P29120 (NEC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 134.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuroendocrine convertase 1 Short name=NEC 1 EC=3.4.21.93 Alternative name(s): Prohormone convertase 1 Proprotein convertase 1 Short name=PC1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 753 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin. |
| Catalytic activity | Release of protein hormones, neuropeptides and renin from their precursors, generally by hydrolysis of -Lys-Arg-|- bonds. |
| Cofactor | Calcium. |
| Subcellular location | Cytoplasmic vesicle › secretory vesicle. Note: Localized in the secretion granules. |
| Post-translational modification | O-glycosylated. Ref.7 |
| Polymorphism | Genetic variations in PCSK1 define the body mass index quantitative trait locus 12 (BMIQ12) [MIM:612362]. Variance in body mass index is a susceptibility factor for obesity. |
| Involvement in disease | Proprotein convertase 1 deficiency (PC1 deficiency) [MIM:600955]: Characterized by obesity, hypogonadism, hypoadrenalism, reactive hypoglycemia as well as marked small-intestinal absorptive dysfunction It is due to impaired processing of prohormones. |
| Sequence similarities | Belongs to the peptidase S8 family. Furin subfamily. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P29120-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P29120-2) The sequence of this isoform differs from the canonical sequence as follows: 1-59: MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLG → MGKGSISFLFFS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | Potential | ||||||||
| Propeptide | 28 – 110 | 83 | Potential | PRO_0000027057 | |||||||
| Chain | 111 – 753 | 643 | Neuroendocrine convertase 1 | PRO_0000027058 | |||||||
Regions | |||||||||||
| Region | 122 – 410 | 289 | Catalytic | ||||||||
| Region | 739 – 751 | 13 | Amphipathic Potential | ||||||||
Sites | |||||||||||
| Active site | 167 | 1 | Charge relay system By similarity | ||||||||
| Active site | 208 | 1 | Charge relay system By similarity | ||||||||
| Active site | 382 | 1 | Charge relay system By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 401 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 632 | 1 | O-linked (GalNAc...) Ref.7 | ||||||||
| Disulfide bond | 225 ↔ 374 | By similarity | |||||||||
| Disulfide bond | 317 ↔ 347 | By similarity | |||||||||
| Disulfide bond | 467 ↔ 494 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 59 | 59 | MERRA…YDLLG → MGKGSISFLFFS in isoform 2. | VSP_046100 | |||||||
| Natural variant | 80 | 1 | R → Q. Ref.3 Corresponds to variant rs1799904 [ dbSNP | Ensembl ]. | VAR_013906 | |||||||
| Natural variant | 213 | 1 | Missing in PC1 deficiency. Ref.11 | VAR_022777 | |||||||
| Natural variant | 221 | 1 | N → D Associated with susceptibility to obesity; induces a 10.4% reduction of activity (P = 0.03) when compared to the wild-type enzyme. Ref.9 Ref.13 Corresponds to variant rs6232 [ dbSNP | Ensembl ]. | VAR_013907 | |||||||
| Natural variant | 307 | 1 | S → L in PC1 deficiency; in vitro the mutation markedly impairs the catalytic activity of the enzyme; however intracellular trafficking of this mutant enzyme appears normal; retains some autocatalytic activity even though it is completely inactive on other substrates. Ref.12 | VAR_055002 | |||||||
| Natural variant | 483 | 1 | G → R in PC1 deficiency; prevents processing of pro-PCSK1 and leads to its retention in the endoplasmic reticulum. Ref.8 | VAR_022778 | |||||||
| Natural variant | 665 | 1 | Q → E. Ref.3 Ref.9 Ref.12 Corresponds to variant rs6234 [ dbSNP | Ensembl ]. | VAR_013908 | |||||||
| Natural variant | 690 | 1 | S → T. Ref.9 Ref.12 Corresponds to variant rs6235 [ dbSNP | Ensembl ]. | VAR_013909 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 357 | 1 | S → G in CAA46031. Ref.1 | ||||||||
| Sequence conflict | 370 – 371 | 2 | LH → VD in BAA11133. Ref.3 | ||||||||
| Sequence conflict | 617 | 1 | R → G in BAH14073. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression in human lung tumor cells of the proprotein processing enzyme PC1/PC3. Cloning and primary sequence of a 5 kb cDNA." Creemers J.W.M., Roebroek A.J.M., van de Ven W.J.M. FEBS Lett. 300:82-88(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The cDNA sequence of the human pro-hormone and pro-protein convertase PC1." Seidah N.G., Hamelin J., Gaspar A.M., Day R., Chretien M. DNA Cell Biol. 11:283-289(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Human prohormone convertase 3 gene: exon-intron organization and molecular scanning for mutations in Japanese subjects with NIDDM." Ohagi S., Sakaguchi H., Sanke T., Tatsuta H., Hanabusa T., Nanjo K. Diabetes 45:897-901(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-80 AND GLU-665. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Trachea. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Neuroendocrine-specific expression of the human prohormone convertase 1 gene. Hormonal regulation of transcription through distinct cAMP response elements." Jansen E. J. Biol. Chem. 270:15391-15397(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-60. |
| [7] | "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins." Halim A., Ruetschi U., Larson G., Nilsson J. J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-632, MASS SPECTROMETRY. |
| [8] | "Obesity and impaired prohormone processing associated with mutations in the human prohormone convertase 1 gene." Jackson R.S., Creemers J.W., Ohagi S., Raffin-Sanson M.-L., Sanders L., Montague C.T., Hutton J.C., O'Rahilly S. Nat. Genet. 16:303-306(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PC1 DEFICIENCY ARG-483. |
| [9] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-221; GLU-665 AND THR-690. |
| [10] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| [11] | "Small-intestinal dysfunction accompanies the complex endocrinopathy of human proprotein convertase 1 deficiency." Jackson R.S., Creemers J.W., Farooqi I.S., Raffin-Sanson M.-L., Varro A., Dockray G.J., Holst J.J., Brubaker P.L., Corvol P., Polonsky K.S., Ostrega D., Becker K.L., Bertagna X., Hutton J.C., White A., Dattani M.T., Hussain K., Middleton S.J. O'Rahilly S.J. Clin. Invest. 112:1550-1560(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PC1 DEFICIENCY ALA-213 DEL. |
| [12] | "Hyperphagia and early-onset obesity due to a novel homozygous missense mutation in prohormone convertase 1/3." Farooqi I.S., Volders K., Stanhope R., Heuschkel R., White A., Lank E., Keogh J., O'Rahilly S., Creemers J.W.M. J. Clin. Endocrinol. Metab. 92:3369-3373(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PC1 DEFICIENCY LEU-307, CHARACTERIZATION OF VARIANT PC1 DEFICIENCY LEU-307, VARIANTS GLU-665 AND THR-690. |
| [13] | "Common nonsynonymous variants in PCSK1 confer risk of obesity." Benzinou M., Creemers J.W.M., Choquet H., Lobbens S., Dina C., Durand E., Guerardel A., Boutin P., Jouret B., Heude B., Balkau B., Tichet J., Marre M., Potoczna N., Horber F., Le Stunff C., Czernichow S., Sandbaek A. Froguel P.Nat. Genet. 40:943-945(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASP-221, CHARACTERIZATION OF VARIANT ASP-221, ASSOCIATION WITH SUSCEPTIBILITY TO OBESITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X64810 mRNA. Translation: CAA46031.1. M90753 mRNA. Translation: AAA59918.1. D73407 Genomic DNA. Translation: BAA11133.1. AK303888 mRNA. Translation: BAH14073.1. AC008951 Genomic DNA. No translation available. AC108107 Genomic DNA. No translation available. U24128 Genomic DNA. Translation: AAA73788.1. |
| IPI | IPI00301961. IPI00967321. |
| PIR | KXHUC1. S21106. |
| RefSeq | NP_000430.3. NM_000439.4. NP_001171346.1. NM_001177875.1. |
| UniGene | Hs.78977. |
3D structure databases | |
| ProteinModelPortal | P29120. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000308024. |
Protein family/group databases | |
| MEROPS | S08.072. |
PTM databases | |
| PhosphoSite | P29120. |
Polymorphism databases | |
| DMDM | 116242674. |
Proteomic databases | |
| PaxDb | P29120. |
| PRIDE | P29120. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311106; ENSP00000308024; ENSG00000175426. ENST00000508626; ENSP00000421600; ENSG00000175426. |
| GeneID | 5122. |
| KEGG | hsa:5122. |
| UCSC | uc003kls.2. human. |
Organism-specific databases | |
| CTD | 5122. |
| GeneCards | GC05M095751. |
| HGNC | HGNC:8743. PCSK1. |
| HPA | HPA048564. |
| MIM | 162150. gene. 600955. phenotype. 612362. phenotype. |
| neXtProt | NX_P29120. |
| Orphanet | 71528. Obesity due to prohormone convertase-I deficiency. |
| PharmGKB | PA33089. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG4935. |
| HOGENOM | HOG000192536. |
| HOVERGEN | HBG008705. |
| InParanoid | P29120. |
| KO | K01359. |
| OMA | NNPGWKK. |
| OrthoDB | EOG4K3KVR. |
| PhylomeDB | P29120. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | P29120. |
| Bgee | P29120. |
| CleanEx | HS_PCSK1. |
| Genevestigator | P29120. |
| GermOnline | ENSG00000175426. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.200. 1 hit. |
| InterPro | IPR008979. Galactose-bd-like. IPR000209. Peptidase_S8/S53_dom. IPR023827. Peptidase_S8_Asp-AS. IPR022398. Peptidase_S8_His-AS. IPR023828. Peptidase_S8_Ser-AS. IPR015500. Peptidase_S8_subtilisin-rel. IPR022005. Proho_convert. IPR009020. Prot_inh_propept. IPR002884. PrprotnconvertsP. [Graphical view] |
| PANTHER | PTHR10795. PTHR10795. 1 hit. |
| Pfam | PF01483. P_proprotein. 1 hit. PF00082. Peptidase_S8. 1 hit. PF12177. Proho_convert. 1 hit. [Graphical view] |
| PRINTS | PR00723. SUBTILISIN. |
| SUPFAM | SSF49785. Gal_bind_like. 1 hit. SSF52743. Pept_S8_S53. 1 hit. SSF54897. Prot_inh_propept. 1 hit. |
| PROSITE | PS00136. SUBTILASE_ASP. 1 hit. PS00137. SUBTILASE_HIS. 1 hit. PS00138. SUBTILASE_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P29120. |
| ChEMBL | CHEMBL3182. |
| ChiTaRS | PCSK1. human. |
| DrugBank | DB00047. Insulin Glargine recombinant. DB00046. Insulin Lyspro recombinant. DB00030. Insulin recombinant. DB00071. Insulin, porcine. |
| GenomeRNAi | 5122. |
| NextBio | 19750. |
| PMAP-CutDB | P29120. |
| SOURCE | Search... |
Entry information
| Entry name | NEC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29120 Secondary accession number(s): B7Z8T7 Q92532 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
