SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P29121

- PCSK4_MOUSE

UniProt

P29121 - PCSK4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Proprotein convertase subtilisin/kexin type 4

Gene
Pcsk4, Nec-3, Nec3
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei155 – 1551Charge relay system By similarity
Active sitei196 – 1961Charge relay system By similarity
Active sitei370 – 3701Charge relay system By similarity

GO - Molecular functioni

  1. serine-type endopeptidase activity Source: RefGenome

GO - Biological processi

  1. acrosome reaction Source: MGI
  2. binding of sperm to zona pellucida Source: MGI
  3. fertilization Source: MGI
  4. proteolysis Source: RefGenome
  5. sperm capacitation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

ReactomeiREACT_206713. NGF processing.

Protein family/group databases

MEROPSiS08.074.

Names & Taxonomyi

Protein namesi
Recommended name:
Proprotein convertase subtilisin/kexin type 4 (EC:3.4.21.-)
Alternative name(s):
KEX2-like endoprotease 3
Neuroendocrine convertase 3
Short name:
NEC 3
Prohormone convertase 3
Gene namesi
Name:Pcsk4
Synonyms:Nec-3, Nec3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 10

Organism-specific databases

MGIiMGI:97514. Pcsk4.

Subcellular locationi

GO - Cellular componenti

  1. acrosomal membrane Source: MGI
  2. endoplasmic reticulum lumen Source: Reactome
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626 By similarityAdd
BLAST
Propeptidei27 – 11084 Reviewed predictionPRO_0000027098Add
BLAST
Chaini111 – 655545Proprotein convertase subtilisin/kexin type 4PRO_0000027099Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi472 – 4721N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Zymogen

Proteomic databases

PRIDEiP29121.

PTM databases

PhosphoSiteiP29121.

Expressioni

Tissue specificityi

Expressed abundantly in the testis.1 Publication

Developmental stagei

Detected only after the 20th day of postnatal development. Mainly expressed in the round spermatids. Expressed mainly in the early stages of spermiogenesis.1 Publication

Gene expression databases

BgeeiP29121.
CleanExiMM_PCSK4.
GenevestigatoriP29121.

Interactioni

Protein-protein interaction databases

BioGridi202060. 1 interaction.
STRINGi10090.ENSMUSP00000020340.

Structurei

3D structure databases

ProteinModelPortaliP29121.
SMRiP29121. Positions 33-107, 115-580.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni121 – 414294CatalyticAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG4935.
GeneTreeiENSGT00750000117358.
HOGENOMiHOG000192536.
HOVERGENiHBG008705.
InParanoidiP29121.
KOiK08671.
OMAiHVQVQLS.
OrthoDBiEOG7BW0JD.
PhylomeDBiP29121.
TreeFamiTF314277.

Family and domain databases

Gene3Di2.60.120.260. 1 hit.
3.40.50.200. 1 hit.
InterProiIPR008979. Galactose-bd-like.
IPR000209. Peptidase_S8/S53_dom.
IPR023827. Peptidase_S8_Asp-AS.
IPR022398. Peptidase_S8_His-AS.
IPR023828. Peptidase_S8_Ser-AS.
IPR015500. Peptidase_S8_subtilisin-rel.
IPR009020. Prot_inh_propept.
IPR002884. PrprotnconvertsP.
[Graphical view]
PANTHERiPTHR10795. PTHR10795. 1 hit.
PfamiPF01483. P_proprotein. 1 hit.
PF00082. Peptidase_S8. 1 hit.
[Graphical view]
PRINTSiPR00723. SUBTILISIN.
SUPFAMiSSF49785. SSF49785. 1 hit.
SSF52743. SSF52743. 1 hit.
SSF54897. SSF54897. 1 hit.
PROSITEiPS00136. SUBTILASE_ASP. 1 hit.
PS00137. SUBTILASE_HIS. 1 hit.
PS00138. SUBTILASE_SER. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P29121-1) [UniParc]FASTAAdd to Basket

Also known as: mPC4-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRPSQTELWL GLTLTLALLA VRWASAQAPI YVSSWAVRVT KGYQEAERLA    50
RKFGFVNLGQ IFPDDQYFHL RHRGVAQQSL TPHWGHRLRL KKDPKVRWFE 100
QQTLRRRVKR SLVVPTDPWF SKQWYMNKEI QQDLNILKAW NQGLTGRGVV 150
ISILDDGIEK DHPDLWANYD PLASYDFNDY DPDPQPRYTP NDENRHGTRC 200
AGEVSATANN GFCGAGVAFN ARIGGVRMLD GAITDIVEAQ SLSLQPQHIH 250
IYSASWGPED DGRTVDGPGL LTQEAFRRGV TKGRQGLGTL FIWASGNGGL 300
HYDNCNCDGY TNSIHTLSVG STTRQGRVPW YSEACASTFT TTFSSGVVTD 350
PQIVTTDLHH QCTDKHTGTS ASAPLAAGMI ALALEANPLL TWRDLQHLVV 400
RASRPAQLQA EDWRINGVGR QVSHHYGYGL LDAGLLVDLA RVWLPTKPQK 450
KCAIRVVHTP TPILPRMLVP KNVTACSDGS RRRLIRSLEH VQVQLSLSYS 500
RRGDLEIFLT SPMGTRSTLV AIRPLDISGQ GYNNWIFMST HYWDEDPQGL 550
WTLGLENKGY YFNTGTLYYY TLLLYGTAED MTARPQAPQV TSRARACVQR 600
DTEGLCQESH SPLSILAGLC LISSQQWWWL YSHPQQPVTE GQASCHPPVT 650
PAAAA 655
Length:655
Mass (Da):73,214
Last modified:December 1, 1992 - v1
Checksum:i4E4E32CEDECBCB59
GO
Isoform 2 (identifier: P29121-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-282: Missing.

Show »
Length:645
Mass (Da):72,040
Checksum:iF640E51A4B932CCC
GO
Isoform 3 (identifier: P29121-3) [UniParc]FASTAAdd to Basket

Also known as: mPC4-B

The sequence of this isoform differs from the canonical sequence as follows:
     590-655: VTSRARACVQ...HPPVTPAAAA → KVTVPSPSWQDSASSPASSGGGSTATHSSQ

Show »
Length:619
Mass (Da):68,946
Checksum:iBFFA404AC3B0309C
GO
Isoform 4 (identifier: P29121-4) [UniParc]FASTAAdd to Basket

Also known as: mPC4-C

The sequence of this isoform differs from the canonical sequence as follows:
     590-655: VTSRARACVQ...HPPVTPAAAA → DSASSPASSGGGSTATHSSQ

Show »
Length:609
Mass (Da):67,835
Checksum:iE6836850549C8B4B
GO
Isoform 5 (identifier: P29121-5) [UniParc]FASTAAdd to Basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     22-60: Missing.

Show »
Length:616
Mass (Da):68,790
Checksum:iE6C5935CDB59CED5
GO
Isoform 6 (identifier: P29121-6) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     51-60: Missing.

Show »
Length:645
Mass (Da):72,066
Checksum:i98D75378E95BB1E7
GO
Isoform 7 (identifier: P29121-7) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     590-608: Missing.

Show »
Length:636
Mass (Da):71,109
Checksum:i9CAE7A7D05A0848E
GO
Isoform 8 (identifier: P29121-8) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     590-617: Missing.

Show »
Length:627
Mass (Da):70,203
Checksum:iF990EE7C2FF4EC95
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei22 – 6039Missing in isoform 5. VSP_011266Add
BLAST
Alternative sequencei51 – 6010Missing in isoform 6. VSP_011267
Alternative sequencei273 – 28210Missing in isoform 2. VSP_011268
Alternative sequencei590 – 65566VTSRA…PAAAA → KVTVPSPSWQDSASSPASSG GGSTATHSSQ in isoform 3. VSP_011271Add
BLAST
Alternative sequencei590 – 65566VTSRA…PAAAA → DSASSPASSGGGSTATHSSQ in isoform 4. VSP_011272Add
BLAST
Alternative sequencei590 – 61728Missing in isoform 8. VSP_011270Add
BLAST
Alternative sequencei590 – 60819Missing in isoform 7. VSP_011269Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti65 – 651D → N in AAA39973. 1 Publication
Sequence conflicti87 – 871R → P in AAA39973. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D01093 mRNA. Translation: BAA00877.1.
L21221
, L21210, L21211, L21212, L21213, L21214, L21215, L21216, L21217, L21218, L21219, L21220, L21222, L21223 Genomic DNA. Translation: AAA39973.1.
CCDSiCCDS24018.1. [P29121-1]
PIRiA54306.
RefSeqiNP_032819.1. NM_008793.2. [P29121-1]
UniGeneiMm.299916.

Genome annotation databases

EnsembliENSMUST00000020340; ENSMUSP00000020340; ENSMUSG00000020131. [P29121-1]
GeneIDi18551.
KEGGimmu:18551.
UCSCiuc007gcs.2. mouse. [P29121-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D01093 mRNA. Translation: BAA00877.1 .
L21221
, L21210 , L21211 , L21212 , L21213 , L21214 , L21215 , L21216 , L21217 , L21218 , L21219 , L21220 , L21222 , L21223 Genomic DNA. Translation: AAA39973.1 .
CCDSi CCDS24018.1. [P29121-1 ]
PIRi A54306.
RefSeqi NP_032819.1. NM_008793.2. [P29121-1 ]
UniGenei Mm.299916.

3D structure databases

ProteinModelPortali P29121.
SMRi P29121. Positions 33-107, 115-580.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202060. 1 interaction.
STRINGi 10090.ENSMUSP00000020340.

Protein family/group databases

MEROPSi S08.074.

PTM databases

PhosphoSitei P29121.

Proteomic databases

PRIDEi P29121.

Protocols and materials databases

DNASUi 18551.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000020340 ; ENSMUSP00000020340 ; ENSMUSG00000020131 . [P29121-1 ]
GeneIDi 18551.
KEGGi mmu:18551.
UCSCi uc007gcs.2. mouse. [P29121-1 ]

Organism-specific databases

CTDi 54760.
MGIi MGI:97514. Pcsk4.

Phylogenomic databases

eggNOGi COG4935.
GeneTreei ENSGT00750000117358.
HOGENOMi HOG000192536.
HOVERGENi HBG008705.
InParanoidi P29121.
KOi K08671.
OMAi HVQVQLS.
OrthoDBi EOG7BW0JD.
PhylomeDBi P29121.
TreeFami TF314277.

Enzyme and pathway databases

Reactomei REACT_206713. NGF processing.

Miscellaneous databases

NextBioi 294352.
PROi P29121.
SOURCEi Search...

Gene expression databases

Bgeei P29121.
CleanExi MM_PCSK4.
Genevestigatori P29121.

Family and domain databases

Gene3Di 2.60.120.260. 1 hit.
3.40.50.200. 1 hit.
InterProi IPR008979. Galactose-bd-like.
IPR000209. Peptidase_S8/S53_dom.
IPR023827. Peptidase_S8_Asp-AS.
IPR022398. Peptidase_S8_His-AS.
IPR023828. Peptidase_S8_Ser-AS.
IPR015500. Peptidase_S8_subtilisin-rel.
IPR009020. Prot_inh_propept.
IPR002884. PrprotnconvertsP.
[Graphical view ]
PANTHERi PTHR10795. PTHR10795. 1 hit.
Pfami PF01483. P_proprotein. 1 hit.
PF00082. Peptidase_S8. 1 hit.
[Graphical view ]
PRINTSi PR00723. SUBTILISIN.
SUPFAMi SSF49785. SSF49785. 1 hit.
SSF52743. SSF52743. 1 hit.
SSF54897. SSF54897. 1 hit.
PROSITEi PS00136. SUBTILASE_ASP. 1 hit.
PS00137. SUBTILASE_HIS. 1 hit.
PS00138. SUBTILASE_SER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Identification of the fourth member of the mammalian endoprotease family homologous to the yeast Kex2 protease. Its testis-specific expression."
    Nakayama K., Kim W.-S., Torii S., Hosaka M., Nakagawa T., Ikemizu J., Baba T., Murakami K.
    J. Biol. Chem. 267:5897-5900(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Testis.
  2. "Testicular expression of PC4 in the rat: molecular diversity of a novel germ cell-specific Kex2/subtilisin-like proprotein convertase."
    Seidah N.G., Day R., Hamelin J., Gaspar A., Collard M.W., Chretien M.
    Mol. Endocrinol. 6:1559-1570(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Testis.
  3. "Structure of the gene for the testis-specific proprotein convertase 4 and of its alternate messenger RNA isoforms."
    Mbikay M., Raffin-Sanson M.-L., Tadros H., Sirois F., Seidah N.G., Chretien M.
    Genomics 20:231-237(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 5; 6; 7 AND 8).
    Strain: C57BL/6.
    Tissue: Liver.

Entry informationi

Entry nameiPCSK4_MOUSE
AccessioniPrimary (citable) accession number: P29121
Secondary accession number(s): Q62094
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: December 1, 1992
Last modified: September 3, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi