGAKS ERGESGKSGD RSGYSSPGSP GTPGSRSRTP SLPTPPTREP KKVAVVRTPP 

       250        260        270        280        290        300 
KSPSAAKSRL QAAPGPMPDL KNVKSKIGST ENLKHQPGGG KVQIINKKLD LSNVQSKCGS 

       310        320        330        340        350        360 
KDNIKHVPGG GSVQIVYKPV DLSKVTSKCG SLGNIHHKPG GGQVEVKSEK LDFKDRVQSK 

       370        380        390        400        410        420 
IGSLDNITHV PGGGNKKIET HKLTFRENAK AKTDHGAEIV YKSPVVSGDT SPRHLSNVSS 

       430        440 
TGSIDMVDSP QLATLADEVS ASLAKQGL 

« Hide

Isoform Tau-B (PBT43-12) [UniParc].

Checksum: 9A7A06EFB6895ACD
Show »

FASTA43044,426
Isoform Tau-C [UniParc].

Checksum: 6D446DCDC0AA66F2
Show »

FASTA39941,180
Isoform Tau-D [UniParc].

Checksum: A45E9316169C57BC
Show »

FASTA41943,603
Isoform Tau-E [UniParc].

Checksum: EF098A6D436C5450
Show »

FASTA40141,696
Isoform Tau-F [UniParc].

Checksum: 225B352519AAC090
Show »

FASTA37038,450
Isoform Tau-G (PBT4) [UniParc].

Checksum: C8F050527153CFDE
Show »

FASTA40442,492
Isoform Tau-H (PBT7) [UniParc].

Checksum: A6BE9C500A65F569
Show »

FASTA30431,551
Isoform Tau-I [UniParc].

Checksum: 1B0AC87B27070C23
Show »

FASTA47749,383
Isoform Tau-J [UniParc].

Checksum: D75BD68C7085B7B7
Show »

FASTA43044,747
Isoform Tau-K [UniParc].

Checksum: E2CF718753CE169A
Show »

FASTA39941,500
Isoform Tau-L [UniParc].

Checksum: B2ABCB5CD3DC4B82
Show »

FASTA42644,458
Isoform Tau-M [UniParc].

Checksum: 27B9A11F85B4E29A
Show »

FASTA40842,552
Isoform Tau-N [UniParc].

Checksum: FF2F16682EF06E96
Show »

FASTA37739,305
Isoform Tau-O [UniParc].

Checksum: E73FCB53C3678CCA
Show »

FASTA51653,884
Isoform Tau-P [UniParc].

Checksum: 913E117E5F1BC2A5
Show »

FASTA46949,248
Isoform Tau-Q [UniParc].

Checksum: 438E48674EB03EEB
Show »

FASTA43846,002
Isoform Tau-R [UniParc].

Checksum: CD8C23689F259F95
Show »

FASTA46548,959
Isoform Tau-S [UniParc].

Checksum: CB410E5C23BC1AA1
Show »

FASTA44747,053
Isoform Tau-T [UniParc].

Checksum: 430F6DB600ECFEA7
Show »

FASTA41643,806

References

« Hide 'large scale' references
[1]"Tau consists of a set of proteins with repeated C-terminal microtubule-binding domains and variable N-terminal domains."
Himmler A., Drechsel D., Kirschner M.W., Martin D.W. Jr.
Mol. Cell. Biol. 9:1381-1388(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS TAU-A; TAU-B; TAU-G AND TAU-H).
Tissue: Brain.
[2]"Structure of the bovine tau gene: alternatively spliced transcripts generate a protein family."
Himmler A.
Mol. Cell. Biol. 9:1389-1396(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS TAU-A; TAU-B; TAU-C; TAU-D; TAU-E; TAU-F; TAU-I; TAU-J; TAU-K; TAU-L; TAU-M; TAU-N; TAU-O; TAU-P; TAU-Q; TAU-R; TAU-S AND TAU-T).
Tissue: Brain.
[3]NIH - Mammalian Gene Collection (MGC) project
Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM TAU-F).
Strain: Crossbred X Angus.
Tissue: Liver.
[4]"The microtubule-associated protein tau is extensively modified with O-linked N-acetylglucosamine."
Arnold C.S., Johnson G.V.W., Cole R.N., Dong D.L.-Y., Lee M., Hart G.W.
J. Biol. Chem. 271:28741-28744(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L34953 expand/collapse EMBL AC list , L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA. Translation: AAA51609.1.
M26157 mRNA. Translation: AAA30770.1.
M26158 mRNA. Translation: AAA30771.1.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51601.1. Sequence problems.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51602.1. Sequence problems.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51603.1. Sequence problems.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51604.1. Sequence problems.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51605.1. Sequence problems.
M26178 expand/collapse EMBL AC list , L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51606.1. Sequence problems.
BC109941 mRNA. Translation: AAI09942.1.
PIRQRBOT1. A31939.
QRBOT2. B31939.
RefSeqNP_776531.1. NM_174106.2. [P29172-1]
UniGeneBt.34217.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid158649. 3 interactions.
IntActP29172. 4 interactions.

Proteomic databases

PRIDEP29172.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512. [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512. [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512. [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512. [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512. [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512. [P29172-18]
GeneID281296.
KEGGbta:281296.

Organism-specific databases

CTD4137.

Phylogenomic databases

eggNOGNOG148882.
GeneTreeENSGT00530000063491.
HOVERGENHBG000991.
InParanoidP29172.
KOK04380.
OMAAGHVTQX.
OrthoDBEOG738045.
TreeFamTF316358.

Family and domain databases

InterProIPR027324. MAP2/MAP4/Tau.
IPR001084. MAP_tubulin-bd_rpt.
IPR002955. Tau.
[Graphical view]
PANTHERPTHR11501. PTHR11501. 1 hit.
PfamPF00418. Tubulin-binding. 4 hits.
[Graphical view]
PRINTSPR01261. TAUPROTEIN.
PROSITEPS00229. TAU_MAP_1. 4 hits.
PS51491. TAU_MAP_2. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio20805325.

Entry information

Entry nameTAU_BOVIN
AccessionPrimary (citable) accession number: P29172
Secondary accession number(s): P29173 expand/collapse secondary AC list , Q28185, Q28186, Q28187, Q28188, Q28189, Q28190, Q32KT2
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: January 23, 2007
Last modified: June 11, 2014
This is version 118 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families