Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P29172

- TAU_BOVIN

UniProt

P29172 - TAU_BOVIN

Protein

Microtubule-associated protein tau

Gene

MAPT

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

    GO - Molecular functioni

    1. lipoprotein particle binding Source: Ensembl
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. adult walking behavior Source: Ensembl
    2. axon cargo transport Source: Ensembl
    3. axon extension Source: Ensembl
    4. microtubule cytoskeleton organization Source: Ensembl
    5. mitochondrion transport along microtubule Source: Ensembl
    6. negative regulation of intracellular transport Source: Ensembl
    7. neuron migration Source: Ensembl
    8. positive regulation of axon extension Source: Ensembl
    9. positive regulation of microtubule polymerization Source: Ensembl
    10. regulation of autophagy Source: Ensembl
    11. regulation of microtubule-based movement Source: Ensembl

    Enzyme and pathway databases

    ReactomeiREACT_218975. Caspase-mediated cleavage of cytoskeletal proteins.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Microtubule-associated protein tau
    Alternative name(s):
    Neurofibrillary tangle protein
    Paired helical filament-tau
    Short name:
    PHF-tau
    Gene namesi
    Name:MAPT
    Synonyms:TAU
    OrganismiBos taurus (Bovine)
    Taxonomic identifieri9913 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
    ProteomesiUP000009136: Chromosome 19

    Subcellular locationi

    Cytoplasmcytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmcytoskeleton. Cell projectionaxon
    Note: Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

    GO - Cellular componenti

    1. axon Source: UniProtKB-SubCell
    2. cytosol Source: UniProtKB-SubCell
    3. growth cone Source: Ensembl
    4. microtubule Source: UniProtKB-KW
    5. nuclear periphery Source: Ensembl
    6. plasma membrane Source: UniProtKB-SubCell
    7. tubulin complex Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Microtubule

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 448447Microtubule-associated protein tauPRO_0000072736Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei19 – 191Phosphotyrosine; by FYNBy similarity
    Modified residuei35 – 351PhosphoserineBy similarity
    Modified residuei39 – 391PhosphothreonineBy similarity
    Modified residuei144 – 1441PhosphothreonineBy similarity
    Modified residuei166 – 1661PhosphothreonineBy similarity
    Modified residuei172 – 1721PhosphothreonineBy similarity
    Modified residuei204 – 2041PhosphotyrosineBy similarity
    Modified residuei205 – 2051PhosphoserineBy similarity
    Modified residuei206 – 2061PhosphoserineBy similarity
    Modified residuei209 – 2091Phosphoserine; by CK1, PDPK1 and TTBK1By similarity
    Modified residuei212 – 2121Phosphothreonine; by CK1 and PDPK1By similarity
    Modified residuei219 – 2191Phosphothreonine; by BRSK1, BRSK2, DYRK2 and PDPK1By similarity
    Modified residuei221 – 2211PhosphoserineBy similarity
    Modified residuei224 – 2241PhosphothreonineBy similarity
    Modified residuei238 – 2381Phosphothreonine; by GSK3-beta and PDPK1By similarity
    Modified residuei242 – 2421PhosphoserineBy similarity
    Modified residuei244 – 2441Phosphoserine; by PHKBy similarity
    Modified residuei269 – 2691Phosphoserine; by MARK1, BRSK1, BRSK2 and PHKBy similarity
    Modified residuei292 – 2921Phosphoserine; by PHKBy similarity
    Modified residuei296 – 2961Phosphoserine; by PHKBy similarity
    Disulfide bondi298 ↔ 329By similarity
    Modified residuei300 – 3001PhosphoserineBy similarity
    Modified residuei312 – 3121PhosphoserineBy similarity
    Modified residuei331 – 3311PhosphoserineBy similarity
    Modified residuei359 – 3591Phosphoserine; by PHKBy similarity
    Modified residuei363 – 3631PhosphoserineBy similarity
    Modified residuei403 – 4031Phosphoserine; by CK1 and PDPK1By similarity
    Modified residuei407 – 4071PhosphoserineBy similarity
    Modified residuei410 – 4101PhosphothreonineBy similarity
    Modified residuei411 – 4111Phosphoserine; by CK1 and PDPK1By similarity
    Modified residuei416 – 4161PhosphoserineBy similarity
    Modified residuei423 – 4231PhosphoserineBy similarity
    Modified residuei429 – 4291PhosphoserineBy similarity
    Modified residuei434 – 4341PhosphothreonineBy similarity

    Post-translational modificationi

    Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome By similarity.By similarity
    Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. Phosphorylation at Ser-269 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK. Dephosphorylation at several serine and threonine residues by the serine/threonine phosphatase PPP5C By similarity.By similarity
    O-glycosylated; contains at least 4 GlcNAc. Site-specific or stoichiometric changes in glycosylation may modulate tau function and also play a role in PHF's formation.1 Publication

    Keywords - PTMi

    Acetylation, Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

    Proteomic databases

    PRIDEiP29172.

    Expressioni

    Tissue specificityi

    Expressed in neurons.

    Inductioni

    During neurite outgrowth.

    Interactioni

    Subunit structurei

    Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 By similarity. Interacts with FKBP4. Binds to CSNK1D By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    YWHAZP631042EBI-7291149,EBI-347088From a different organism.

    Protein-protein interaction databases

    BioGridi158649. 3 interactions.
    IntActiP29172. 4 interactions.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati251 – 28131Tau/MAP 1Add
    BLAST
    Repeati282 – 31231Tau/MAP 2Add
    BLAST
    Repeati313 – 34331Tau/MAP 3Add
    BLAST
    Repeati344 – 37532Tau/MAP 4Add
    BLAST

    Domaini

    The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.

    Sequence similaritiesi

    Contains 4 Tau/MAP repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG148882.
    GeneTreeiENSGT00530000063491.
    HOVERGENiHBG000991.
    InParanoidiP29172.
    KOiK04380.
    OMAiAGHVTQX.
    OrthoDBiEOG738045.
    TreeFamiTF316358.

    Family and domain databases

    InterProiIPR027324. MAP2/MAP4/Tau.
    IPR001084. MAP_tubulin-bd_rpt.
    IPR002955. Tau.
    [Graphical view]
    PANTHERiPTHR11501. PTHR11501. 1 hit.
    PfamiPF00418. Tubulin-binding. 4 hits.
    [Graphical view]
    PRINTSiPR01261. TAUPROTEIN.
    PROSITEiPS00229. TAU_MAP_1. 4 hits.
    PS51491. TAU_MAP_2. 4 hits.
    [Graphical view]

    Sequences (20)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 20 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 6 of the 14 exons. One of these optional exons contains the additional tau/MAP repeat. Tau-A cDNA has been constructed from two overlapping cDNAs by PubMed:2498649: Tau-G and Tau-H sequences begin with exon 6 or a part of it (exon 6 is missing in isoforms that begin with exon 1). 3 different C-termini are obtained either by the retention or the splicing of intron 13/14 (2 different 5' splice donors).

    Isoform Tau-A (identifier: P29172-1) [UniParc]FASTAAdd to Basket

    Also known as: PBT43I12

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEPRQEFDV MEDHAQGDYT LQDQEGDMDP GLKESPLQTP ADDGSEEPGS    50
    ETSDAKSTPT AEDATAPLVD EGAPGEQAAA QAPAEIPEGT AAEEAGIGDT 100
    SNLEDQAAGH VTQARMVSKG KDGTGPDDKK TKGADGKPGT KIATPRGAAP 150
    PGQKGQANAT RIPAKTTPTP KTSPATMQVQ KKPPPAGAKS ERGESGKSGD 200
    RSGYSSPGSP GTPGSRSRTP SLPTPPTREP KKVAVVRTPP KSPSAAKSRL 250
    QAAPGPMPDL KNVKSKIGST ENLKHQPGGG KVQIINKKLD LSNVQSKCGS 300
    KDNIKHVPGG GSVQIVYKPV DLSKVTSKCG SLGNIHHKPG GGQVEVKSEK 350
    LDFKDRVQSK IGSLDNITHV PGGGNKKIET HKLTFRENAK AKTDHGAEIV 400
    YKSPVVSGDT SPRHLSNVSS TGSIDMVDSP QLATLADEVS ASLAKQGL 448
    Length:448
    Mass (Da):46,333
    Last modified:January 23, 2007 - v3
    Checksum:i821638A9C4809602
    GO
    Isoform Tau-B (identifier: P29172-2) [UniParc]FASTAAdd to Basket

    Also known as: PBT43-12

    The sequence of this isoform differs from the canonical sequence as follows:
         175-192: Missing.

    Show »
    Length:430
    Mass (Da):44,426
    Checksum:i9A7A06EFB6895ACD
    GO
    Isoform Tau-C (identifier: P29172-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         175-192: Missing.
         282-312: Missing.

    Show »
    Length:399
    Mass (Da):41,180
    Checksum:i6D446DCDC0AA66F2
    GO
    Isoform Tau-D (identifier: P29172-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.

    Show »
    Length:419
    Mass (Da):43,603
    Checksum:iA45E9316169C57BC
    GO
    Isoform Tau-E (identifier: P29172-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.

    Show »
    Length:401
    Mass (Da):41,696
    Checksum:iEF098A6D436C5450
    GO
    Isoform Tau-F (identifier: P29172-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.
         282-312: Missing.

    Show »
    Length:370
    Mass (Da):38,450
    Checksum:i225B352519AAC090
    GO
    Isoform Tau-G (identifier: P29172-7) [UniParc]FASTAAdd to Basket

    Also known as: PBT4

    The sequence of this isoform differs from the canonical sequence as follows:
         2-131: AEPRQEFDVM...DGTGPDDKKT → MPLNHYLPYL...NSGAKEMKVK
         175-192: Missing.

    Show »
    Length:404
    Mass (Da):42,492
    Checksum:iC8F050527153CFDE
    GO
    Isoform Tau-H (identifier: P29172-8) [UniParc]FASTAAdd to Basket

    Also known as: PBT7

    The sequence of this isoform differs from the canonical sequence as follows:
         2-131: AEPRQEFDVM...DGTGPDDKKT → MKVK
         175-192: Missing.

    Show »
    Length:304
    Mass (Da):31,551
    Checksum:iA6BE9C500A65F569
    GO
    Isoform Tau-I (identifier: P29172-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:477
    Mass (Da):49,383
    Checksum:i1B0AC87B27070C23
    GO
    Isoform Tau-J (identifier: P29172-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:430
    Mass (Da):44,747
    Checksum:iD75BD68C7085B7B7
    GO
    Isoform Tau-K (identifier: P29172-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.
         282-312: Missing.
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:399
    Mass (Da):41,500
    Checksum:iE2CF718753CE169A
    GO
    Isoform Tau-L (identifier: P29172-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:426
    Mass (Da):44,458
    Checksum:iB2ABCB5CD3DC4B82
    GO
    Isoform Tau-M (identifier: P29172-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         175-192: Missing.
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:408
    Mass (Da):42,552
    Checksum:i27B9A11F85B4E29A
    GO
    Isoform Tau-N (identifier: P29172-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         175-192: Missing.
         282-312: Missing.
         439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

    Show »
    Length:377
    Mass (Da):39,305
    Checksum:iFF2F16682EF06E96
    GO
    Isoform Tau-O (identifier: P29172-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:516
    Mass (Da):53,884
    Checksum:iE73FCB53C3678CCA
    GO
    Isoform Tau-P (identifier: P29172-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:469
    Mass (Da):49,248
    Checksum:i913E117E5F1BC2A5
    GO
    Isoform Tau-Q (identifier: P29172-17) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         175-192: Missing.
         282-312: Missing.
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:438
    Mass (Da):46,002
    Checksum:i438E48674EB03EEB
    GO
    Isoform Tau-R (identifier: P29172-18) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:465
    Mass (Da):48,959
    Checksum:iCD8C23689F259F95
    GO
    Isoform Tau-S (identifier: P29172-19) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         175-192: Missing.
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:447
    Mass (Da):47,053
    Checksum:iCB410E5C23BC1AA1
    GO
    Isoform Tau-T (identifier: P29172-20) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-91: Missing.
         92-113: Missing.
         175-192: Missing.
         282-312: Missing.
         447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

    Show »
    Length:416
    Mass (Da):43,806
    Checksum:i430F6DB600ECFEA7
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 131130AEPRQ…DDKKT → MPLNHYLPYLFLVSVLFQFV PFSHVLTFILILFMFMFKPS TPSSAKTLKNRPCLSPKRPT PGSSDPLIKPSSPAVCPEPS SSPKHVSSVTPRTGNSGAKE MKVK in isoform Tau-G. 1 PublicationVSP_003165Add
    BLAST
    Alternative sequencei2 – 131130AEPRQ…DDKKT → MKVK in isoform Tau-H. 1 PublicationVSP_003166Add
    BLAST
    Alternative sequencei63 – 9129Missing in isoform Tau-D, isoform Tau-E, isoform Tau-F, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. 1 PublicationVSP_003167Add
    BLAST
    Alternative sequencei92 – 11322Missing in isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedVSP_003168Add
    BLAST
    Alternative sequencei175 – 19218Missing in isoform Tau-B, isoform Tau-C, isoform Tau-E, isoform Tau-F, isoform Tau-G, isoform Tau-H, isoform Tau-J, isoform Tau-K, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-S and isoform Tau-T. 2 PublicationsVSP_003169Add
    BLAST
    Alternative sequencei282 – 31231Missing in isoform Tau-C, isoform Tau-F, isoform Tau-K, isoform Tau-N, isoform Tau-Q and isoform Tau-T. 1 PublicationVSP_003170Add
    BLAST
    Alternative sequencei439 – 44810VSASLAKQGL → PCVCPHHACVSAVRSLVTAC PLTTSCCPEFPASPPTPSR in isoform Tau-I, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M and isoform Tau-N. CuratedVSP_003171
    Alternative sequencei447 – 4482GL → ALRLPPPRLCVCRAEPGHCL SPHYVMLSRVPRLATHPFSV MDIVPMGRHLLYTKGEVKEG EVQTPGPPSL in isoform Tau-O, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedVSP_003172

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L34953
    , L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA. Translation: AAA51609.1.
    M26157 mRNA. Translation: AAA30770.1.
    M26158 mRNA. Translation: AAA30771.1.
    M26178
    , L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51601.1. Sequence problems.
    M26178
    , L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51602.1. Sequence problems.
    M26178
    , L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51603.1. Sequence problems.
    M26178
    , L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51604.1. Sequence problems.
    M26178
    , L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51605.1. Sequence problems.
    M26178
    , L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51606.1. Sequence problems.
    BC109941 mRNA. Translation: AAI09942.1.
    PIRiA31939. QRBOT1.
    B31939. QRBOT2.
    RefSeqiNP_776531.1. NM_174106.2. [P29172-1]
    UniGeneiBt.34217.

    Genome annotation databases

    EnsembliENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512. [P29172-1]
    ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512. [P29172-3]
    ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512. [P29172-15]
    ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512. [P29172-2]
    ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512. [P29172-4]
    ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512. [P29172-18]
    GeneIDi281296.
    KEGGibta:281296.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L34953
    , L34940 , L34941 , L34942 , L34943 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 , L34952 Genomic DNA. Translation: AAA51609.1 .
    M26157 mRNA. Translation: AAA30770.1 .
    M26158 mRNA. Translation: AAA30771.1 .
    M26178
    , L34940 , L34941 , L34942 , L34943 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51601.1 . Sequence problems.
    M26178
    , L34940 , L34941 , L34943 , L34944 , L34946 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51602.1 . Sequence problems.
    M26178
    , L34940 , L34941 , L34943 , L34944 , L34946 , L34948 , L34950 , L34951 Genomic DNA. Translation: AAA51603.1 . Sequence problems.
    M26178
    , L34940 , L34941 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51604.1 . Sequence problems.
    M26178
    , L34940 , L34941 , L34944 , L34946 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51605.1 . Sequence problems.
    M26178
    , L34940 , L34941 , L34944 , L34946 , L34948 , L34950 , L34951 Genomic DNA. Translation: AAA51606.1 . Sequence problems.
    BC109941 mRNA. Translation: AAI09942.1 .
    PIRi A31939. QRBOT1.
    B31939. QRBOT2.
    RefSeqi NP_776531.1. NM_174106.2. [P29172-1 ]
    UniGenei Bt.34217.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 158649. 3 interactions.
    IntActi P29172. 4 interactions.

    Proteomic databases

    PRIDEi P29172.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSBTAT00000023284 ; ENSBTAP00000023284 ; ENSBTAG00000017512 . [P29172-1 ]
    ENSBTAT00000042687 ; ENSBTAP00000040320 ; ENSBTAG00000017512 . [P29172-3 ]
    ENSBTAT00000064492 ; ENSBTAP00000054412 ; ENSBTAG00000017512 . [P29172-15 ]
    ENSBTAT00000064966 ; ENSBTAP00000054994 ; ENSBTAG00000017512 . [P29172-2 ]
    ENSBTAT00000065509 ; ENSBTAP00000056351 ; ENSBTAG00000017512 . [P29172-4 ]
    ENSBTAT00000065660 ; ENSBTAP00000056547 ; ENSBTAG00000017512 . [P29172-18 ]
    GeneIDi 281296.
    KEGGi bta:281296.

    Organism-specific databases

    CTDi 4137.

    Phylogenomic databases

    eggNOGi NOG148882.
    GeneTreei ENSGT00530000063491.
    HOVERGENi HBG000991.
    InParanoidi P29172.
    KOi K04380.
    OMAi AGHVTQX.
    OrthoDBi EOG738045.
    TreeFami TF316358.

    Enzyme and pathway databases

    Reactomei REACT_218975. Caspase-mediated cleavage of cytoskeletal proteins.

    Miscellaneous databases

    NextBioi 20805325.

    Family and domain databases

    InterProi IPR027324. MAP2/MAP4/Tau.
    IPR001084. MAP_tubulin-bd_rpt.
    IPR002955. Tau.
    [Graphical view ]
    PANTHERi PTHR11501. PTHR11501. 1 hit.
    Pfami PF00418. Tubulin-binding. 4 hits.
    [Graphical view ]
    PRINTSi PR01261. TAUPROTEIN.
    PROSITEi PS00229. TAU_MAP_1. 4 hits.
    PS51491. TAU_MAP_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Tau consists of a set of proteins with repeated C-terminal microtubule-binding domains and variable N-terminal domains."
      Himmler A., Drechsel D., Kirschner M.W., Martin D.W. Jr.
      Mol. Cell. Biol. 9:1381-1388(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS TAU-A; TAU-B; TAU-G AND TAU-H).
      Tissue: Brain.
    2. "Structure of the bovine tau gene: alternatively spliced transcripts generate a protein family."
      Himmler A.
      Mol. Cell. Biol. 9:1389-1396(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS TAU-A; TAU-B; TAU-C; TAU-D; TAU-E; TAU-F; TAU-I; TAU-J; TAU-K; TAU-L; TAU-M; TAU-N; TAU-O; TAU-P; TAU-Q; TAU-R; TAU-S AND TAU-T).
      Tissue: Brain.
    3. NIH - Mammalian Gene Collection (MGC) project
      Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM TAU-F).
      Strain: Crossbred X Angus.
      Tissue: Liver.
    4. "The microtubule-associated protein tau is extensively modified with O-linked N-acetylglucosamine."
      Arnold C.S., Johnson G.V.W., Cole R.N., Dong D.L.-Y., Lee M., Hart G.W.
      J. Biol. Chem. 271:28741-28744(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION.

    Entry informationi

    Entry nameiTAU_BOVIN
    AccessioniPrimary (citable) accession number: P29172
    Secondary accession number(s): P29173
    , Q28185, Q28186, Q28187, Q28188, Q28189, Q28190, Q32KT2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 1992
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3