Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P29122

- PCSK6_HUMAN

UniProt

P29122 - PCSK6_HUMAN

Protein

Proprotein convertase subtilisin/kexin type 6

Gene

PCSK6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 152 (01 Oct 2014)
      Sequence version 1 (01 Dec 1992)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.

    Catalytic activityi

    Release of mature proteins from their proproteins by cleavage of Arg-Xaa-Yaa-Arg-|-Zaa bonds, where Xaa can be any amino acid and Yaa is Arg or Lys.

    Cofactori

    Calcium.Curated

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei149 – 1502Cleavage; by autolysis
    Active sitei205 – 2051Charge relay systemBy similarity
    Active sitei246 – 2461Charge relay systemBy similarity
    Active sitei420 – 4201Charge relay systemBy similarity

    GO - Molecular functioni

    1. endopeptidase activity Source: BHF-UCL
    2. heparin binding Source: BHF-UCL
    3. nerve growth factor binding Source: BHF-UCL
    4. serine-type endopeptidase activity Source: BHF-UCL

    GO - Biological processi

    1. determination of left/right symmetry Source: Ensembl
    2. glycoprotein metabolic process Source: BHF-UCL
    3. nerve growth factor processing Source: Reactome
    4. nerve growth factor production Source: BHF-UCL
    5. neurotrophin TRK receptor signaling pathway Source: Reactome
    6. peptide hormone processing Source: BHF-UCL
    7. protein processing Source: BHF-UCL
    8. regulation of BMP signaling pathway Source: BHF-UCL
    9. secretion by cell Source: BHF-UCL
    10. zygotic determination of anterior/posterior axis, embryo Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase, Protease, Serine protease

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_11062. NGF processing.
    REACT_111057. Signaling by NODAL.
    SignaLinkiP29122.

    Protein family/group databases

    MEROPSiS08.075.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Proprotein convertase subtilisin/kexin type 6 (EC:3.4.21.-)
    Alternative name(s):
    Paired basic amino acid cleaving enzyme 4
    Subtilisin-like proprotein convertase 4
    Short name:
    SPC4
    Subtilisin/kexin-like protease PACE4
    Gene namesi
    Name:PCSK6
    Synonyms:PACE4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:8569. PCSK6.

    Subcellular locationi

    Isoform PACE4C : Endoplasmic reticulum
    Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum.
    Isoform PACE4CS : Endoplasmic reticulum
    Note: Not secreted, remains probably in zymogen form in endoplasmic reticulum.
    Isoform PACE4E-I : Endomembrane system; Peripheral membrane protein
    Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus.
    Isoform PACE4E-II : Endomembrane system; Peripheral membrane protein
    Note: Retained intracellularly probably through a hydrophobic cluster in their C-terminus.

    GO - Cellular componenti

    1. cell surface Source: BHF-UCL
    2. endoplasmic reticulum Source: UniProtKB-SubCell
    3. extracellular matrix Source: BHF-UCL
    4. extracellular space Source: BHF-UCL
    5. Golgi lumen Source: Reactome
    6. membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA32895.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 6363Sequence AnalysisAdd
    BLAST
    Propeptidei64 – 14986PRO_0000027110Add
    BLAST
    Chaini150 – 969820Proprotein convertase subtilisin/kexin type 6PRO_0000027111Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi914 – 9141N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi932 – 9321N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Cleavage on pair of basic residues, Glycoprotein, Zymogen

    Proteomic databases

    MaxQBiP29122.
    PaxDbiP29122.
    PRIDEiP29122.

    PTM databases

    PhosphoSiteiP29122.

    Expressioni

    Tissue specificityi

    Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.

    Gene expression databases

    ArrayExpressiP29122.
    BgeeiP29122.
    GenevestigatoriP29122.

    Organism-specific databases

    HPAiHPA004774.

    Interactioni

    Subunit structurei

    The PACE4A-I precursor protein seems to exist in the reticulum endoplasmic as both a monomer and a dimer-sized complex whereas mature PACE4A-I exists only as a monomer, suggesting that propeptide cleavage affects its tertiary or quaternary structure.

    Protein-protein interaction databases

    BioGridi111083. 3 interactions.
    DIPiDIP-29903N.
    IntActiP29122. 4 interactions.
    MINTiMINT-3011239.

    Structurei

    3D structure databases

    ProteinModelPortaliP29122.
    SMRiP29122. Positions 70-141, 162-633, 690-939.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini200 – 487288Peptidase S8Add
    BLAST
    Repeati692 – 73948FU 1Add
    BLAST
    Repeati743 – 79048FU 2Add
    BLAST
    Repeati794 – 83845FU 3Add
    BLAST
    Repeati842 – 88746FU 4Add
    BLAST
    Repeati895 – 94349FU 5Add
    BLAST
    Domaini931 – 96939PLACPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni695 – 930236CRM (Cys-rich motif)Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi553 – 5553Cell attachment siteSequence Analysis

    Domaini

    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum. Isoform PACE4D lacks the propeptide domain.

    Sequence similaritiesi

    Belongs to the peptidase S8 family.Curated
    Contains 5 FU (furin-like) repeats.Curated
    Contains 1 peptidase S8 domain.Curated
    Contains 1 PLAC domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiCOG4935.
    HOVERGENiHBG008705.
    InParanoidiP29122.
    KOiK08672.
    PhylomeDBiP29122.
    TreeFamiTF314277.

    Family and domain databases

    Gene3Di2.60.120.260. 1 hit.
    3.40.50.200. 1 hit.
    InterProiIPR006212. Furin_repeat.
    IPR008979. Galactose-bd-like.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000209. Peptidase_S8/S53_dom.
    IPR023827. Peptidase_S8_Asp-AS.
    IPR022398. Peptidase_S8_His-AS.
    IPR023828. Peptidase_S8_Ser-AS.
    IPR015500. Peptidase_S8_subtilisin-rel.
    IPR010909. PLAC.
    IPR009020. Prot_inh_propept.
    IPR002884. PrprotnconvertsP.
    [Graphical view]
    PANTHERiPTHR10795. PTHR10795. 1 hit.
    PfamiPF01483. P_proprotein. 1 hit.
    PF00082. Peptidase_S8. 1 hit.
    PF08686. PLAC. 1 hit.
    [Graphical view]
    PRINTSiPR00723. SUBTILISIN.
    SMARTiSM00261. FU. 5 hits.
    [Graphical view]
    SUPFAMiSSF49785. SSF49785. 1 hit.
    SSF52743. SSF52743. 1 hit.
    SSF54897. SSF54897. 1 hit.
    SSF57184. SSF57184. 2 hits.
    PROSITEiPS50900. PLAC. 1 hit.
    PS00136. SUBTILASE_ASP. 1 hit.
    PS00137. SUBTILASE_HIS. 1 hit.
    PS00138. SUBTILASE_SER. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform PACE4A-I (identifier: P29122-1) [UniParc]FASTAAdd to Basket

    Also known as: PACE4

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPPRAPPAPG PRPPPRAAAA TDTAAGAGGA GGAGGAGGPG FRPLAPRPWR    50
    WLLLLALPAA CSAPPPRPVY TNHWAVQVLG GPAEADRVAA AHGYLNLGQI 100
    GNLEDYYHFY HSKTFKRSTL SSRGPHTFLR MDPQVKWLQQ QEVKRRVKRQ 150
    VRSDPQALYF NDPIWSNMWY LHCGDKNSRC RSEMNVQAAW KRGYTGKNVV 200
    VTILDDGIER NHPDLAPNYD SYASYDVNGN DYDPSPRYDA SNENKHGTRC 250
    AGEVAASANN SYCIVGIAYN AKIGGIRMLD GDVTDVVEAK SLGIRPNYID 300
    IYSASWGPDD DGKTVDGPGR LAKQAFEYGI KKGRQGLGSI FVWASGNGGR 350
    EGDYCSCDGY TNSIYTISVS SATENGYKPW YLEECASTLA TTYSSGAFYE 400
    RKIVTTDLRQ RCTDGHTGTS VSAPMVAGII ALALEANSQL TWRDVQHLLV 450
    KTSRPAHLKA SDWKVNGAGH KVSHFYGFGL VDAEALVVEA KKWTAVPSQH 500
    MCVAASDKRP RSIPLVQVLR TTALTSACAE HSDQRVVYLE HVVVRTSISH 550
    PRRGDLQIYL VSPSGTKSQL LAKRLLDLSN EGFTNWEFMT VHCWGEKAEG 600
    QWTLEIQDLP SQVRNPEKQG KLKEWSLILY GTAEHPYHTF SAHQSRSRML 650
    ELSAPELEPP KAALSPSQVE VPEDEEDYTA QSTPGSANIL QTSVCHPECG 700
    DKGCDGPNAD QCLNCVHFSL GSVKTSRKCV SVCPLGYFGD TAARRCRRCH 750
    KGCETCSSRA ATQCLSCRRG FYHHQEMNTC VTLCPAGFYA DESQKNCLKC 800
    HPSCKKCVDE PEKCTVCKEG FSLARGSCIP DCEPGTYFDS ELIRCGECHH 850
    TCGTCVGPGR EECIHCAKNF HFHDWKCVPA CGEGFYPEEM PGLPHKVCRR 900
    CDENCLSCAG SSRNCSRCKT GFTQLGTSCI TNHTCSNADE TFCEMVKSNR 950
    LCERKLFIQF CCRTCLLAG 969
    Length:969
    Mass (Da):106,420
    Last modified:December 1, 1992 - v1
    Checksum:iA3599CC278D09B05
    GO
    Isoform PACE4A-II (identifier: P29122-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         680-693: AQSTPGSANILQTS → G

    Show »
    Length:956
    Mass (Da):105,121
    Checksum:iBA240E3EEBCC862F
    GO
    Isoform PACE4B (identifier: P29122-3) [UniParc]FASTAAdd to Basket

    Also known as: PACE4.1

    The sequence of this isoform differs from the canonical sequence as follows:
         471-471: K → KGAAVAFWWTIGWPWNV
         472-969: Missing.

    Note: Probably enzymatically inactive.

    Show »
    Length:487
    Mass (Da):53,044
    Checksum:i10DB376359A7F1AF
    GO
    Isoform PACE4C (identifier: P29122-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         621-652: KLKEWSLILYGTAEHPYHTFSAHQSRSRMLEL → DLETPVANQLTTEEREPGLKHVFRWQIEQELW
         653-969: Missing.

    Note: Probably enzymatically inactive.

    Show »
    Length:652
    Mass (Da):71,771
    Checksum:i880D99278881942C
    GO
    Isoform PACE4CS (identifier: P29122-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         621-623: KLK → NLD
         624-969: Missing.

    Note: Probably enzymatically inactive.

    Show »
    Length:623
    Mass (Da):68,238
    Checksum:i19BCB5350278C621
    GO
    Isoform PACE4D (identifier: P29122-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-167: Missing.
         621-664: KLKEWSLILY...PELEPPKAAL → DLETPVANQL...YHIVLITVAL
         665-969: Missing.

    Note: Probably enzymatically inactive.

    Show »
    Length:497
    Mass (Da):54,900
    Checksum:i46C1F64CAEA0E3EB
    GO
    Isoform PACE4E-I (identifier: P29122-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

    Show »
    Length:975
    Mass (Da):106,674
    Checksum:i31983E526116A67C
    GO
    Isoform PACE4E-II (identifier: P29122-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         680-693: AQSTPGSANILQTS → G
         901-969: CDENCLSCAG...FCCRTCLLAG → YGPPGGERQA...AVGRHRAAAG

    Show »
    Length:962
    Mass (Da):105,375
    Checksum:iF16ABF9230DE5F01
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti639 – 6391T → I in BAA21624. (PubMed:9378725)Curated
    Sequence conflicti639 – 6391T → I in BAA21625. (PubMed:9378725)Curated
    Sequence conflicti639 – 6391T → I in BAA21626. (PubMed:9378725)Curated
    Sequence conflicti639 – 6391T → I in BAA21627. (PubMed:9378725)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti502 – 5021C → R.
    Corresponds to variant rs1058260 [ dbSNP | Ensembl ].
    VAR_051824

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 167167Missing in isoform PACE4D. 1 PublicationVSP_005427Add
    BLAST
    Alternative sequencei471 – 4711K → KGAAVAFWWTIGWPWNV in isoform PACE4B. 1 PublicationVSP_005428
    Alternative sequencei472 – 969498Missing in isoform PACE4B. 1 PublicationVSP_005429Add
    BLAST
    Alternative sequencei621 – 66444KLKEW…PKAAL → DLETPVANQLTTEERFVSTP SILFHWSVYLSWSQYHIVLI TVAL in isoform PACE4D. 1 PublicationVSP_005434Add
    BLAST
    Alternative sequencei621 – 65232KLKEW…RMLEL → DLETPVANQLTTEEREPGLK HVFRWQIEQELW in isoform PACE4C. 1 PublicationVSP_005432Add
    BLAST
    Alternative sequencei621 – 6233KLK → NLD in isoform PACE4CS. CuratedVSP_005430
    Alternative sequencei624 – 969346Missing in isoform PACE4CS. CuratedVSP_005431Add
    BLAST
    Alternative sequencei653 – 969317Missing in isoform PACE4C. 1 PublicationVSP_005433Add
    BLAST
    Alternative sequencei665 – 969305Missing in isoform PACE4D. 1 PublicationVSP_005435Add
    BLAST
    Alternative sequencei680 – 69314AQSTP…ILQTS → G in isoform PACE4A-II and isoform PACE4E-II. 1 PublicationVSP_005436Add
    BLAST
    Alternative sequencei901 – 96969CDENC…CLLAG → YGPPGGERQATVSSKGVPGG QSLSASSPGAGEGMLHHPTV DRSPFTELLRGLRPFVHWMH ICWVPAVGRHRAAAG in isoform PACE4E-I and isoform PACE4E-II. 1 PublicationVSP_005437Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M80482 mRNA. Translation: AAA59998.1.
    AB001914 Genomic DNA. Translation: BAA21620.1.
    AB001914 Genomic DNA. Translation: BAA21621.1.
    AB001914 Genomic DNA. Translation: BAA21622.1.
    AB001914 Genomic DNA. Translation: BAA21623.1.
    AB001914 Genomic DNA. Translation: BAA21624.1.
    AB001914 Genomic DNA. Translation: BAA21625.1.
    AB001914 Genomic DNA. Translation: BAA21626.1.
    AB001914 Genomic DNA. Translation: BAA21627.1.
    D28513 mRNA. Translation: BAA05871.1.
    D28514 mRNA. Translation: BAA05872.1.
    D87995 mRNA. Translation: BAA21793.1.
    D87993 mRNA. Translation: BAA21791.1.
    D87994 mRNA. Translation: BAA21792.1.
    PIRiA39490.
    B39490.
    JC2191.
    JC2192.
    JC5570.
    JC5571.
    RefSeqiNP_001278238.1. NM_001291309.1.
    NP_002561.1. NM_002570.4. [P29122-1]
    NP_612192.1. NM_138319.3. [P29122-2]
    NP_612195.1. NM_138322.3. [P29122-3]
    NP_612196.1. NM_138323.2. [P29122-5]
    NP_612197.1. NM_138324.2. [P29122-4]
    NP_612198.2. NM_138325.3.
    UniGeneiHs.498494.
    Hs.665989.

    Genome annotation databases

    EnsembliENST00000348070; ENSP00000305056; ENSG00000140479.
    GeneIDi5046.
    KEGGihsa:5046.
    UCSCiuc002bwy.3. human. [P29122-1]
    uc002bxa.2. human. [P29122-7]
    uc002bxb.2. human. [P29122-8]
    uc002bxc.1. human. [P29122-4]
    uc002bxd.1. human. [P29122-5]
    uc002bxg.1. human. [P29122-3]
    uc010bpe.3. human. [P29122-2]

    Polymorphism databases

    DMDMi129542.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M80482 mRNA. Translation: AAA59998.1 .
    AB001914 Genomic DNA. Translation: BAA21620.1 .
    AB001914 Genomic DNA. Translation: BAA21621.1 .
    AB001914 Genomic DNA. Translation: BAA21622.1 .
    AB001914 Genomic DNA. Translation: BAA21623.1 .
    AB001914 Genomic DNA. Translation: BAA21624.1 .
    AB001914 Genomic DNA. Translation: BAA21625.1 .
    AB001914 Genomic DNA. Translation: BAA21626.1 .
    AB001914 Genomic DNA. Translation: BAA21627.1 .
    D28513 mRNA. Translation: BAA05871.1 .
    D28514 mRNA. Translation: BAA05872.1 .
    D87995 mRNA. Translation: BAA21793.1 .
    D87993 mRNA. Translation: BAA21791.1 .
    D87994 mRNA. Translation: BAA21792.1 .
    PIRi A39490.
    B39490.
    JC2191.
    JC2192.
    JC5570.
    JC5571.
    RefSeqi NP_001278238.1. NM_001291309.1.
    NP_002561.1. NM_002570.4. [P29122-1 ]
    NP_612192.1. NM_138319.3. [P29122-2 ]
    NP_612195.1. NM_138322.3. [P29122-3 ]
    NP_612196.1. NM_138323.2. [P29122-5 ]
    NP_612197.1. NM_138324.2. [P29122-4 ]
    NP_612198.2. NM_138325.3.
    UniGenei Hs.498494.
    Hs.665989.

    3D structure databases

    ProteinModelPortali P29122.
    SMRi P29122. Positions 70-141, 162-633, 690-939.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111083. 3 interactions.
    DIPi DIP-29903N.
    IntActi P29122. 4 interactions.
    MINTi MINT-3011239.

    Chemistry

    BindingDBi P29122.
    ChEMBLi CHEMBL2951.

    Protein family/group databases

    MEROPSi S08.075.

    PTM databases

    PhosphoSitei P29122.

    Polymorphism databases

    DMDMi 129542.

    Proteomic databases

    MaxQBi P29122.
    PaxDbi P29122.
    PRIDEi P29122.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000348070 ; ENSP00000305056 ; ENSG00000140479 .
    GeneIDi 5046.
    KEGGi hsa:5046.
    UCSCi uc002bwy.3. human. [P29122-1 ]
    uc002bxa.2. human. [P29122-7 ]
    uc002bxb.2. human. [P29122-8 ]
    uc002bxc.1. human. [P29122-4 ]
    uc002bxd.1. human. [P29122-5 ]
    uc002bxg.1. human. [P29122-3 ]
    uc010bpe.3. human. [P29122-2 ]

    Organism-specific databases

    CTDi 5046.
    GeneCardsi GC15M101844.
    HGNCi HGNC:8569. PCSK6.
    HPAi HPA004774.
    MIMi 167405. gene.
    neXtProti NX_P29122.
    PharmGKBi PA32895.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4935.
    HOVERGENi HBG008705.
    InParanoidi P29122.
    KOi K08672.
    PhylomeDBi P29122.
    TreeFami TF314277.

    Enzyme and pathway databases

    Reactomei REACT_11062. NGF processing.
    REACT_111057. Signaling by NODAL.
    SignaLinki P29122.

    Miscellaneous databases

    GeneWikii PCSK6.
    GenomeRNAii 5046.
    NextBioi 19426.
    PROi P29122.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P29122.
    Bgeei P29122.
    Genevestigatori P29122.

    Family and domain databases

    Gene3Di 2.60.120.260. 1 hit.
    3.40.50.200. 1 hit.
    InterProi IPR006212. Furin_repeat.
    IPR008979. Galactose-bd-like.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000209. Peptidase_S8/S53_dom.
    IPR023827. Peptidase_S8_Asp-AS.
    IPR022398. Peptidase_S8_His-AS.
    IPR023828. Peptidase_S8_Ser-AS.
    IPR015500. Peptidase_S8_subtilisin-rel.
    IPR010909. PLAC.
    IPR009020. Prot_inh_propept.
    IPR002884. PrprotnconvertsP.
    [Graphical view ]
    PANTHERi PTHR10795. PTHR10795. 1 hit.
    Pfami PF01483. P_proprotein. 1 hit.
    PF00082. Peptidase_S8. 1 hit.
    PF08686. PLAC. 1 hit.
    [Graphical view ]
    PRINTSi PR00723. SUBTILISIN.
    SMARTi SM00261. FU. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49785. SSF49785. 1 hit.
    SSF52743. SSF52743. 1 hit.
    SSF54897. SSF54897. 1 hit.
    SSF57184. SSF57184. 2 hits.
    PROSITEi PS50900. PLAC. 1 hit.
    PS00136. SUBTILASE_ASP. 1 hit.
    PS00137. SUBTILASE_HIS. 1 hit.
    PS00138. SUBTILASE_SER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a second human subtilisin-like protease gene in the fes/fps region of chromosome 15."
      Kiefer M.C., Tucker J.E., Joh R., Landsberg K.E., Saltman D., Barr P.J.
      DNA Cell Biol. 10:757-769(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4A-I AND PACE4B).
      Tissue: Hepatoma and Kidney.
    2. "Identification of novel cDNAs encoding human kexin-like protease, PACE4 isoforms."
      Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H., Matsuda Y.
      Biochem. Biophys. Res. Commun. 200:943-950(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4C AND PACE4D).
      Tissue: Placenta.
    3. "Identification of a novel PACE4 isoform, PACE4E."
      Mori K., Imamaki A., Kii S., Nagamune H., Nagahama M., Tsuji A., Matsuda Y.
      Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM PACE4A-II).
      Tissue: Placenta.
    4. "A novel human PACE4 isoform, PACE4E is an active processing protease containing a hydrophobic cluster at the carboxy terminus."
      Mori K., Kii S., Tsuji A., Nagahama M., Imamaki A., Hayashi K., Akamatsu T., Nagamune H., Matsuda Y.
      J. Biochem. 121:941-948(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4E-I AND PACE4E-II).
      Tissue: Cerebellum.
    5. "Genomic organization and alternative splicing of human PACE4 (SPC4), kexin-like processing endoprotease."
      Tsuji A., Hine C., Tamai Y., Yonemoto K., Mori K., Yoshida S., Bando M., Sakai E., Mori K., Akamatsu T., Matsuda Y.
      J. Biochem. 122:438-452(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS PACE4A-I; PACE4A-II; PACE4CS; PACE4D; PACE4E-I AND PACE4E-II).
    6. "Functional analysis of human PACE4-A and PACE4-C isoforms: identification of a new PACE4-CS isoform."
      Zhong M., Benjannet S., Lazure C., Munzer S., Seidah N.G.
      FEBS Lett. 396:31-36(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORM PACE4CS).
    7. "Endoprotease PACE4 is Ca2+-dependent and temperature-sensitive and can partly rescue the phenotype of a furin-deficient cell strain."
      Sucic J.F., Moehring J.M., Inocencio N.M., Luchini J.W., Moehring T.J.
      Biochem. J. 339:639-647(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. "Biosynthetic processing and quaternary interactions of proprotein convertase SPC4 (PACE4)."
      Nagahama M., Taniguchi T., Hashimoto E., Imamaki A., Mori K., Tsuji A., Matsuda Y.
      FEBS Lett. 434:155-159(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEOLYTIC PROCESSING.

    Entry informationi

    Entry nameiPCSK6_HUMAN
    AccessioniPrimary (citable) accession number: P29122
    Secondary accession number(s): Q15099
    , Q15100, Q9UEG7, Q9UEJ1, Q9UEJ2, Q9UEJ7, Q9UEJ8, Q9UEJ9, Q9Y4G9, Q9Y4H0, Q9Y4H1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 1992
    Last sequence update: December 1, 1992
    Last modified: October 1, 2014
    This is version 152 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Peptidase families
      Classification of peptidase families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3