Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P29121 (PCSK4_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Proprotein convertase subtilisin/kexin type 4

EC=3.4.21.-
Alternative name(s):
KEX2-like endoprotease 3
Neuroendocrine convertase 3
Short name=NEC 3
Prohormone convertase 3
Gene names
Name:Pcsk4
Synonyms:Nec-3, Nec3
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length655 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues.

Tissue specificity

Expressed abundantly in the testis. Ref.1

Developmental stage

Detected only after the 20th day of postnatal development. Mainly expressed in the round spermatids. Expressed mainly in the early stages of spermiogenesis. Ref.1

Sequence similarities

Belongs to the peptidase S8 family. Furin subfamily.

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P29121-1)

Also known as: mPC4-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P29121-2)

The sequence of this isoform differs from the canonical sequence as follows:
     273-282: Missing.
Isoform 3 (identifier: P29121-3)

Also known as: mPC4-B;

The sequence of this isoform differs from the canonical sequence as follows:
     590-655: VTSRARACVQ...HPPVTPAAAA → KVTVPSPSWQDSASSPASSGGGSTATHSSQ
Isoform 4 (identifier: P29121-4)

Also known as: mPC4-C;

The sequence of this isoform differs from the canonical sequence as follows:
     590-655: VTSRARACVQ...HPPVTPAAAA → DSASSPASSGGGSTATHSSQ
Isoform 5 (identifier: P29121-5)

Also known as: E;

The sequence of this isoform differs from the canonical sequence as follows:
     22-60: Missing.
Isoform 6 (identifier: P29121-6)

Also known as: D;

The sequence of this isoform differs from the canonical sequence as follows:
     51-60: Missing.
Isoform 7 (identifier: P29121-7)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     590-608: Missing.
Isoform 8 (identifier: P29121-8)

Also known as: C;

The sequence of this isoform differs from the canonical sequence as follows:
     590-617: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2626 By similarity
Propeptide27 – 11084 Potential
PRO_0000027098
Chain111 – 655545Proprotein convertase subtilisin/kexin type 4
PRO_0000027099

Regions

Region121 – 414294Catalytic

Sites

Active site1551Charge relay system By similarity
Active site1961Charge relay system By similarity
Active site3701Charge relay system By similarity

Amino acid modifications

Glycosylation4721N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence22 – 6039Missing in isoform 5.
VSP_011266
Alternative sequence51 – 6010Missing in isoform 6.
VSP_011267
Alternative sequence273 – 28210Missing in isoform 2.
VSP_011268
Alternative sequence590 – 65566VTSRA…PAAAA → KVTVPSPSWQDSASSPASSG GGSTATHSSQ in isoform 3.
VSP_011271
Alternative sequence590 – 65566VTSRA…PAAAA → DSASSPASSGGGSTATHSSQ in isoform 4.
VSP_011272
Alternative sequence590 – 61728Missing in isoform 8.
VSP_011270
Alternative sequence590 – 60819Missing in isoform 7.
VSP_011269

Experimental info

Sequence conflict651D → N in AAA39973. Ref.3
Sequence conflict871R → P in AAA39973. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (mPC4-A) [UniParc].

Last modified December 1, 1992. Version 1.
Checksum: 4E4E32CEDECBCB59

FASTA65573,214
        10         20         30         40         50         60 
MRPSQTELWL GLTLTLALLA VRWASAQAPI YVSSWAVRVT KGYQEAERLA RKFGFVNLGQ 

        70         80         90        100        110        120 
IFPDDQYFHL RHRGVAQQSL TPHWGHRLRL KKDPKVRWFE QQTLRRRVKR SLVVPTDPWF 

       130        140        150        160        170        180 
SKQWYMNKEI QQDLNILKAW NQGLTGRGVV ISILDDGIEK DHPDLWANYD PLASYDFNDY 

       190        200        210        220        230        240 
DPDPQPRYTP NDENRHGTRC AGEVSATANN GFCGAGVAFN ARIGGVRMLD GAITDIVEAQ 

       250        260        270        280        290        300 
SLSLQPQHIH IYSASWGPED DGRTVDGPGL LTQEAFRRGV TKGRQGLGTL FIWASGNGGL 

       310        320        330        340        350        360 
HYDNCNCDGY TNSIHTLSVG STTRQGRVPW YSEACASTFT TTFSSGVVTD PQIVTTDLHH 

       370        380        390        400        410        420 
QCTDKHTGTS ASAPLAAGMI ALALEANPLL TWRDLQHLVV RASRPAQLQA EDWRINGVGR 

       430        440        450        460        470        480 
QVSHHYGYGL LDAGLLVDLA RVWLPTKPQK KCAIRVVHTP TPILPRMLVP KNVTACSDGS 

       490        500        510        520        530        540 
RRRLIRSLEH VQVQLSLSYS RRGDLEIFLT SPMGTRSTLV AIRPLDISGQ GYNNWIFMST 

       550        560        570        580        590        600 
HYWDEDPQGL WTLGLENKGY YFNTGTLYYY TLLLYGTAED MTARPQAPQV TSRARACVQR 

       610        620        630        640        650 
DTEGLCQESH SPLSILAGLC LISSQQWWWL YSHPQQPVTE GQASCHPPVT PAAAA 

« Hide

Isoform 2 [UniParc].

Checksum: F640E51A4B932CCC
Show »

FASTA64572,040
Isoform 3 (mPC4-B) [UniParc].

Checksum: BFFA404AC3B0309C
Show »

FASTA61968,946
Isoform 4 (mPC4-C) [UniParc].

Checksum: E6836850549C8B4B
Show »

FASTA60967,835
Isoform 5 (E) [UniParc].

Checksum: E6C5935CDB59CED5
Show »

FASTA61668,790
Isoform 6 (D) [UniParc].

Checksum: 98D75378E95BB1E7
Show »

FASTA64572,066
Isoform 7 (B) [UniParc].

Checksum: 9CAE7A7D05A0848E
Show »

FASTA63671,109
Isoform 8 (C) [UniParc].

Checksum: F990EE7C2FF4EC95
Show »

FASTA62770,203

References

[1]"Identification of the fourth member of the mammalian endoprotease family homologous to the yeast Kex2 protease. Its testis-specific expression."
Nakayama K., Kim W.-S., Torii S., Hosaka M., Nakagawa T., Ikemizu J., Baba T., Murakami K.
J. Biol. Chem. 267:5897-5900(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Tissue: Testis.
[2]"Testicular expression of PC4 in the rat: molecular diversity of a novel germ cell-specific Kex2/subtilisin-like proprotein convertase."
Seidah N.G., Day R., Hamelin J., Gaspar A., Collard M.W., Chretien M.
Mol. Endocrinol. 6:1559-1570(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: Testis.
[3]"Structure of the gene for the testis-specific proprotein convertase 4 and of its alternate messenger RNA isoforms."
Mbikay M., Raffin-Sanson M.-L., Tadros H., Sirois F., Seidah N.G., Chretien M.
Genomics 20:231-237(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 5; 6; 7 AND 8).
Strain: C57BL/6.
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D01093 mRNA. Translation: BAA00877.1.
L21221 expand/collapse EMBL AC list , L21210, L21211, L21212, L21213, L21214, L21215, L21216, L21217, L21218, L21219, L21220, L21222, L21223 Genomic DNA. Translation: AAA39973.1.
PIRA54306.
RefSeqNP_032819.1. NM_008793.2.
UniGeneMm.299916.

3D structure databases

ProteinModelPortalP29121.
SMRP29121. Positions 31-103, 115-580.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid202060. 1 interaction.
STRING10090.ENSMUSP00000020340.

Protein family/group databases

MEROPSS08.074.

PTM databases

PhosphoSiteP29121.

Proteomic databases

PRIDEP29121.

Protocols and materials databases

DNASU18551.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000020340; ENSMUSP00000020340; ENSMUSG00000020131. [P29121-1]
GeneID18551.
KEGGmmu:18551.
UCSCuc007gcs.2. mouse. [P29121-1]

Organism-specific databases

CTD54760.
MGIMGI:97514. Pcsk4.

Phylogenomic databases

eggNOGCOG4935.
GeneTreeENSGT00750000117358.
HOGENOMHOG000192536.
HOVERGENHBG008705.
InParanoidP29121.
KOK08671.
OMAHVQVQLS.
OrthoDBEOG7BW0JD.
PhylomeDBP29121.
TreeFamTF314277.

Enzyme and pathway databases

ReactomeREACT_188257. Signal Transduction.

Gene expression databases

BgeeP29121.
CleanExMM_PCSK4.
GenevestigatorP29121.

Family and domain databases

Gene3D2.60.120.260. 1 hit.
3.40.50.200. 1 hit.
InterProIPR008979. Galactose-bd-like.
IPR000209. Peptidase_S8/S53_dom.
IPR023827. Peptidase_S8_Asp-AS.
IPR022398. Peptidase_S8_His-AS.
IPR023828. Peptidase_S8_Ser-AS.
IPR015500. Peptidase_S8_subtilisin-rel.
IPR009020. Prot_inh_propept.
IPR002884. PrprotnconvertsP.
[Graphical view]
PANTHERPTHR10795. PTHR10795. 1 hit.
PfamPF01483. P_proprotein. 1 hit.
PF00082. Peptidase_S8. 1 hit.
[Graphical view]
PRINTSPR00723. SUBTILISIN.
SUPFAMSSF49785. SSF49785. 1 hit.
SSF52743. SSF52743. 1 hit.
SSF54897. SSF54897. 1 hit.
PROSITEPS00136. SUBTILASE_ASP. 1 hit.
PS00137. SUBTILASE_HIS. 1 hit.
PS00138. SUBTILASE_SER. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio294352.
PROP29121.
SOURCESearch...

Entry information

Entry namePCSK4_MOUSE
AccessionPrimary (citable) accession number: P29121
Secondary accession number(s): Q62094
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: December 1, 1992
Last modified: April 16, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot