P29122 (PCSK6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proprotein convertase subtilisin/kexin type 6 EC=3.4.21.- Alternative name(s): Paired basic amino acid cleaving enzyme 4 Subtilisin-like proprotein convertase 4 Short name=SPC4 Subtilisin/kexin-like protease PACE4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 969 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif. |
| Catalytic activity | Release of mature proteins from their proproteins by cleavage of Arg-Xaa-Yaa-Arg-|-Zaa bonds, where Xaa can be any amino acid and Yaa is Arg or Lys. |
| Cofactor | Calcium Potential. |
| Subunit structure | The PACE4A-I precursor protein seems to exist in the reticulum endoplasmic as both a monomer and a dimer-sized complex whereas mature PACE4A-I exists only as a monomer, suggesting that propeptide cleavage affects its tertiary or quaternary structure. |
| Subcellular location | Isoform PACE4C: Endoplasmic reticulum. Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum. Isoform PACE4CS: Endoplasmic reticulum. Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum. Isoform PACE4E-I: Endomembrane system; Peripheral membrane protein. Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus. Isoform PACE4E-II: Endomembrane system; Peripheral membrane protein. Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus. |
| Tissue specificity | Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum. |
| Domain | The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum. Isoform PACE4D lacks the propeptide domain. |
| Sequence similarities | Belongs to the peptidase S8 family. Contains 1 homo B/P domain. Contains 1 PLAC domain. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PACE4A-I (identifier: P29122-1) Also known as: PACE4; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PACE4A-II (identifier: P29122-2) The sequence of this isoform differs from the canonical sequence as follows: 680-693: AQSTPGSANILQTS → G | ||||||
| Isoform PACE4B (identifier: P29122-3) Also known as: PACE4.1; The sequence of this isoform differs from the canonical sequence as follows: 471-471: K → KGAAVAFWWTIGWPWNV 472-969: Missing. | ||||||
| Note: Probably enzymatically inactive. | ||||||
| Isoform PACE4C (identifier: P29122-4) The sequence of this isoform differs from the canonical sequence as follows: 621-652: KLKEWSLILYGTAEHPYHTFSAHQSRSRMLEL → DLETPVANQLTTEEREPGLKHVFRWQIEQELW 653-969: Missing. | ||||||
| Note: Probably enzymatically inactive. | ||||||
| Isoform PACE4CS (identifier: P29122-5) The sequence of this isoform differs from the canonical sequence as follows: 621-623: KLK → NLD 624-969: Missing. | ||||||
| Note: Probably enzymatically inactive. | ||||||
| Isoform PACE4D (identifier: P29122-6) The sequence of this isoform differs from the canonical sequence as follows: 1-167: Missing. 621-664: KLKEWSLILY...PELEPPKAAL → DLETPVANQL...YHIVLITVAL 665-969: Missing. | ||||||
| Note: Probably enzymatically inactive. | ||||||
| Isoform PACE4E-I (identifier: P29122-7) The sequence of this isoform differs from the canonical sequence as follows: 901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG | ||||||
| Isoform PACE4E-II (identifier: P29122-8) The sequence of this isoform differs from the canonical sequence as follows: 680-693: AQSTPGSANILQTS → G 901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 63 | 63 | Potential | ||||||
| Propeptide | 64 – 149 | 86 | PRO_0000027110 | ||||||
| Chain | 150 – 969 | 820 | Proprotein convertase subtilisin/kexin type 6 | PRO_0000027111 | |||||
Regions | |||||||||
| Domain | 496 – 634 | 139 | Homo B/P | ||||||
| Domain | 931 – 969 | 39 | PLAC | ||||||
| Region | 150 – 454 | 305 | Catalytic | ||||||
| Region | 695 – 930 | 236 | CRM (Cys-rich motif) | ||||||
| Motif | 553 – 555 | 3 | Cell attachment site Potential | ||||||
Sites | |||||||||
| Active site | 205 | 1 | Charge relay system By similarity | ||||||
| Active site | 246 | 1 | Charge relay system By similarity | ||||||
| Active site | 420 | 1 | Charge relay system By similarity | ||||||
| Site | 149 – 150 | 2 | Cleavage; by autolysis | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 914 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 932 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 167 | 167 | Missing in isoform PACE4D. | VSP_005427 | |||||
| Alternative sequence | 471 | 1 | K → KGAAVAFWWTIGWPWNV in isoform PACE4B. | VSP_005428 | |||||
| Alternative sequence | 472 – 969 | 498 | Missing in isoform PACE4B. | VSP_005429 | |||||
| Alternative sequence | 621 – 664 | 44 | KLKEW…PKAAL → DLETPVANQLTTEERFVSTP SILFHWSVYLSWSQYHIVLI TVAL in isoform PACE4D. | VSP_005434 | |||||
| Alternative sequence | 621 – 652 | 32 | KLKEW…RMLEL → DLETPVANQLTTEEREPGLK HVFRWQIEQELW in isoform PACE4C. | VSP_005432 | |||||
| Alternative sequence | 621 – 623 | 3 | KLK → NLD in isoform PACE4CS. | VSP_005430 | |||||
| Alternative sequence | 624 – 969 | 346 | Missing in isoform PACE4CS. | VSP_005431 | |||||
| Alternative sequence | 653 – 969 | 317 | Missing in isoform PACE4C. | VSP_005433 | |||||
| Alternative sequence | 665 – 969 | 305 | Missing in isoform PACE4D. | VSP_005435 | |||||
| Alternative sequence | 680 – 693 | 14 | AQSTP…ILQTS → G in isoform PACE4A-II and isoform PACE4E-II. | VSP_005436 | |||||
| Alternative sequence | 901 – 969 | 69 | CDENC…CLLAG → YGPPGGERQATVSSKGVPGG QSLSASSPGAGEGMLHHPTV DRSPFTELLRGLRPFVHWMH ICWVPAVGRHRAAAG in isoform PACE4E-I and isoform PACE4E-II. | VSP_005437 | |||||
| Natural variant | 502 | 1 | C → R. Corresponds to variant rs1058260 [ dbSNP | Ensembl ]. | VAR_051824 | |||||
Experimental info | |||||||||
| Sequence conflict | 639 | 1 | T → I in BAA21624. Ref.6 | ||||||
| Sequence conflict | 639 | 1 | T → I in BAA21625. Ref.6 | ||||||
| Sequence conflict | 639 | 1 | T → I in BAA21626. Ref.6 | ||||||
| Sequence conflict | 639 | 1 | T → I in BAA21627. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Identification of a second human subtilisin-like protease gene in the fes/fps region of chromosome 15." Kiefer M.C., Tucker J.E., Joh R., Landsberg K.E., Saltman D., Barr P.J. DNA Cell Biol. 10:757-769(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4A-I AND PACE4B). Tissue: Hepatoma and Kidney. |
| [2] | "Identification of novel cDNAs encoding human kexin-like protease, PACE4 isoforms." Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H., Matsuda Y. Biochem. Biophys. Res. Commun. 200:943-950(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4C AND PACE4D). Tissue: Placenta. |
| [3] | Erratum Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H., Matsuda Y. Biochem. Biophys. Res. Commun. 204:1381-1382(1994) [PubMed] [Europe PMC] [Abstract] |
| [4] | "Identification of a novel PACE4 isoform, PACE4E." Mori K., Imamaki A., Kii S., Nagamune H., Nagahama M., Tsuji A., Matsuda Y. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM PACE4A-II). Tissue: Placenta. |
| [5] | "A novel human PACE4 isoform, PACE4E is an active processing protease containing a hydrophobic cluster at the carboxy terminus." Mori K., Kii S., Tsuji A., Nagahama M., Imamaki A., Hayashi K., Akamatsu T., Nagamune H., Matsuda Y. J. Biochem. 121:941-948(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4E-I AND PACE4E-II). Tissue: Cerebellum. |
| [6] | "Genomic organization and alternative splicing of human PACE4 (SPC4), kexin-like processing endoprotease." Tsuji A., Hine C., Tamai Y., Yonemoto K., Mori K., Yoshida S., Bando M., Sakai E., Mori K., Akamatsu T., Matsuda Y. J. Biochem. 122:438-452(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS PACE4A-I; PACE4A-II; PACE4CS; PACE4D; PACE4E-I AND PACE4E-II). |
| [7] | "Functional analysis of human PACE4-A and PACE4-C isoforms: identification of a new PACE4-CS isoform." Zhong M., Benjannet S., Lazure C., Munzer S., Seidah N.G. FEBS Lett. 396:31-36(1996) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM PACE4CS). |
| [8] | "Endoprotease PACE4 is Ca2+-dependent and temperature-sensitive and can partly rescue the phenotype of a furin-deficient cell strain." Sucic J.F., Moehring J.M., Inocencio N.M., Luchini J.W., Moehring T.J. Biochem. J. 339:639-647(1999) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION. |
| [9] | "Biosynthetic processing and quaternary interactions of proprotein convertase SPC4 (PACE4)." Nagahama M., Taniguchi T., Hashimoto E., Imamaki A., Mori K., Tsuji A., Matsuda Y. FEBS Lett. 434:155-159(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M80482 mRNA. Translation: AAA59998.1. AB001914 Genomic DNA. Translation: BAA21620.1. AB001914 Genomic DNA. Translation: BAA21621.1. AB001914 Genomic DNA. Translation: BAA21622.1. AB001914 Genomic DNA. Translation: BAA21623.1. AB001914 Genomic DNA. Translation: BAA21624.1. AB001914 Genomic DNA. Translation: BAA21625.1. AB001914 Genomic DNA. Translation: BAA21626.1. AB001914 Genomic DNA. Translation: BAA21627.1. D28513 mRNA. Translation: BAA05871.1. D28514 mRNA. Translation: BAA05872.1. D87995 mRNA. Translation: BAA21793.1. D87993 mRNA. Translation: BAA21791.1. D87994 mRNA. Translation: BAA21792.1. |
| IPI | IPI00020396. IPI00217331. IPI00217332. IPI00217333. IPI00217334. IPI00293159. IPI00332449. IPI00982047. |
| PIR | A39490. B39490. JC2191. JC2192. JC5570. JC5571. |
| RefSeq | NP_002561.1. NM_002570.3. NP_612192.1. NM_138319.2. NP_612193.1. NM_138320.1. NP_612194.1. NM_138321.1. NP_612195.1. NM_138322.2. NP_612196.1. NM_138323.1. NP_612197.1. NM_138324.1. NP_612198.2. NM_138325.2. |
| UniGene | Hs.498494. Hs.665989. |
3D structure databases | |
| ProteinModelPortal | P29122. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29903N. |
| IntAct | P29122. 3 interactions. |
Protein family/group databases | |
| MEROPS | S08.075. |
PTM databases | |
| PhosphoSite | P29122. |
Polymorphism databases | |
| DMDM | 129542. |
Proteomic databases | |
| PaxDb | P29122. |
| PRIDE | P29122. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000348070; ENSP00000305056; ENSG00000140479. |
| GeneID | 5046. |
| KEGG | hsa:5046. |
| UCSC | uc002bwy.3. human. uc002bxa.2. human. uc002bxb.2. human. uc002bxc.1. human. uc002bxd.1. human. uc002bxg.1. human. uc010bpe.3. human. |
Organism-specific databases | |
| CTD | 5046. |
| GeneCards | GC15M101844. |
| HGNC | HGNC:8569. PCSK6. |
| HPA | HPA004774. |
| MIM | 167405. gene. |
| neXtProt | NX_P29122. |
| PharmGKB | PA32895. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG4935. |
| HOVERGEN | HBG008705. |
| InParanoid | P29122. |
| KO | K08672. |
| OrthoDB | EOG44MXR9. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P29122. |
| Bgee | P29122. |
| Genevestigator | P29122. |
| GermOnline | ENSG00000140479. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.200. 1 hit. |
| InterPro | IPR006212. Furin_repeat. IPR008979. Galactose-bd-like. IPR009030. Growth_fac_rcpt. IPR000209. Peptidase_S8/S53_dom. IPR023827. Peptidase_S8_Asp-AS. IPR022398. Peptidase_S8_His-AS. IPR023828. Peptidase_S8_Ser-AS. IPR015500. Peptidase_S8_subtilisin-rel. IPR010909. PLAC. IPR009020. Prot_inh_propept. IPR002884. PrprotnconvertsP. [Graphical view] |
| PANTHER | PTHR10795. PTHR10795. 1 hit. |
| Pfam | PF01483. P_proprotein. 1 hit. PF00082. Peptidase_S8. 1 hit. PF08686. PLAC. 1 hit. [Graphical view] |
| PRINTS | PR00723. SUBTILISIN. |
| SMART | SM00261. FU. 5 hits. [Graphical view] |
| SUPFAM | SSF49785. Gal_bind_like. 1 hit. SSF57184. Grow_fac_recept. 2 hits. SSF52743. Pept_S8_S53. 1 hit. SSF54897. Prot_inh_propept. 1 hit. |
| PROSITE | PS50900. PLAC. 1 hit. PS00136. SUBTILASE_ASP. 1 hit. PS00137. SUBTILASE_HIS. 1 hit. PS00138. SUBTILASE_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P29122. |
| ChEMBL | CHEMBL2951. |
| GenomeRNAi | 5046. |
| NextBio | 19426. |
| SOURCE | Search... |
Entry information
| Entry name | PCSK6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29122 Secondary accession number(s): Q15099 Q9Y4H1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
