Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P29121

- PCSK4_MOUSE

UniProt

P29121 - PCSK4_MOUSE

Protein

Proprotein convertase subtilisin/kexin type 4

Gene

Pcsk4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 1 (01 Dec 1992)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei155 – 1551Charge relay systemBy similarity
    Active sitei196 – 1961Charge relay systemBy similarity
    Active sitei370 – 3701Charge relay systemBy similarity

    GO - Molecular functioni

    1. serine-type endopeptidase activity Source: RefGenome

    GO - Biological processi

    1. acrosome reaction Source: MGI
    2. binding of sperm to zona pellucida Source: MGI
    3. fertilization Source: MGI
    4. proteolysis Source: RefGenome
    5. sperm capacitation Source: MGI

    Keywords - Molecular functioni

    Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    ReactomeiREACT_206713. NGF processing.

    Protein family/group databases

    MEROPSiS08.074.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Proprotein convertase subtilisin/kexin type 4 (EC:3.4.21.-)
    Alternative name(s):
    KEX2-like endoprotease 3
    Neuroendocrine convertase 3
    Short name:
    NEC 3
    Prohormone convertase 3
    Gene namesi
    Name:Pcsk4
    Synonyms:Nec-3, Nec3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 10

    Organism-specific databases

    MGIiMGI:97514. Pcsk4.

    Subcellular locationi

    GO - Cellular componenti

    1. acrosomal membrane Source: MGI
    2. endoplasmic reticulum lumen Source: Reactome

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2626By similarityAdd
    BLAST
    Propeptidei27 – 11084Sequence AnalysisPRO_0000027098Add
    BLAST
    Chaini111 – 655545Proprotein convertase subtilisin/kexin type 4PRO_0000027099Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi472 – 4721N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Cleavage on pair of basic residues, Glycoprotein, Zymogen

    Proteomic databases

    PRIDEiP29121.

    PTM databases

    PhosphoSiteiP29121.

    Expressioni

    Tissue specificityi

    Expressed abundantly in the testis.1 Publication

    Developmental stagei

    Detected only after the 20th day of postnatal development. Mainly expressed in the round spermatids. Expressed mainly in the early stages of spermiogenesis.1 Publication

    Gene expression databases

    BgeeiP29121.
    CleanExiMM_PCSK4.
    GenevestigatoriP29121.

    Interactioni

    Protein-protein interaction databases

    BioGridi202060. 1 interaction.
    STRINGi10090.ENSMUSP00000020340.

    Structurei

    3D structure databases

    ProteinModelPortaliP29121.
    SMRiP29121. Positions 33-107, 115-580.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini150 – 436287Peptidase S8Add
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase S8 family. Furin subfamily.Curated
    Contains 1 peptidase S8 domain.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG4935.
    GeneTreeiENSGT00750000117358.
    HOGENOMiHOG000192536.
    HOVERGENiHBG008705.
    InParanoidiP29121.
    KOiK08671.
    OMAiHVQVQLS.
    OrthoDBiEOG7BW0JD.
    PhylomeDBiP29121.
    TreeFamiTF314277.

    Family and domain databases

    Gene3Di2.60.120.260. 1 hit.
    3.40.50.200. 1 hit.
    InterProiIPR008979. Galactose-bd-like.
    IPR000209. Peptidase_S8/S53_dom.
    IPR023827. Peptidase_S8_Asp-AS.
    IPR022398. Peptidase_S8_His-AS.
    IPR023828. Peptidase_S8_Ser-AS.
    IPR015500. Peptidase_S8_subtilisin-rel.
    IPR009020. Prot_inh_propept.
    IPR002884. PrprotnconvertsP.
    [Graphical view]
    PANTHERiPTHR10795. PTHR10795. 1 hit.
    PfamiPF01483. P_proprotein. 1 hit.
    PF00082. Peptidase_S8. 1 hit.
    [Graphical view]
    PRINTSiPR00723. SUBTILISIN.
    SUPFAMiSSF49785. SSF49785. 1 hit.
    SSF52743. SSF52743. 1 hit.
    SSF54897. SSF54897. 1 hit.
    PROSITEiPS00136. SUBTILASE_ASP. 1 hit.
    PS00137. SUBTILASE_HIS. 1 hit.
    PS00138. SUBTILASE_SER. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P29121-1) [UniParc]FASTAAdd to Basket

    Also known as: mPC4-A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRPSQTELWL GLTLTLALLA VRWASAQAPI YVSSWAVRVT KGYQEAERLA    50
    RKFGFVNLGQ IFPDDQYFHL RHRGVAQQSL TPHWGHRLRL KKDPKVRWFE 100
    QQTLRRRVKR SLVVPTDPWF SKQWYMNKEI QQDLNILKAW NQGLTGRGVV 150
    ISILDDGIEK DHPDLWANYD PLASYDFNDY DPDPQPRYTP NDENRHGTRC 200
    AGEVSATANN GFCGAGVAFN ARIGGVRMLD GAITDIVEAQ SLSLQPQHIH 250
    IYSASWGPED DGRTVDGPGL LTQEAFRRGV TKGRQGLGTL FIWASGNGGL 300
    HYDNCNCDGY TNSIHTLSVG STTRQGRVPW YSEACASTFT TTFSSGVVTD 350
    PQIVTTDLHH QCTDKHTGTS ASAPLAAGMI ALALEANPLL TWRDLQHLVV 400
    RASRPAQLQA EDWRINGVGR QVSHHYGYGL LDAGLLVDLA RVWLPTKPQK 450
    KCAIRVVHTP TPILPRMLVP KNVTACSDGS RRRLIRSLEH VQVQLSLSYS 500
    RRGDLEIFLT SPMGTRSTLV AIRPLDISGQ GYNNWIFMST HYWDEDPQGL 550
    WTLGLENKGY YFNTGTLYYY TLLLYGTAED MTARPQAPQV TSRARACVQR 600
    DTEGLCQESH SPLSILAGLC LISSQQWWWL YSHPQQPVTE GQASCHPPVT 650
    PAAAA 655
    Length:655
    Mass (Da):73,214
    Last modified:December 1, 1992 - v1
    Checksum:i4E4E32CEDECBCB59
    GO
    Isoform 2 (identifier: P29121-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         273-282: Missing.

    Show »
    Length:645
    Mass (Da):72,040
    Checksum:iF640E51A4B932CCC
    GO
    Isoform 3 (identifier: P29121-3) [UniParc]FASTAAdd to Basket

    Also known as: mPC4-B

    The sequence of this isoform differs from the canonical sequence as follows:
         590-655: VTSRARACVQ...HPPVTPAAAA → KVTVPSPSWQDSASSPASSGGGSTATHSSQ

    Show »
    Length:619
    Mass (Da):68,946
    Checksum:iBFFA404AC3B0309C
    GO
    Isoform 4 (identifier: P29121-4) [UniParc]FASTAAdd to Basket

    Also known as: mPC4-C

    The sequence of this isoform differs from the canonical sequence as follows:
         590-655: VTSRARACVQ...HPPVTPAAAA → DSASSPASSGGGSTATHSSQ

    Show »
    Length:609
    Mass (Da):67,835
    Checksum:iE6836850549C8B4B
    GO
    Isoform 5 (identifier: P29121-5) [UniParc]FASTAAdd to Basket

    Also known as: E

    The sequence of this isoform differs from the canonical sequence as follows:
         22-60: Missing.

    Show »
    Length:616
    Mass (Da):68,790
    Checksum:iE6C5935CDB59CED5
    GO
    Isoform 6 (identifier: P29121-6) [UniParc]FASTAAdd to Basket

    Also known as: D

    The sequence of this isoform differs from the canonical sequence as follows:
         51-60: Missing.

    Show »
    Length:645
    Mass (Da):72,066
    Checksum:i98D75378E95BB1E7
    GO
    Isoform 7 (identifier: P29121-7) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         590-608: Missing.

    Show »
    Length:636
    Mass (Da):71,109
    Checksum:i9CAE7A7D05A0848E
    GO
    Isoform 8 (identifier: P29121-8) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         590-617: Missing.

    Show »
    Length:627
    Mass (Da):70,203
    Checksum:iF990EE7C2FF4EC95
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti65 – 651D → N in AAA39973. (PubMed:8020970)Curated
    Sequence conflicti87 – 871R → P in AAA39973. (PubMed:8020970)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei22 – 6039Missing in isoform 5. 1 PublicationVSP_011266Add
    BLAST
    Alternative sequencei51 – 6010Missing in isoform 6. 1 PublicationVSP_011267
    Alternative sequencei273 – 28210Missing in isoform 2. 1 PublicationVSP_011268
    Alternative sequencei590 – 65566VTSRA…PAAAA → KVTVPSPSWQDSASSPASSG GGSTATHSSQ in isoform 3. 1 PublicationVSP_011271Add
    BLAST
    Alternative sequencei590 – 65566VTSRA…PAAAA → DSASSPASSGGGSTATHSSQ in isoform 4. 1 PublicationVSP_011272Add
    BLAST
    Alternative sequencei590 – 61728Missing in isoform 8. 1 PublicationVSP_011270Add
    BLAST
    Alternative sequencei590 – 60819Missing in isoform 7. 1 PublicationVSP_011269Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D01093 mRNA. Translation: BAA00877.1.
    L21221
    , L21210, L21211, L21212, L21213, L21214, L21215, L21216, L21217, L21218, L21219, L21220, L21222, L21223 Genomic DNA. Translation: AAA39973.1.
    CCDSiCCDS24018.1. [P29121-1]
    PIRiA54306.
    RefSeqiNP_032819.1. NM_008793.2. [P29121-1]
    UniGeneiMm.299916.

    Genome annotation databases

    EnsembliENSMUST00000020340; ENSMUSP00000020340; ENSMUSG00000020131. [P29121-1]
    GeneIDi18551.
    KEGGimmu:18551.
    UCSCiuc007gcs.2. mouse. [P29121-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D01093 mRNA. Translation: BAA00877.1 .
    L21221
    , L21210 , L21211 , L21212 , L21213 , L21214 , L21215 , L21216 , L21217 , L21218 , L21219 , L21220 , L21222 , L21223 Genomic DNA. Translation: AAA39973.1 .
    CCDSi CCDS24018.1. [P29121-1 ]
    PIRi A54306.
    RefSeqi NP_032819.1. NM_008793.2. [P29121-1 ]
    UniGenei Mm.299916.

    3D structure databases

    ProteinModelPortali P29121.
    SMRi P29121. Positions 33-107, 115-580.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 202060. 1 interaction.
    STRINGi 10090.ENSMUSP00000020340.

    Protein family/group databases

    MEROPSi S08.074.

    PTM databases

    PhosphoSitei P29121.

    Proteomic databases

    PRIDEi P29121.

    Protocols and materials databases

    DNASUi 18551.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000020340 ; ENSMUSP00000020340 ; ENSMUSG00000020131 . [P29121-1 ]
    GeneIDi 18551.
    KEGGi mmu:18551.
    UCSCi uc007gcs.2. mouse. [P29121-1 ]

    Organism-specific databases

    CTDi 54760.
    MGIi MGI:97514. Pcsk4.

    Phylogenomic databases

    eggNOGi COG4935.
    GeneTreei ENSGT00750000117358.
    HOGENOMi HOG000192536.
    HOVERGENi HBG008705.
    InParanoidi P29121.
    KOi K08671.
    OMAi HVQVQLS.
    OrthoDBi EOG7BW0JD.
    PhylomeDBi P29121.
    TreeFami TF314277.

    Enzyme and pathway databases

    Reactomei REACT_206713. NGF processing.

    Miscellaneous databases

    NextBioi 294352.
    PROi P29121.
    SOURCEi Search...

    Gene expression databases

    Bgeei P29121.
    CleanExi MM_PCSK4.
    Genevestigatori P29121.

    Family and domain databases

    Gene3Di 2.60.120.260. 1 hit.
    3.40.50.200. 1 hit.
    InterProi IPR008979. Galactose-bd-like.
    IPR000209. Peptidase_S8/S53_dom.
    IPR023827. Peptidase_S8_Asp-AS.
    IPR022398. Peptidase_S8_His-AS.
    IPR023828. Peptidase_S8_Ser-AS.
    IPR015500. Peptidase_S8_subtilisin-rel.
    IPR009020. Prot_inh_propept.
    IPR002884. PrprotnconvertsP.
    [Graphical view ]
    PANTHERi PTHR10795. PTHR10795. 1 hit.
    Pfami PF01483. P_proprotein. 1 hit.
    PF00082. Peptidase_S8. 1 hit.
    [Graphical view ]
    PRINTSi PR00723. SUBTILISIN.
    SUPFAMi SSF49785. SSF49785. 1 hit.
    SSF52743. SSF52743. 1 hit.
    SSF54897. SSF54897. 1 hit.
    PROSITEi PS00136. SUBTILASE_ASP. 1 hit.
    PS00137. SUBTILASE_HIS. 1 hit.
    PS00138. SUBTILASE_SER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of the fourth member of the mammalian endoprotease family homologous to the yeast Kex2 protease. Its testis-specific expression."
      Nakayama K., Kim W.-S., Torii S., Hosaka M., Nakagawa T., Ikemizu J., Baba T., Murakami K.
      J. Biol. Chem. 267:5897-5900(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Testis.
    2. "Testicular expression of PC4 in the rat: molecular diversity of a novel germ cell-specific Kex2/subtilisin-like proprotein convertase."
      Seidah N.G., Day R., Hamelin J., Gaspar A., Collard M.W., Chretien M.
      Mol. Endocrinol. 6:1559-1570(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Testis.
    3. "Structure of the gene for the testis-specific proprotein convertase 4 and of its alternate messenger RNA isoforms."
      Mbikay M., Raffin-Sanson M.-L., Tadros H., Sirois F., Seidah N.G., Chretien M.
      Genomics 20:231-237(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 5; 6; 7 AND 8).
      Strain: C57BL/6.
      Tissue: Liver.

    Entry informationi

    Entry nameiPCSK4_MOUSE
    AccessioniPrimary (citable) accession number: P29121
    Secondary accession number(s): Q62094
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 1992
    Last sequence update: December 1, 1992
    Last modified: October 1, 2014
    This is version 119 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3