P28740 (KIF2A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kinesin-like protein KIF2A Alternative name(s): Kinesin-2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 705 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity By similarity. Ref.4 |
| Subunit structure | Interacts with AURKA, PSRC1 and PLK1 By similarity. |
| Subcellular location | Cytoplasm By similarity. Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › centrosome. Cytoplasm › cytoskeleton › spindle pole. Cytoplasm › cytoskeleton › spindle By similarity. Lysosome. Note: Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1 By similarity. Associated with lysosomes in NIH3T3 cells. Ref.2 |
| Tissue specificity | Highest level in lung. High level in ovary, moderate levels in heart, kidney, placenta, skeletal muscle and spleen (at protein level). Pancreas and spleen express a shorter at protein level). Isoform 1 expressed in neuronal cells. Isoform 2 expressed in astrocytes and fibroblasts. Ref.2 |
| Developmental stage | Isoform 1 expressed at low level in E13 embryonic hippocampus, higher level by stage 15 persisting into juvenile and adult stages. Isoform 2 expressed in E13 and E15 embryonic hippocampus declining to very low levels in juvenile and adult neurons. High level of isoform 1 and very low level of isoform 2 in stage 2 and 5 hippocampal neurons in culture. Ref.2 |
| Disruption phenotype | Mice show overextension of collateral branches of developing axons and defects in neuronal migration in the brain. They die within 24 hours of birth. NIH3T3 cells overexpressing isoform 2 show enlarged lysosomal structures and a defect in their perinuclear localization. Ref.4 |
| Sequence similarities | Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily. Contains 1 kinesin-motor domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: P28740-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P28740-1) Also known as: Kif2; The sequence of this isoform differs from the canonical sequence as follows: 1-27: Missing. 551-551: E → EFGISPSDIPFSQGGGSRPDLSPSYDYDDFSPSITRVKE | ||||||
| Isoform 2 (identifier: P28740-2) Also known as: Kif2-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-27: Missing. 133-152: GSVSDISPVQAAKKEFGPPS → A | ||||||
| Note: Contains a phosphoserine at position 554. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 705 | 705 | Kinesin-like protein KIF2A | PRO_0000125415 | |||||
Regions | |||||||||
| Domain | 217 – 566 | 350 | Kinesin-motor | ||||||
| Nucleotide binding | 312 – 319 | 8 | ATP By similarity | ||||||
| Region | 1 – 216 | 216 | Globular Potential | ||||||
| Coiled coil | 659 – 698 | 40 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 75 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 571 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 27 | 27 | Missing in isoform 1 and isoform 2. | VSP_028377 | |||||
| Alternative sequence | 133 – 152 | 20 | GSVSD…FGPPS → A in isoform 2. | VSP_028378 | |||||
| Alternative sequence | 551 | 1 | E → EFGISPSDIPFSQGGGSRPD LSPSYDYDDFSPSITRVKE in isoform 1. | VSP_028379 | |||||
Experimental info | |||||||||
| Sequence conflict | 99 | 1 | A → ARA in CAA75815. Ref.2 | ||||||
| Sequence conflict | 117 – 118 | 2 | Missing in CAA75815. Ref.2 | ||||||
| Sequence conflict | 486 | 1 | A → R in BAA02165. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Kinesin family in murine central nervous system." Aizawa H., Sekine Y., Takemura R., Zhang Z., Nangaku M., Hirokawa N. J. Cell Biol. 119:1287-1296(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "KIF2beta, a new kinesin superfamily protein in non-neuronal cells, is associated with lysosomes and may be implicated in their centrifugal translocation." Santama N., Krijnse-Locker J., Griffiths G., Noda Y., Hirokawa N., Dotti C.G. EMBO J. 17:5855-5867(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: C57BL/6 X SJL. Tissue: Hippocampus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: FVB/N-3. Tissue: Mammary gland. |
| [4] | "Kinesin superfamily protein 2A (KIF2A) functions in suppression of collateral branch extension." Homma N., Takei Y., Tanaka Y., Nakata T., Terada S., Kikkawa M., Noda Y., Hirokawa N. Cell 114:229-239(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [5] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-571, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-554 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Embryonic brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D12644 mRNA. Translation: BAA02165.1. Y15894 mRNA. Translation: CAA75815.1. BC006803 mRNA. Translation: AAH06803.2. |
| IPI | IPI00127135. IPI00867847. IPI00988408. |
| PIR | A44259. |
| RefSeq | NP_001139251.1. NM_001145779.1. |
| UniGene | Mm.355686. |
3D structure databases | |
| ProteinModelPortal | P28740. |
| SMR | P28740. Positions 161-549. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P28740. 1 interaction. |
PTM databases | |
| PhosphoSite | P28740. |
Proteomic databases | |
| PaxDb | P28740. |
| PRIDE | P28740. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000022204; ENSMUSP00000022204; ENSMUSG00000021693. ENSMUST00000117423; ENSMUSP00000113921; ENSMUSG00000021693. ENSMUST00000122233; ENSMUSP00000112715; ENSMUSG00000021693. |
| GeneID | 16563. |
| KEGG | mmu:16563. |
| UCSC | uc007rub.2. mouse. uc007ruc.2. mouse. uc007rud.2. mouse. |
Organism-specific databases | |
| CTD | 3796. |
| MGI | MGI:108390. Kif2a. |
Phylogenomic databases | |
| eggNOG | COG5059. |
| GeneTree | ENSGT00680000099804. |
| HOGENOM | HOG000231329. |
| HOVERGEN | HBG003875. |
| KO | K10393. |
| OrthoDB | EOG44QT0D. |
Gene expression databases | |
| ArrayExpress | P28740. |
| Bgee | P28740. |
| CleanEx | MM_KIF2A. |
| Genevestigator | P28740. |
| GermOnline | ENSMUSG00000021693. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.40.850.10. 1 hit. |
| InterPro | IPR019821. Kinesin_motor_CS. IPR001752. Kinesin_motor_dom. [Graphical view] |
| Pfam | PF00225. Kinesin. 1 hit. [Graphical view] |
| PRINTS | PR00380. KINESINHEAVY. |
| SMART | SM00129. KISc. 1 hit. [Graphical view] |
| PROSITE | PS00411. KINESIN_MOTOR_DOMAIN1. 1 hit. PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 290061. |
| SOURCE | Search... |
Entry information
| Entry name | KIF2A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P28740 Secondary accession number(s): O54744, Q91W03 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
