P28749 (RBL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Retinoblastoma-like protein 1 Alternative name(s): 107 kDa retinoblastoma-associated protein Short name=p107 pRb1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1068 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation. Forms a complex with adenovirus E1A and with SV40 large T antigen. May bind and modulate functionally certain cellular proteins with which T and E1A compete for pocket binding. May act as a tumor suppressor. |
| Subunit structure | Interacts with SUV420H1, SUV420H2 and USP4 By similarity. Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with AATF. Interacts with KDM5A. Interacts with SV40 and JC virus large T antigens. Ref.9 Ref.10 Ref.11 Ref.13 |
| Subcellular location | Nucleus Potential. |
| Post-translational modification | Exists in both phosphorylated and unphosphorylated forms, and T, but not E1A, binds only to the unphosphorylated form. Cell-cycle arrest properties are inactivated by phosphorylation on Thr-332, Ser-640, Ser-964 and Ser-975 by CDK4. Ref.8 Ref.12 Ref.15 |
| Sequence similarities | Belongs to the retinoblastoma protein (RB) family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BEGAIN | Q9BUH8 | 2 | EBI-971402,EBI-742722 | |
| DGKZ | Q13574-2 | 2 | EBI-971402,EBI-715527 | |
| Pax3 | P24610 | 3 | EBI-971402,EBI-1208116 | From a different organism. |
| Sirt1 | Q923E4 | 2 | EBI-971402,EBI-1802585 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P28749-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P28749-2) The sequence of this isoform differs from the canonical sequence as follows: 1013-1068: SLKDINNMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH → VR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1068 | 1068 | Retinoblastoma-like protein 1 | PRO_0000167839 | |||||
Regions | |||||||||
| Region | 385 – 949 | 565 | Pocket; binds T and E1A | ||||||
| Region | 385 – 584 | 200 | Domain A | ||||||
| Region | 585 – 780 | 196 | Spacer | ||||||
| Region | 781 – 949 | 169 | Domain B | ||||||
Amino acid modifications | |||||||||
| Modified residue | 332 | 1 | Phosphothreonine; by CDK2 Ref.8 Ref.15 | ||||||
| Modified residue | 369 | 1 | Phosphothreonine; by CDK4 Ref.8 Ref.12 | ||||||
| Modified residue | 385 | 1 | Phosphothreonine; by CDK2 Ref.8 Ref.15 | ||||||
| Modified residue | 640 | 1 | Phosphoserine; by CDK2 and CDK4 Ref.8 | ||||||
| Modified residue | 650 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 749 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 762 | 1 | Phosphoserine; by CDK2 Ref.8 Ref.15 | ||||||
| Modified residue | 964 | 1 | Phosphoserine; by CDK2 and CDK4 Ref.8 | ||||||
| Modified residue | 975 | 1 | Phosphoserine; by CDK2 and CDK4 Ref.8 | ||||||
| Modified residue | 988 | 1 | Phosphoserine; by CDK2 Ref.8 | ||||||
| Modified residue | 997 | 1 | Phosphothreonine; by CDK2 Ref.8 | ||||||
| Modified residue | 1009 | 1 | Phosphoserine; by CDK2 Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1013 – 1068 | 56 | SLKDI…ERANH → VR in isoform 2. | VSP_017496 | |||||
| Natural variant | 1035 | 1 | I → M. Corresponds to variant rs8114297 [ dbSNP | Ensembl ]. | VAR_034443 | |||||
Experimental info | |||||||||
| Mutagenesis | 640 | 1 | S → A: Strongly reduces phosphorylation by CDK2 and CDK4. Ref.8 | ||||||
| Mutagenesis | 643 | 1 | S → R: No effect on S-640 phosphorylation, but strongly increases S-640 phosphorylation; when associated with 657-A--A-660. Ref.8 | ||||||
| Mutagenesis | 650 | 1 | S → A: No effect on phosphorylation by CDK2. Ref.8 | ||||||
| Mutagenesis | 657 – 660 | 4 | KRRL → AAAA: Reduces S-640 phosphorylation by CDK2 and CDK4. Ref.8 | ||||||
| Sequence conflict | 326 | 1 | Missing AA sequence Ref.8 | ||||||
| Sequence conflict | 928 | 1 | G → S Ref.1 | ||||||
| Sequence conflict | 928 | 1 | G → S Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Inhibition of cell proliferation by p107, a relative of the retinoblastoma protein." Zhu L., van den Heuvel S., Helin K., Fattaey A., Ewen M., Livingston D., Dyson N., Harlow E. Genes Dev. 7:1111-1125(1993) [PubMed: 8319904] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Tongue. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [6] | "Molecular cloning, chromosomal mapping, and expression of the cDNA for p107, a retinoblastoma gene product-related protein." Ewen M.E., Xing Y., Lawrence J.B., Livingston D.M. Cell 66:1155-1164(1991) [PubMed: 1833063] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 134-1068 (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. |
| [7] | "Differential roles of two tandem E2F sites in repression of the human p107 promoter by retinoblastoma and p107 proteins." Zhu L., Zhu L., Xie E., Chang L.S. Mol. Cell. Biol. 15:3552-3562(1995) [PubMed: 7791762] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-52. |
| [8] | "Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4." Leng X., Noble M., Adams P.D., Qin J., Harper J.W. Mol. Cell. Biol. 22:2242-2254(2002) [PubMed: 11884610] [Abstract] Cited for: PROTEIN SEQUENCE OF 320-334; 364-374; 635-657; 949-977 AND 1006-1012, PHOSPHORYLATION AT THR-332; THR-369; THR-385; SER-640; SER-762; SER-964; SER-975; SER-988; THR-997 AND SER-1009, MUTAGENESIS OF SER-640; SER-643; SER-650 AND 657-LYS--LEU-660, MASS SPECTROMETRY. |
| [9] | "The cellular 107K protein that binds to adenovirus E1A also associates with the large T antigens of SV40 and JC virus." Dyson N., Buchkovich K., Whyte P., Harlow E. Cell 58:249-255(1989) [PubMed: 2546678] [Abstract] Cited for: INTERACTION WITH SV40 AND JC VIRUS LARGE T ANTIGEN. |
| [10] | "Differential specificity for binding of retinoblastoma binding protein 2 to RB, p107, and TATA-binding protein." Kim Y.W., Otterson G.A., Kratzke R.A., Coxon A.B., Kaye F.J. Mol. Cell. Biol. 14:7256-7264(1994) [PubMed: 7935440] [Abstract] Cited for: INTERACTION WITH KDM5A. |
| [11] | "Che-1 affects cell growth by interfering with the recruitment of HDAC1 by Rb." Bruno T., De Angelis R., De Nicola F., Barbato C., Di Padova M., Corbi N., Libri V., Benassi B., Mattei E., Chersi A., Soddu S., Floridi A., Passananti C., Fanciulli M. Cancer Cell 2:387-399(2002) [PubMed: 12450794] [Abstract] Cited for: INTERACTION WITH AATF. |
| [12] | "Distinct phosphorylation events regulate p130- and p107-mediated repression of E2F-4." Farkas T., Hansen K., Holm K., Lukas J., Bartek J. J. Biol. Chem. 277:26741-26752(2002) [PubMed: 12006580] [Abstract] Cited for: PHOSPHORYLATION AT THR-369 AND SER-650. |
| [13] | "Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release." Rubin S.M., Gall A.-L., Zheng N., Pavletich N.P. Cell 123:1093-1106(2005) [PubMed: 16360038] [Abstract] Cited for: INTERACTION WITH WITH E2F4 AND TFDP1. |
| [14] | "LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes." Schmit F., Korenjak M., Mannefeld M., Schmitt K., Franke C., von Eyss B., Gagrica S., Haenel F., Brehm A., Gaubatz S. Cell Cycle 6:1903-1913(2007) [PubMed: 17671431] [Abstract] Cited for: IDENTIFICATION IN THE DREAM COMPLEX. |
| [15] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-332; THR-385; SER-749 AND SER-762, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L14812 mRNA. Translation: AAA02489.1. AK290380 mRNA. Translation: BAF83069.1. AL136172, AL365505, AL391114 Genomic DNA. Translation: CAI95716.1. AL365505, AL136172, AL391114 Genomic DNA. Translation: CAI95177.1. AL391114, AL136172, AL365505 Genomic DNA. Translation: CAI95151.1. AL365505, AL136172, AL391114 Genomic DNA. Translation: CAI95178.1. AL391114, AL136172, AL365505 Genomic DNA. Translation: CAI95152.1. AL136172, AL365505, AL391114 Genomic DNA. Translation: CAI95717.1. CH471077 Genomic DNA. Translation: EAW76088.1. BC032247 mRNA. Translation: AAH32247.1. M74547 mRNA. Translation: AAA36397.1. S78664 Genomic DNA. Translation: AAD14290.1. | ||||||||||||
| IPI | IPI00005139. IPI00375494. | ||||||||||||
| PIR | A40265. A47319. | ||||||||||||
| RefSeq | NP_002886.2. NM_002895.2. NP_899662.1. NM_183404.1. | ||||||||||||
| UniGene | Hs.207745. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P28749. | ||||||||||||
| SMR | P28749. Positions 392-969, 1000-1043. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-148N. | ||||||||||||
| IntAct | P28749. 18 interactions. | ||||||||||||
| MINT | MINT-1353484. | ||||||||||||
| STRING | P28749. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P28749. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 90103515. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P28749. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000373664; ENSP00000362768; ENSG00000080839. | ||||||||||||
| GeneID | 5933. | ||||||||||||
| KEGG | hsa:5933. | ||||||||||||
| UCSC | uc002xgi.1. human. uc002xgj.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5933. | ||||||||||||
| GeneCards | GC20M035624. | ||||||||||||
| HGNC | HGNC:9893. RBL1. | ||||||||||||
| MIM | 116957. gene. | ||||||||||||
| neXtProt | NX_P28749. | ||||||||||||
| PharmGKB | PA34257. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG18228. | ||||||||||||
| GeneTree | ENSGT00530000063235. | ||||||||||||
| HOGENOM | HBG358205. | ||||||||||||
| HOVERGEN | HBG017710. | ||||||||||||
| InParanoid | P28749. | ||||||||||||
| OMA | IGASPKQ. | ||||||||||||
| OrthoDB | EOG4QZ7KB. | ||||||||||||
| PhylomeDB | P28749. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. | ||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P28749. | ||||||||||||
| Bgee | P28749. | ||||||||||||
| CleanEx | HS_RBL1. | ||||||||||||
| Genevestigator | P28749. | ||||||||||||
| GermOnline | ENSG00000080839. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013763. Cyclin-like. IPR024599. DUF3452_retinoblatoma-assoc. IPR002720. RB_A. IPR002719. RB_B. IPR015030. Rb_C. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.472.10. Cyclin_related. 3 hits. | ||||||||||||
| KO | K04681. | ||||||||||||
| Pfam | PF11934. DUF3452. 1 hit. PF01858. RB_A. 1 hit. PF01857. RB_B. 1 hit. PF08934. Rb_C. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00385. CYCLIN. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47954. Cyclin_like. 2 hits. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 23126. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P28749 Secondary accession number(s): A8K2W5 Q9H1M1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with