Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P29172

- TAU_BOVIN

UniProt

P29172 - TAU_BOVIN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Microtubule-associated protein tau

Gene

MAPT

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

GO - Molecular functioni

  1. lipoprotein particle binding Source: Ensembl

GO - Biological processi

  1. adult walking behavior Source: Ensembl
  2. axon cargo transport Source: Ensembl
  3. axon extension Source: Ensembl
  4. microtubule cytoskeleton organization Source: Ensembl
  5. mitochondrion transport along microtubule Source: Ensembl
  6. negative regulation of intracellular transport Source: Ensembl
  7. neuron migration Source: Ensembl
  8. positive regulation of axon extension Source: Ensembl
  9. positive regulation of microtubule polymerization Source: Ensembl
  10. regulation of autophagy Source: Ensembl
  11. regulation of microtubule-based movement Source: Ensembl
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_218975. Caspase-mediated cleavage of cytoskeletal proteins.

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein tau
Alternative name(s):
Neurofibrillary tangle protein
Paired helical filament-tau
Short name:
PHF-tau
Gene namesi
Name:MAPT
Synonyms:TAU
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136: Chromosome 19

Subcellular locationi

Cytoplasmcytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmcytoskeleton. Cell projectionaxon
Note: Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

GO - Cellular componenti

  1. axon Source: Ensembl
  2. axoneme Source: Ensembl
  3. growth cone Source: Ensembl
  4. microtubule Source: UniProtKB-KW
  5. nuclear periphery Source: Ensembl
  6. plasma membrane Source: UniProtKB-KW
  7. tubulin complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 448447Microtubule-associated protein tauPRO_0000072736Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity
Modified residuei19 – 191Phosphotyrosine; by FYNBy similarity
Modified residuei35 – 351PhosphoserineBy similarity
Modified residuei39 – 391PhosphothreonineBy similarity
Modified residuei144 – 1441PhosphothreonineBy similarity
Modified residuei166 – 1661PhosphothreonineBy similarity
Modified residuei172 – 1721PhosphothreonineBy similarity
Modified residuei204 – 2041PhosphotyrosineBy similarity
Modified residuei205 – 2051PhosphoserineBy similarity
Modified residuei206 – 2061PhosphoserineBy similarity
Modified residuei209 – 2091Phosphoserine; by CK1, PDPK1 and TTBK1By similarity
Modified residuei212 – 2121Phosphothreonine; by CK1 and PDPK1By similarity
Modified residuei219 – 2191Phosphothreonine; by BRSK1, BRSK2, DYRK2 and PDPK1By similarity
Modified residuei221 – 2211PhosphoserineBy similarity
Modified residuei224 – 2241PhosphothreonineBy similarity
Modified residuei238 – 2381Phosphothreonine; by GSK3-beta and PDPK1By similarity
Modified residuei242 – 2421PhosphoserineBy similarity
Modified residuei244 – 2441Phosphoserine; by PHKBy similarity
Modified residuei269 – 2691Phosphoserine; by MARK1, BRSK1, BRSK2 and PHKBy similarity
Modified residuei292 – 2921Phosphoserine; by PHKBy similarity
Modified residuei296 – 2961Phosphoserine; by PHKBy similarity
Disulfide bondi298 ↔ 329By similarity
Modified residuei300 – 3001PhosphoserineBy similarity
Modified residuei312 – 3121PhosphoserineBy similarity
Modified residuei331 – 3311PhosphoserineBy similarity
Modified residuei359 – 3591Phosphoserine; by PHKBy similarity
Modified residuei363 – 3631PhosphoserineBy similarity
Modified residuei403 – 4031Phosphoserine; by CK1 and PDPK1By similarity
Modified residuei407 – 4071PhosphoserineBy similarity
Modified residuei410 – 4101PhosphothreonineBy similarity
Modified residuei411 – 4111Phosphoserine; by CK1 and PDPK1By similarity
Modified residuei416 – 4161PhosphoserineBy similarity
Modified residuei423 – 4231PhosphoserineBy similarity
Modified residuei429 – 4291PhosphoserineBy similarity
Modified residuei434 – 4341PhosphothreonineBy similarity

Post-translational modificationi

Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome By similarity.By similarity
Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. Phosphorylation at Ser-269 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK. Dephosphorylation at several serine and threonine residues by the serine/threonine phosphatase PPP5C By similarity.By similarity
O-glycosylated; contains at least 4 GlcNAc. Site-specific or stoichiometric changes in glycosylation may modulate tau function and also play a role in PHF's formation.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

PRIDEiP29172.

Expressioni

Tissue specificityi

Expressed in neurons.

Inductioni

During neurite outgrowth.

Gene expression databases

ExpressionAtlasiP29172. baseline.

Interactioni

Subunit structurei

Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 By similarity. Interacts with FKBP4. Binds to CSNK1D By similarity.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631042EBI-7291149,EBI-347088From a different organism.

Protein-protein interaction databases

BioGridi158649. 3 interactions.
IntActiP29172. 4 interactions.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati251 – 28131Tau/MAP 1Add
BLAST
Repeati282 – 31231Tau/MAP 2Add
BLAST
Repeati313 – 34331Tau/MAP 3Add
BLAST
Repeati344 – 37532Tau/MAP 4Add
BLAST

Domaini

The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.

Sequence similaritiesi

Contains 4 Tau/MAP repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG148882.
GeneTreeiENSGT00530000063491.
HOVERGENiHBG000991.
InParanoidiP29172.
KOiK04380.
OMAiAGHVTQX.
OrthoDBiEOG738045.
TreeFamiTF316358.

Family and domain databases

InterProiIPR027324. MAP2/MAP4/Tau.
IPR001084. MAP_tubulin-bd_rpt.
IPR002955. Tau.
[Graphical view]
PANTHERiPTHR11501. PTHR11501. 1 hit.
PfamiPF00418. Tubulin-binding. 4 hits.
[Graphical view]
PRINTSiPR01261. TAUPROTEIN.
PROSITEiPS00229. TAU_MAP_1. 4 hits.
PS51491. TAU_MAP_2. 4 hits.
[Graphical view]

Sequences (20)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 20 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 6 of the 14 exons. One of these optional exons contains the additional tau/MAP repeat. Tau-A cDNA has been constructed from two overlapping cDNAs by PubMed:2498649: Tau-G and Tau-H sequences begin with exon 6 or a part of it (exon 6 is missing in isoforms that begin with exon 1). 3 different C-termini are obtained either by the retention or the splicing of intron 13/14 (2 different 5' splice donors).

Isoform Tau-A (identifier: P29172-1) [UniParc]FASTAAdd to Basket

Also known as: PBT43I12

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPRQEFDV MEDHAQGDYT LQDQEGDMDP GLKESPLQTP ADDGSEEPGS
60 70 80 90 100
ETSDAKSTPT AEDATAPLVD EGAPGEQAAA QAPAEIPEGT AAEEAGIGDT
110 120 130 140 150
SNLEDQAAGH VTQARMVSKG KDGTGPDDKK TKGADGKPGT KIATPRGAAP
160 170 180 190 200
PGQKGQANAT RIPAKTTPTP KTSPATMQVQ KKPPPAGAKS ERGESGKSGD
210 220 230 240 250
RSGYSSPGSP GTPGSRSRTP SLPTPPTREP KKVAVVRTPP KSPSAAKSRL
260 270 280 290 300
QAAPGPMPDL KNVKSKIGST ENLKHQPGGG KVQIINKKLD LSNVQSKCGS
310 320 330 340 350
KDNIKHVPGG GSVQIVYKPV DLSKVTSKCG SLGNIHHKPG GGQVEVKSEK
360 370 380 390 400
LDFKDRVQSK IGSLDNITHV PGGGNKKIET HKLTFRENAK AKTDHGAEIV
410 420 430 440
YKSPVVSGDT SPRHLSNVSS TGSIDMVDSP QLATLADEVS ASLAKQGL
Length:448
Mass (Da):46,333
Last modified:January 23, 2007 - v3
Checksum:i821638A9C4809602
GO
Isoform Tau-B (identifier: P29172-2) [UniParc]FASTAAdd to Basket

Also known as: PBT43-12

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.

Show »
Length:430
Mass (Da):44,426
Checksum:i9A7A06EFB6895ACD
GO
Isoform Tau-C (identifier: P29172-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.
     282-312: Missing.

Show »
Length:399
Mass (Da):41,180
Checksum:i6D446DCDC0AA66F2
GO
Isoform Tau-D (identifier: P29172-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.

Show »
Length:419
Mass (Da):43,603
Checksum:iA45E9316169C57BC
GO
Isoform Tau-E (identifier: P29172-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.

Show »
Length:401
Mass (Da):41,696
Checksum:iEF098A6D436C5450
GO
Isoform Tau-F (identifier: P29172-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.

Show »
Length:370
Mass (Da):38,450
Checksum:i225B352519AAC090
GO
Isoform Tau-G (identifier: P29172-7) [UniParc]FASTAAdd to Basket

Also known as: PBT4

The sequence of this isoform differs from the canonical sequence as follows:
     2-131: AEPRQEFDVM...DGTGPDDKKT → MPLNHYLPYL...NSGAKEMKVK
     175-192: Missing.

Show »
Length:404
Mass (Da):42,492
Checksum:iC8F050527153CFDE
GO
Isoform Tau-H (identifier: P29172-8) [UniParc]FASTAAdd to Basket

Also known as: PBT7

The sequence of this isoform differs from the canonical sequence as follows:
     2-131: AEPRQEFDVM...DGTGPDDKKT → MKVK
     175-192: Missing.

Show »
Length:304
Mass (Da):31,551
Checksum:iA6BE9C500A65F569
GO
Isoform Tau-I (identifier: P29172-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:477
Mass (Da):49,383
Checksum:i1B0AC87B27070C23
GO
Isoform Tau-J (identifier: P29172-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:430
Mass (Da):44,747
Checksum:iD75BD68C7085B7B7
GO
Isoform Tau-K (identifier: P29172-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:399
Mass (Da):41,500
Checksum:iE2CF718753CE169A
GO
Isoform Tau-L (identifier: P29172-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:426
Mass (Da):44,458
Checksum:iB2ABCB5CD3DC4B82
GO
Isoform Tau-M (identifier: P29172-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:408
Mass (Da):42,552
Checksum:i27B9A11F85B4E29A
GO
Isoform Tau-N (identifier: P29172-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:377
Mass (Da):39,305
Checksum:iFF2F16682EF06E96
GO
Isoform Tau-O (identifier: P29172-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:516
Mass (Da):53,884
Checksum:iE73FCB53C3678CCA
GO
Isoform Tau-P (identifier: P29172-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:469
Mass (Da):49,248
Checksum:i913E117E5F1BC2A5
GO
Isoform Tau-Q (identifier: P29172-17) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:438
Mass (Da):46,002
Checksum:i438E48674EB03EEB
GO
Isoform Tau-R (identifier: P29172-18) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:465
Mass (Da):48,959
Checksum:iCD8C23689F259F95
GO
Isoform Tau-S (identifier: P29172-19) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:447
Mass (Da):47,053
Checksum:iCB410E5C23BC1AA1
GO
Isoform Tau-T (identifier: P29172-20) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:416
Mass (Da):43,806
Checksum:i430F6DB600ECFEA7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 131130AEPRQ…DDKKT → MPLNHYLPYLFLVSVLFQFV PFSHVLTFILILFMFMFKPS TPSSAKTLKNRPCLSPKRPT PGSSDPLIKPSSPAVCPEPS SSPKHVSSVTPRTGNSGAKE MKVK in isoform Tau-G. 1 PublicationVSP_003165Add
BLAST
Alternative sequencei2 – 131130AEPRQ…DDKKT → MKVK in isoform Tau-H. 1 PublicationVSP_003166Add
BLAST
Alternative sequencei63 – 9129Missing in isoform Tau-D, isoform Tau-E, isoform Tau-F, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. 1 PublicationVSP_003167Add
BLAST
Alternative sequencei92 – 11322Missing in isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedVSP_003168Add
BLAST
Alternative sequencei175 – 19218Missing in isoform Tau-B, isoform Tau-C, isoform Tau-E, isoform Tau-F, isoform Tau-G, isoform Tau-H, isoform Tau-J, isoform Tau-K, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-S and isoform Tau-T. 2 PublicationsVSP_003169Add
BLAST
Alternative sequencei282 – 31231Missing in isoform Tau-C, isoform Tau-F, isoform Tau-K, isoform Tau-N, isoform Tau-Q and isoform Tau-T. 1 PublicationVSP_003170Add
BLAST
Alternative sequencei439 – 44810VSASLAKQGL → PCVCPHHACVSAVRSLVTAC PLTTSCCPEFPASPPTPSR in isoform Tau-I, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M and isoform Tau-N. CuratedVSP_003171
Alternative sequencei447 – 4482GL → ALRLPPPRLCVCRAEPGHCL SPHYVMLSRVPRLATHPFSV MDIVPMGRHLLYTKGEVKEG EVQTPGPPSL in isoform Tau-O, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedVSP_003172

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L34953
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA. Translation: AAA51609.1.
M26157 mRNA. Translation: AAA30770.1.
M26158 mRNA. Translation: AAA30771.1.
M26178
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51601.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51602.1. Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51603.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51604.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA. Translation: AAA51605.1. Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA. Translation: AAA51606.1. Sequence problems.
BC109941 mRNA. Translation: AAI09942.1.
PIRiA31939. QRBOT1.
B31939. QRBOT2.
RefSeqiNP_776531.1. NM_174106.2. [P29172-1]
UniGeneiBt.34217.

Genome annotation databases

EnsembliENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512. [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512. [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512. [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512. [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512. [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512. [P29172-18]
GeneIDi281296.
KEGGibta:281296.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L34953
, L34940 , L34941 , L34942 , L34943 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 , L34952 Genomic DNA. Translation: AAA51609.1 .
M26157 mRNA. Translation: AAA30770.1 .
M26158 mRNA. Translation: AAA30771.1 .
M26178
, L34940 , L34941 , L34942 , L34943 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51601.1 . Sequence problems.
M26178
, L34940 , L34941 , L34943 , L34944 , L34946 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51602.1 . Sequence problems.
M26178
, L34940 , L34941 , L34943 , L34944 , L34946 , L34948 , L34950 , L34951 Genomic DNA. Translation: AAA51603.1 . Sequence problems.
M26178
, L34940 , L34941 , L34944 , L34946 , L34947 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51604.1 . Sequence problems.
M26178
, L34940 , L34941 , L34944 , L34946 , L34948 , L34949 , L34950 , L34951 Genomic DNA. Translation: AAA51605.1 . Sequence problems.
M26178
, L34940 , L34941 , L34944 , L34946 , L34948 , L34950 , L34951 Genomic DNA. Translation: AAA51606.1 . Sequence problems.
BC109941 mRNA. Translation: AAI09942.1 .
PIRi A31939. QRBOT1.
B31939. QRBOT2.
RefSeqi NP_776531.1. NM_174106.2. [P29172-1 ]
UniGenei Bt.34217.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 158649. 3 interactions.
IntActi P29172. 4 interactions.

Proteomic databases

PRIDEi P29172.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSBTAT00000023284 ; ENSBTAP00000023284 ; ENSBTAG00000017512 . [P29172-1 ]
ENSBTAT00000042687 ; ENSBTAP00000040320 ; ENSBTAG00000017512 . [P29172-3 ]
ENSBTAT00000064492 ; ENSBTAP00000054412 ; ENSBTAG00000017512 . [P29172-15 ]
ENSBTAT00000064966 ; ENSBTAP00000054994 ; ENSBTAG00000017512 . [P29172-2 ]
ENSBTAT00000065509 ; ENSBTAP00000056351 ; ENSBTAG00000017512 . [P29172-4 ]
ENSBTAT00000065660 ; ENSBTAP00000056547 ; ENSBTAG00000017512 . [P29172-18 ]
GeneIDi 281296.
KEGGi bta:281296.

Organism-specific databases

CTDi 4137.

Phylogenomic databases

eggNOGi NOG148882.
GeneTreei ENSGT00530000063491.
HOVERGENi HBG000991.
InParanoidi P29172.
KOi K04380.
OMAi AGHVTQX.
OrthoDBi EOG738045.
TreeFami TF316358.

Enzyme and pathway databases

Reactomei REACT_218975. Caspase-mediated cleavage of cytoskeletal proteins.

Miscellaneous databases

NextBioi 20805325.

Gene expression databases

ExpressionAtlasi P29172. baseline.

Family and domain databases

InterProi IPR027324. MAP2/MAP4/Tau.
IPR001084. MAP_tubulin-bd_rpt.
IPR002955. Tau.
[Graphical view ]
PANTHERi PTHR11501. PTHR11501. 1 hit.
Pfami PF00418. Tubulin-binding. 4 hits.
[Graphical view ]
PRINTSi PR01261. TAUPROTEIN.
PROSITEi PS00229. TAU_MAP_1. 4 hits.
PS51491. TAU_MAP_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Tau consists of a set of proteins with repeated C-terminal microtubule-binding domains and variable N-terminal domains."
    Himmler A., Drechsel D., Kirschner M.W., Martin D.W. Jr.
    Mol. Cell. Biol. 9:1381-1388(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS TAU-A; TAU-B; TAU-G AND TAU-H).
    Tissue: Brain.
  2. "Structure of the bovine tau gene: alternatively spliced transcripts generate a protein family."
    Himmler A.
    Mol. Cell. Biol. 9:1389-1396(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS TAU-A; TAU-B; TAU-C; TAU-D; TAU-E; TAU-F; TAU-I; TAU-J; TAU-K; TAU-L; TAU-M; TAU-N; TAU-O; TAU-P; TAU-Q; TAU-R; TAU-S AND TAU-T).
    Tissue: Brain.
  3. NIH - Mammalian Gene Collection (MGC) project
    Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM TAU-F).
    Strain: Crossbred X Angus.
    Tissue: Liver.
  4. "The microtubule-associated protein tau is extensively modified with O-linked N-acetylglucosamine."
    Arnold C.S., Johnson G.V.W., Cole R.N., Dong D.L.-Y., Lee M., Hart G.W.
    J. Biol. Chem. 271:28741-28744(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION.

Entry informationi

Entry nameiTAU_BOVIN
AccessioniPrimary (citable) accession number: P29172
Secondary accession number(s): P29173
, Q28185, Q28186, Q28187, Q28188, Q28189, Q28190, Q32KT2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3