Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P29122

- PCSK6_HUMAN

UniProt

P29122 - PCSK6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Proprotein convertase subtilisin/kexin type 6

Gene

PCSK6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.

Catalytic activityi

Release of mature proteins from their proproteins by cleavage of Arg-Xaa-Yaa-Arg-|-Zaa bonds, where Xaa can be any amino acid and Yaa is Arg or Lys.

Cofactori

Calcium.Curated

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei149 – 1502Cleavage; by autolysis
Active sitei205 – 2051Charge relay systemBy similarity
Active sitei246 – 2461Charge relay systemBy similarity
Active sitei420 – 4201Charge relay systemBy similarity

GO - Molecular functioni

  1. endopeptidase activity Source: BHF-UCL
  2. heparin binding Source: BHF-UCL
  3. nerve growth factor binding Source: BHF-UCL
  4. serine-type endopeptidase activity Source: BHF-UCL

GO - Biological processi

  1. determination of left/right symmetry Source: Ensembl
  2. glycoprotein metabolic process Source: BHF-UCL
  3. nerve growth factor processing Source: Reactome
  4. nerve growth factor production Source: BHF-UCL
  5. neurotrophin TRK receptor signaling pathway Source: Reactome
  6. peptide hormone processing Source: BHF-UCL
  7. protein processing Source: BHF-UCL
  8. regulation of BMP signaling pathway Source: BHF-UCL
  9. secretion by cell Source: BHF-UCL
  10. zygotic determination of anterior/posterior axis, embryo Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_11062. NGF processing.
REACT_111057. Signaling by NODAL.
SignaLinkiP29122.

Protein family/group databases

MEROPSiS08.075.

Names & Taxonomyi

Protein namesi
Recommended name:
Proprotein convertase subtilisin/kexin type 6 (EC:3.4.21.-)
Alternative name(s):
Paired basic amino acid cleaving enzyme 4
Subtilisin-like proprotein convertase 4
Short name:
SPC4
Subtilisin/kexin-like protease PACE4
Gene namesi
Name:PCSK6
Synonyms:PACE4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:8569. PCSK6.

Subcellular locationi

Isoform PACE4C : Endoplasmic reticulum
Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum.
Isoform PACE4CS : Endoplasmic reticulum
Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum.
Isoform PACE4E-I : Endomembrane system; Peripheral membrane protein
Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus.
Isoform PACE4E-II : Endomembrane system; Peripheral membrane protein
Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus.

GO - Cellular componenti

  1. cell surface Source: BHF-UCL
  2. endoplasmic reticulum Source: UniProtKB-KW
  3. extracellular matrix Source: BHF-UCL
  4. extracellular space Source: BHF-UCL
  5. Golgi lumen Source: Reactome
  6. membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA32895.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 6363Sequence AnalysisAdd
BLAST
Propeptidei64 – 14986PRO_0000027110Add
BLAST
Chaini150 – 969820Proprotein convertase subtilisin/kexin type 6PRO_0000027111Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi914 – 9141N-linked (GlcNAc...)Sequence Analysis
Glycosylationi932 – 9321N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Zymogen

Proteomic databases

MaxQBiP29122.
PaxDbiP29122.
PRIDEiP29122.

PTM databases

PhosphoSiteiP29122.

Expressioni

Tissue specificityi

Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.

Gene expression databases

BgeeiP29122.
ExpressionAtlasiP29122. baseline and differential.
GenevestigatoriP29122.

Organism-specific databases

HPAiHPA004774.

Interactioni

Subunit structurei

The PACE4A-I precursor protein seems to exist in the reticulum endoplasmic as both a monomer and a dimer-sized complex whereas mature PACE4A-I exists only as a monomer, suggesting that propeptide cleavage affects its tertiary or quaternary structure.

Protein-protein interaction databases

BioGridi111083. 4 interactions.
DIPiDIP-29903N.
IntActiP29122. 4 interactions.
MINTiMINT-3011239.

Structurei

3D structure databases

ProteinModelPortaliP29122.
SMRiP29122. Positions 70-141, 162-633, 690-836.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini200 – 487288Peptidase S8Add
BLAST
Repeati692 – 73948FU 1Add
BLAST
Repeati743 – 79048FU 2Add
BLAST
Repeati794 – 83845FU 3Add
BLAST
Repeati842 – 88746FU 4Add
BLAST
Repeati895 – 94349FU 5Add
BLAST
Domaini931 – 96939PLACPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni695 – 930236CRM (Cys-rich motif)Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi553 – 5553Cell attachment siteSequence Analysis

Domaini

The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum. Isoform PACE4D lacks the propeptide domain.

Sequence similaritiesi

Belongs to the peptidase S8 family.Curated
Contains 5 FU (furin-like) repeats.Curated
Contains 1 peptidase S8 domain.Curated
Contains 1 PLAC domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiCOG4935.
GeneTreeiENSGT00750000117358.
HOVERGENiHBG008705.
InParanoidiP29122.
KOiK08672.
PhylomeDBiP29122.
TreeFamiTF314277.

Family and domain databases

Gene3Di2.60.120.260. 1 hit.
3.40.50.200. 1 hit.
InterProiIPR006212. Furin_repeat.
IPR008979. Galactose-bd-like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000209. Peptidase_S8/S53_dom.
IPR023827. Peptidase_S8_Asp-AS.
IPR022398. Peptidase_S8_His-AS.
IPR023828. Peptidase_S8_Ser-AS.
IPR015500. Peptidase_S8_subtilisin-rel.
IPR010909. PLAC.
IPR009020. Prot_inh_propept.
IPR002884. PrprotnconvertsP.
[Graphical view]
PANTHERiPTHR10795. PTHR10795. 1 hit.
PfamiPF01483. P_proprotein. 1 hit.
PF00082. Peptidase_S8. 1 hit.
PF08686. PLAC. 1 hit.
[Graphical view]
PRINTSiPR00723. SUBTILISIN.
SMARTiSM00261. FU. 5 hits.
[Graphical view]
SUPFAMiSSF49785. SSF49785. 1 hit.
SSF52743. SSF52743. 1 hit.
SSF54897. SSF54897. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEiPS50900. PLAC. 1 hit.
PS00136. SUBTILASE_ASP. 1 hit.
PS00137. SUBTILASE_HIS. 1 hit.
PS00138. SUBTILASE_SER. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform PACE4A-I (identifier: P29122-1) [UniParc]FASTAAdd to Basket

Also known as: PACE4

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPRAPPAPG PRPPPRAAAA TDTAAGAGGA GGAGGAGGPG FRPLAPRPWR
60 70 80 90 100
WLLLLALPAA CSAPPPRPVY TNHWAVQVLG GPAEADRVAA AHGYLNLGQI
110 120 130 140 150
GNLEDYYHFY HSKTFKRSTL SSRGPHTFLR MDPQVKWLQQ QEVKRRVKRQ
160 170 180 190 200
VRSDPQALYF NDPIWSNMWY LHCGDKNSRC RSEMNVQAAW KRGYTGKNVV
210 220 230 240 250
VTILDDGIER NHPDLAPNYD SYASYDVNGN DYDPSPRYDA SNENKHGTRC
260 270 280 290 300
AGEVAASANN SYCIVGIAYN AKIGGIRMLD GDVTDVVEAK SLGIRPNYID
310 320 330 340 350
IYSASWGPDD DGKTVDGPGR LAKQAFEYGI KKGRQGLGSI FVWASGNGGR
360 370 380 390 400
EGDYCSCDGY TNSIYTISVS SATENGYKPW YLEECASTLA TTYSSGAFYE
410 420 430 440 450
RKIVTTDLRQ RCTDGHTGTS VSAPMVAGII ALALEANSQL TWRDVQHLLV
460 470 480 490 500
KTSRPAHLKA SDWKVNGAGH KVSHFYGFGL VDAEALVVEA KKWTAVPSQH
510 520 530 540 550
MCVAASDKRP RSIPLVQVLR TTALTSACAE HSDQRVVYLE HVVVRTSISH
560 570 580 590 600
PRRGDLQIYL VSPSGTKSQL LAKRLLDLSN EGFTNWEFMT VHCWGEKAEG
610 620 630 640 650
QWTLEIQDLP SQVRNPEKQG KLKEWSLILY GTAEHPYHTF SAHQSRSRML
660 670 680 690 700
ELSAPELEPP KAALSPSQVE VPEDEEDYTA QSTPGSANIL QTSVCHPECG
710 720 730 740 750
DKGCDGPNAD QCLNCVHFSL GSVKTSRKCV SVCPLGYFGD TAARRCRRCH
760 770 780 790 800
KGCETCSSRA ATQCLSCRRG FYHHQEMNTC VTLCPAGFYA DESQKNCLKC
810 820 830 840 850
HPSCKKCVDE PEKCTVCKEG FSLARGSCIP DCEPGTYFDS ELIRCGECHH
860 870 880 890 900
TCGTCVGPGR EECIHCAKNF HFHDWKCVPA CGEGFYPEEM PGLPHKVCRR
910 920 930 940 950
CDENCLSCAG SSRNCSRCKT GFTQLGTSCI TNHTCSNADE TFCEMVKSNR
960
LCERKLFIQF CCRTCLLAG
Length:969
Mass (Da):106,420
Last modified:December 1, 1992 - v1
Checksum:iA3599CC278D09B05
GO
Isoform PACE4A-II (identifier: P29122-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     680-693: AQSTPGSANILQTS → G

Show »
Length:956
Mass (Da):105,121
Checksum:iBA240E3EEBCC862F
GO
Isoform PACE4B (identifier: P29122-3) [UniParc]FASTAAdd to Basket

Also known as: PACE4.1

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KGAAVAFWWTIGWPWNV
     472-969: Missing.

Note: Probably enzymatically inactive.

Show »
Length:487
Mass (Da):53,044
Checksum:i10DB376359A7F1AF
GO
Isoform PACE4C (identifier: P29122-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-652: KLKEWSLILYGTAEHPYHTFSAHQSRSRMLEL → DLETPVANQLTTEEREPGLKHVFRWQIEQELW
     653-969: Missing.

Note: Probably enzymatically inactive.

Show »
Length:652
Mass (Da):71,771
Checksum:i880D99278881942C
GO
Isoform PACE4CS (identifier: P29122-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-623: KLK → NLD
     624-969: Missing.

Note: Probably enzymatically inactive.

Show »
Length:623
Mass (Da):68,238
Checksum:i19BCB5350278C621
GO
Isoform PACE4D (identifier: P29122-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-167: Missing.
     621-664: KLKEWSLILY...PELEPPKAAL → DLETPVANQL...YHIVLITVAL
     665-969: Missing.

Note: Probably enzymatically inactive.

Show »
Length:497
Mass (Da):54,900
Checksum:i46C1F64CAEA0E3EB
GO
Isoform PACE4E-I (identifier: P29122-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

Show »
Length:975
Mass (Da):106,674
Checksum:i31983E526116A67C
GO
Isoform PACE4E-II (identifier: P29122-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     680-693: AQSTPGSANILQTS → G
     901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

Show »
Length:962
Mass (Da):105,375
Checksum:iF16ABF9230DE5F01
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti639 – 6391T → I in BAA21624. (PubMed:9378725)Curated
Sequence conflicti639 – 6391T → I in BAA21625. (PubMed:9378725)Curated
Sequence conflicti639 – 6391T → I in BAA21626. (PubMed:9378725)Curated
Sequence conflicti639 – 6391T → I in BAA21627. (PubMed:9378725)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti502 – 5021C → R.
Corresponds to variant rs1058260 [ dbSNP | Ensembl ].
VAR_051824

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 167167Missing in isoform PACE4D. 1 PublicationVSP_005427Add
BLAST
Alternative sequencei471 – 4711K → KGAAVAFWWTIGWPWNV in isoform PACE4B. 1 PublicationVSP_005428
Alternative sequencei472 – 969498Missing in isoform PACE4B. 1 PublicationVSP_005429Add
BLAST
Alternative sequencei621 – 66444KLKEW…PKAAL → DLETPVANQLTTEERFVSTP SILFHWSVYLSWSQYHIVLI TVAL in isoform PACE4D. 1 PublicationVSP_005434Add
BLAST
Alternative sequencei621 – 65232KLKEW…RMLEL → DLETPVANQLTTEEREPGLK HVFRWQIEQELW in isoform PACE4C. 1 PublicationVSP_005432Add
BLAST
Alternative sequencei621 – 6233KLK → NLD in isoform PACE4CS. CuratedVSP_005430
Alternative sequencei624 – 969346Missing in isoform PACE4CS. CuratedVSP_005431Add
BLAST
Alternative sequencei653 – 969317Missing in isoform PACE4C. 1 PublicationVSP_005433Add
BLAST
Alternative sequencei665 – 969305Missing in isoform PACE4D. 1 PublicationVSP_005435Add
BLAST
Alternative sequencei680 – 69314AQSTP…ILQTS → G in isoform PACE4A-II and isoform PACE4E-II. 1 PublicationVSP_005436Add
BLAST
Alternative sequencei901 – 96969CDENC…CLLAG → YGPPGGERQATVSSKGVPGG QSLSASSPGAGEGMLHHPTV DRSPFTELLRGLRPFVHWMH ICWVPAVGRHRAAAG in isoform PACE4E-I and isoform PACE4E-II. 1 PublicationVSP_005437Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M80482 mRNA. Translation: AAA59998.1.
AB001914 Genomic DNA. Translation: BAA21620.1.
AB001914 Genomic DNA. Translation: BAA21621.1.
AB001914 Genomic DNA. Translation: BAA21622.1.
AB001914 Genomic DNA. Translation: BAA21623.1.
AB001914 Genomic DNA. Translation: BAA21624.1.
AB001914 Genomic DNA. Translation: BAA21625.1.
AB001914 Genomic DNA. Translation: BAA21626.1.
AB001914 Genomic DNA. Translation: BAA21627.1.
D28513 mRNA. Translation: BAA05871.1.
D28514 mRNA. Translation: BAA05872.1.
D87995 mRNA. Translation: BAA21793.1.
D87993 mRNA. Translation: BAA21791.1.
D87994 mRNA. Translation: BAA21792.1.
CCDSiCCDS73789.1. [P29122-2]
CCDS73790.1. [P29122-1]
CCDS73791.1. [P29122-5]
CCDS73793.1. [P29122-4]
PIRiA39490.
B39490.
JC2191.
JC2192.
JC5570.
JC5571.
RefSeqiNP_001278238.1. NM_001291309.1.
NP_002561.1. NM_002570.4. [P29122-1]
NP_612192.1. NM_138319.3. [P29122-2]
NP_612195.1. NM_138322.3. [P29122-3]
NP_612196.1. NM_138323.2. [P29122-5]
NP_612197.1. NM_138324.2. [P29122-4]
NP_612198.2. NM_138325.3.
UniGeneiHs.498494.
Hs.665989.

Genome annotation databases

EnsembliENST00000611716; ENSP00000482760; ENSG00000140479. [P29122-1]
ENST00000611967; ENSP00000477768; ENSG00000140479. [P29122-4]
ENST00000615296; ENSP00000478081; ENSG00000140479. [P29122-5]
ENST00000618548; ENSP00000479496; ENSG00000140479. [P29122-2]
GeneIDi5046.
KEGGihsa:5046.
UCSCiuc002bwy.3. human. [P29122-1]
uc002bxa.2. human. [P29122-7]
uc002bxb.2. human. [P29122-8]
uc002bxc.1. human. [P29122-4]
uc002bxd.1. human. [P29122-5]
uc002bxg.1. human. [P29122-3]
uc010bpe.3. human. [P29122-2]

Polymorphism databases

DMDMi129542.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M80482 mRNA. Translation: AAA59998.1 .
AB001914 Genomic DNA. Translation: BAA21620.1 .
AB001914 Genomic DNA. Translation: BAA21621.1 .
AB001914 Genomic DNA. Translation: BAA21622.1 .
AB001914 Genomic DNA. Translation: BAA21623.1 .
AB001914 Genomic DNA. Translation: BAA21624.1 .
AB001914 Genomic DNA. Translation: BAA21625.1 .
AB001914 Genomic DNA. Translation: BAA21626.1 .
AB001914 Genomic DNA. Translation: BAA21627.1 .
D28513 mRNA. Translation: BAA05871.1 .
D28514 mRNA. Translation: BAA05872.1 .
D87995 mRNA. Translation: BAA21793.1 .
D87993 mRNA. Translation: BAA21791.1 .
D87994 mRNA. Translation: BAA21792.1 .
CCDSi CCDS73789.1. [P29122-2 ]
CCDS73790.1. [P29122-1 ]
CCDS73791.1. [P29122-5 ]
CCDS73793.1. [P29122-4 ]
PIRi A39490.
B39490.
JC2191.
JC2192.
JC5570.
JC5571.
RefSeqi NP_001278238.1. NM_001291309.1.
NP_002561.1. NM_002570.4. [P29122-1 ]
NP_612192.1. NM_138319.3. [P29122-2 ]
NP_612195.1. NM_138322.3. [P29122-3 ]
NP_612196.1. NM_138323.2. [P29122-5 ]
NP_612197.1. NM_138324.2. [P29122-4 ]
NP_612198.2. NM_138325.3.
UniGenei Hs.498494.
Hs.665989.

3D structure databases

ProteinModelPortali P29122.
SMRi P29122. Positions 70-141, 162-633, 690-836.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111083. 4 interactions.
DIPi DIP-29903N.
IntActi P29122. 4 interactions.
MINTi MINT-3011239.

Chemistry

BindingDBi P29122.
ChEMBLi CHEMBL2951.

Protein family/group databases

MEROPSi S08.075.

PTM databases

PhosphoSitei P29122.

Polymorphism databases

DMDMi 129542.

Proteomic databases

MaxQBi P29122.
PaxDbi P29122.
PRIDEi P29122.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000611716 ; ENSP00000482760 ; ENSG00000140479 . [P29122-1 ]
ENST00000611967 ; ENSP00000477768 ; ENSG00000140479 . [P29122-4 ]
ENST00000615296 ; ENSP00000478081 ; ENSG00000140479 . [P29122-5 ]
ENST00000618548 ; ENSP00000479496 ; ENSG00000140479 . [P29122-2 ]
GeneIDi 5046.
KEGGi hsa:5046.
UCSCi uc002bwy.3. human. [P29122-1 ]
uc002bxa.2. human. [P29122-7 ]
uc002bxb.2. human. [P29122-8 ]
uc002bxc.1. human. [P29122-4 ]
uc002bxd.1. human. [P29122-5 ]
uc002bxg.1. human. [P29122-3 ]
uc010bpe.3. human. [P29122-2 ]

Organism-specific databases

CTDi 5046.
GeneCardsi GC15M101844.
HGNCi HGNC:8569. PCSK6.
HPAi HPA004774.
MIMi 167405. gene.
neXtProti NX_P29122.
PharmGKBi PA32895.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4935.
GeneTreei ENSGT00750000117358.
HOVERGENi HBG008705.
InParanoidi P29122.
KOi K08672.
PhylomeDBi P29122.
TreeFami TF314277.

Enzyme and pathway databases

Reactomei REACT_11062. NGF processing.
REACT_111057. Signaling by NODAL.
SignaLinki P29122.

Miscellaneous databases

GeneWikii PCSK6.
GenomeRNAii 5046.
NextBioi 19426.
PROi P29122.
SOURCEi Search...

Gene expression databases

Bgeei P29122.
ExpressionAtlasi P29122. baseline and differential.
Genevestigatori P29122.

Family and domain databases

Gene3Di 2.60.120.260. 1 hit.
3.40.50.200. 1 hit.
InterProi IPR006212. Furin_repeat.
IPR008979. Galactose-bd-like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000209. Peptidase_S8/S53_dom.
IPR023827. Peptidase_S8_Asp-AS.
IPR022398. Peptidase_S8_His-AS.
IPR023828. Peptidase_S8_Ser-AS.
IPR015500. Peptidase_S8_subtilisin-rel.
IPR010909. PLAC.
IPR009020. Prot_inh_propept.
IPR002884. PrprotnconvertsP.
[Graphical view ]
PANTHERi PTHR10795. PTHR10795. 1 hit.
Pfami PF01483. P_proprotein. 1 hit.
PF00082. Peptidase_S8. 1 hit.
PF08686. PLAC. 1 hit.
[Graphical view ]
PRINTSi PR00723. SUBTILISIN.
SMARTi SM00261. FU. 5 hits.
[Graphical view ]
SUPFAMi SSF49785. SSF49785. 1 hit.
SSF52743. SSF52743. 1 hit.
SSF54897. SSF54897. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEi PS50900. PLAC. 1 hit.
PS00136. SUBTILASE_ASP. 1 hit.
PS00137. SUBTILASE_HIS. 1 hit.
PS00138. SUBTILASE_SER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Identification of a second human subtilisin-like protease gene in the fes/fps region of chromosome 15."
    Kiefer M.C., Tucker J.E., Joh R., Landsberg K.E., Saltman D., Barr P.J.
    DNA Cell Biol. 10:757-769(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4A-I AND PACE4B).
    Tissue: Hepatoma and Kidney.
  2. "Identification of novel cDNAs encoding human kexin-like protease, PACE4 isoforms."
    Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H., Matsuda Y.
    Biochem. Biophys. Res. Commun. 200:943-950(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4C AND PACE4D).
    Tissue: Placenta.
  3. "Identification of a novel PACE4 isoform, PACE4E."
    Mori K., Imamaki A., Kii S., Nagamune H., Nagahama M., Tsuji A., Matsuda Y.
    Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM PACE4A-II).
    Tissue: Placenta.
  4. "A novel human PACE4 isoform, PACE4E is an active processing protease containing a hydrophobic cluster at the carboxy terminus."
    Mori K., Kii S., Tsuji A., Nagahama M., Imamaki A., Hayashi K., Akamatsu T., Nagamune H., Matsuda Y.
    J. Biochem. 121:941-948(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4E-I AND PACE4E-II).
    Tissue: Cerebellum.
  5. "Genomic organization and alternative splicing of human PACE4 (SPC4), kexin-like processing endoprotease."
    Tsuji A., Hine C., Tamai Y., Yonemoto K., Mori K., Yoshida S., Bando M., Sakai E., Mori K., Akamatsu T., Matsuda Y.
    J. Biochem. 122:438-452(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS PACE4A-I; PACE4A-II; PACE4CS; PACE4D; PACE4E-I AND PACE4E-II).
  6. "Functional analysis of human PACE4-A and PACE4-C isoforms: identification of a new PACE4-CS isoform."
    Zhong M., Benjannet S., Lazure C., Munzer S., Seidah N.G.
    FEBS Lett. 396:31-36(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM PACE4CS).
  7. "Endoprotease PACE4 is Ca2+-dependent and temperature-sensitive and can partly rescue the phenotype of a furin-deficient cell strain."
    Sucic J.F., Moehring J.M., Inocencio N.M., Luchini J.W., Moehring T.J.
    Biochem. J. 339:639-647(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. "Biosynthetic processing and quaternary interactions of proprotein convertase SPC4 (PACE4)."
    Nagahama M., Taniguchi T., Hashimoto E., Imamaki A., Mori K., Tsuji A., Matsuda Y.
    FEBS Lett. 434:155-159(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEOLYTIC PROCESSING.

Entry informationi

Entry nameiPCSK6_HUMAN
AccessioniPrimary (citable) accession number: P29122
Secondary accession number(s): Q15099
, Q15100, Q9UEG7, Q9UEJ1, Q9UEJ2, Q9UEJ7, Q9UEJ8, Q9UEJ9, Q9Y4G9, Q9Y4H0, Q9Y4H1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: December 1, 1992
Last modified: October 29, 2014
This is version 153 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3