Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

Kif2a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity (By similarity).By similarity2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi312 – 3198ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cell cycle, Cell division, Differentiation, Mitosis, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-2132295. MHC class II antigen presentation.
R-MMU-2467813. Separation of Sister Chromatids.
R-MMU-2500257. Resolution of Sister Chromatid Cohesion.
R-MMU-5663220. RHO GTPases Activate Formins.
R-MMU-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-MMU-68877. Mitotic Prometaphase.
R-MMU-983189. Kinesins.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Gene namesi
Name:Kif2a
Synonyms:Kif2, Kns2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:108390. Kif2a.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Lysosome, Microtubule

Pathology & Biotechi

Disruption phenotypei

Mice show overextension of collateral branches of developing axons and defects in neuronal migration in the brain. They die within 24 hours of birth.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 705705Kinesin-like protein KIF2APRO_0000125415Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei75 – 751PhosphoserineBy similarity
Modified residuei96 – 961PhosphothreonineBy similarity
Modified residuei101 – 1011N6-acetyllysineCombined sources
Modified residuei134 – 1341PhosphoserineBy similarity
Modified residuei139 – 1391PhosphoserineCombined sources
Isoform 1 (identifier: P28740-1)
Modified residuei528 – 5281PhosphoserineCombined sources
Modified residuei545 – 5451PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP28740.
MaxQBiP28740.
PeptideAtlasiP28740.
PRIDEiP28740.

PTM databases

iPTMnetiP28740.
PhosphoSiteiP28740.

Expressioni

Tissue specificityi

Highest level in lung. High level in ovary, moderate levels in heart, kidney, placenta, skeletal muscle and spleen (at protein level). Pancreas and spleen express a shorter isoform (at protein level). Isoform 1 expressed in neuronal cells. Isoform 2 expressed in astrocytes and fibroblasts.1 Publication

Developmental stagei

Isoform 1 expressed at low level in E13 embryonic hippocampus, higher level by stage 15 persisting into juvenile and adult stages. Isoform 2 expressed in E13 and E15 embryonic hippocampus declining to very low levels in juvenile and adult neurons. High level of isoform 1 and very low level of isoform 2 in stage 2 and 5 hippocampal neurons in culture.1 Publication

Gene expression databases

BgeeiENSMUSG00000021693.
CleanExiMM_KIF2A.
ExpressionAtlasiP28740. baseline and differential.
GenevisibleiP28740. MM.

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.By similarity

Protein-protein interaction databases

BioGridi200938. 8 interactions.
IntActiP28740. 7 interactions.
MINTiMINT-4099810.

Structurei

3D structure databases

ProteinModelPortaliP28740.
SMRiP28740. Positions 161-549.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini222 – 552331Kinesin motorPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 216216GlobularSequence analysisAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili659 – 69840Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00830000128292.
HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiP28740.
KOiK10393.
PhylomeDBiP28740.
TreeFamiTF105222.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: P28740-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE DIEPSPELPP PSSSSKVNKI VKNRRTVAAV
110 120 130 140 150
KNDPPPRDNR VVGSARARPS QLPEQSSSAQ QNGSVSDISP VQAAKKEFGP
160 170 180 190 200
PSRRKSNCVK EVEKLQEKRE KRRLQQQELR EKRAQDVDAT NPNYEIMCMI
210 220 230 240 250
RDFRGSLDYR PLTTADPIDE HRICVCVRKR PLNKKETQMK DLDVITIPSK
260 270 280 290 300
DVVMVHEPKQ KVDLTRYLEN QTFRFDYAFD DSAPNEMVYR FTARPLVETI
310 320 330 340 350
FERGMATCFA YGQTGSGKTH TMGGDFSGKN QDCSKGIYAL AARDVFLMLK
360 370 380 390 400
KPNYKKLELQ VYATFFEIYS GKVFDLLNRK TKLRVLEDGK QQVQVVGLQE
410 420 430 440 450
REVKCVEDVL KLIDIGNSCR TSGQTSANAH SSRSHAVFQI ILRRKGKLHG
460 470 480 490 500
KFSLIDLAGN ERGADTSSAD RQTRLEGAEI NKSLLALKEC IRALGRNKPH
510 520 530 540 550
TPFRASKLTQ VLRDSFIGEN SRTCMIATIS PGMASCENTL NTLRYANRVK
560 570 580 590 600
ELTVNPAAAG DVHPIMHHPP SQIDDLETQW GVGSSPQRDD LKLLCEQNEE
610 620 630 640 650
EVSPQLFTFH EAVSQMVEME EQVVEDHRAV FQESIRWIED EKALLEMTEE
660 670 680 690 700
VDYDVDSYAT QLEAILEQKI DILTELRDKV KSFRAALQEE EQASKQINPK

RPRAL
Length:705
Mass (Da):79,756
Last modified:October 2, 2007 - v2
Checksum:iACEBB35CC0F4A68E
GO
Isoform 1 (identifier: P28740-1) [UniParc]FASTAAdd to basket
Also known as: Kif2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     551-551: E → EFGISPSDIPFSQGGGSRPDLSPSYDYDDFSPSITRVKE

Show »
Length:716
Mass (Da):80,861
Checksum:i6655DA8F001DC51B
GO
Isoform 2 (identifier: P28740-2) [UniParc]FASTAAdd to basket
Also known as: Kif2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     133-152: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:659
Mass (Da):74,845
Checksum:i32482C9FE134CF96
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti99 – 991A → ARA in CAA75815 (PubMed:9774330).Curated
Sequence conflicti117 – 1182Missing in CAA75815 (PubMed:9774330).Curated
Sequence conflicti486 – 4861A → R in BAA02165 (PubMed:1447303).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2727Missing in isoform 1 and isoform 2. 2 PublicationsVSP_028377Add
BLAST
Alternative sequencei133 – 15220GSVSD…FGPPS → A in isoform 2. 1 PublicationVSP_028378Add
BLAST
Alternative sequencei551 – 5511E → EFGISPSDIPFSQGGGSRPD LSPSYDYDDFSPSITRVKE in isoform 1. 2 PublicationsVSP_028379

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12644 mRNA. Translation: BAA02165.1.
Y15894 mRNA. Translation: CAA75815.1.
BC006803 mRNA. Translation: AAH06803.2.
CCDSiCCDS26759.1. [P28740-1]
CCDS49356.1. [P28740-3]
PIRiA44259.
RefSeqiNP_001139251.1. NM_001145779.1. [P28740-3]
XP_006517602.1. XM_006517539.2. [P28740-2]
XP_011242927.1. XM_011244625.1. [P28740-1]
UniGeneiMm.355686.

Genome annotation databases

EnsembliENSMUST00000022204; ENSMUSP00000022204; ENSMUSG00000021693. [P28740-3]
ENSMUST00000117423; ENSMUSP00000113921; ENSMUSG00000021693. [P28740-2]
ENSMUST00000122233; ENSMUSP00000112715; ENSMUSG00000021693. [P28740-1]
GeneIDi16563.
KEGGimmu:16563.
UCSCiuc007rub.2. mouse. [P28740-3]
uc007ruc.2. mouse. [P28740-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12644 mRNA. Translation: BAA02165.1.
Y15894 mRNA. Translation: CAA75815.1.
BC006803 mRNA. Translation: AAH06803.2.
CCDSiCCDS26759.1. [P28740-1]
CCDS49356.1. [P28740-3]
PIRiA44259.
RefSeqiNP_001139251.1. NM_001145779.1. [P28740-3]
XP_006517602.1. XM_006517539.2. [P28740-2]
XP_011242927.1. XM_011244625.1. [P28740-1]
UniGeneiMm.355686.

3D structure databases

ProteinModelPortaliP28740.
SMRiP28740. Positions 161-549.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200938. 8 interactions.
IntActiP28740. 7 interactions.
MINTiMINT-4099810.

PTM databases

iPTMnetiP28740.
PhosphoSiteiP28740.

Proteomic databases

EPDiP28740.
MaxQBiP28740.
PeptideAtlasiP28740.
PRIDEiP28740.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022204; ENSMUSP00000022204; ENSMUSG00000021693. [P28740-3]
ENSMUST00000117423; ENSMUSP00000113921; ENSMUSG00000021693. [P28740-2]
ENSMUST00000122233; ENSMUSP00000112715; ENSMUSG00000021693. [P28740-1]
GeneIDi16563.
KEGGimmu:16563.
UCSCiuc007rub.2. mouse. [P28740-3]
uc007ruc.2. mouse. [P28740-1]

Organism-specific databases

CTDi3796.
MGIiMGI:108390. Kif2a.

Phylogenomic databases

GeneTreeiENSGT00830000128292.
HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiP28740.
KOiK10393.
PhylomeDBiP28740.
TreeFamiTF105222.

Enzyme and pathway databases

ReactomeiR-MMU-2132295. MHC class II antigen presentation.
R-MMU-2467813. Separation of Sister Chromatids.
R-MMU-2500257. Resolution of Sister Chromatid Cohesion.
R-MMU-5663220. RHO GTPases Activate Formins.
R-MMU-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-MMU-68877. Mitotic Prometaphase.
R-MMU-983189. Kinesins.

Miscellaneous databases

PROiP28740.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021693.
CleanExiMM_KIF2A.
ExpressionAtlasiP28740. baseline and differential.
GenevisibleiP28740. MM.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2A_MOUSE
AccessioniPrimary (citable) accession number: P28740
Secondary accession number(s): O54744, Q91W03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: October 2, 2007
Last modified: September 7, 2016
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.