Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myeloid zinc finger 1

Gene

MZF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to target promoter DNA and functions as transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • negative regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  • positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  • regulation of transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000099326-MONOMER.
SignaLinkiP28698.
SIGNORiP28698.

Names & Taxonomyi

Protein namesi
Recommended name:
Myeloid zinc finger 1
Short name:
MZF-1
Alternative name(s):
Zinc finger and SCAN domain-containing protein 6
Zinc finger protein 42
Gene namesi
Name:MZF1
Synonyms:MZF, ZNF42, ZSCAN6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:13108. MZF1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7593.
OpenTargetsiENSG00000099326.
PharmGKBiPA37683.

Polymorphism and mutation databases

BioMutaiMZF1.
DMDMi215274121.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000473751 – 734Myeloid zinc finger 1Add BLAST734

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei111PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP28698.
PaxDbiP28698.
PeptideAtlasiP28698.
PRIDEiP28698.

PTM databases

iPTMnetiP28698.
PhosphoSitePlusiP28698.

Expressioni

Tissue specificityi

Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts.1 Publication

Inductioni

By retinoic acid.

Gene expression databases

BgeeiENSG00000099326.
CleanExiHS_MZF1.
ExpressionAtlasiP28698. baseline and differential.
GenevisibleiP28698. HS.

Organism-specific databases

HPAiHPA001757.

Interactioni

Subunit structurei

Homodimer.1 Publication

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi113419. 8 interactors.
IntActiP28698. 3 interactors.
STRINGi9606.ENSP00000215057.

Structurei

Secondary structure

1734
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi40 – 48Combined sources9
Turni54 – 56Combined sources3
Helixi58 – 73Combined sources16
Turni75 – 77Combined sources3
Helixi80 – 95Combined sources16
Helixi98 – 107Combined sources10
Helixi112 – 122Combined sources11
Turni123 – 127Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2FI2NMR-A/B37-128[»]
ProteinModelPortaliP28698.
SMRiP28698.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP28698.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini44 – 125SCAN boxPROSITE-ProRule annotationAdd BLAST82

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi310 – 321Asp/Glu-rich (acidic)Add BLAST12
Compositional biasi463 – 484Gly/Pro-richAdd BLAST22

Sequence similaritiesi

Contains 13 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri356 – 378C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri384 – 406C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri412 – 434C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri440 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri485 – 507C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri513 – 535C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri541 – 563C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri569 – 591C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri597 – 619C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri625 – 647C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri653 – 675C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri681 – 703C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri709 – 731C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00730000111047.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiP28698.
KOiK09221.
OMAiVRGGRCD.
OrthoDBiEOG091G02KC.
PhylomeDBiP28698.
TreeFamiTF337913.

Family and domain databases

Gene3Di3.30.160.60. 13 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 5 hits.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 13 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 13 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MZF1A (identifier: P28698-1) [UniParc]FASTAAdd to basket
Also known as: MZF1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPAVLGSPD RAPPEDEGPV MVKLEDSEEE GEAALWDPGP EAARLRFRCF
60 70 80 90 100
RYEEATGPQE ALAQLRELCR QWLRPEVRSK EQMLELLVLE QFLGALPPEI
110 120 130 140 150
QARVQGQRPG SPEEAAALVD GLRREPGGPR RWVTVQVQGQ EVLSEKMEPS
160 170 180 190 200
SFQPLPETEP PTPEPGPKTP PRTMQESPLG LQVKEESEVT EDSDFLESGP
210 220 230 240 250
LAATQESVPT LLPEEAQRCG TVLDQIFPHS KTGPEGPSWR EHPRALWHEE
260 270 280 290 300
AGGIFSPGFA LQLGSISAGP GSVSPHLHVP WDLGMAGLSG QIQSPSREGG
310 320 330 340 350
FAHALLLPSD LRSEQDPTDE DPCRGVGPAL ITTRWRSPRG RSRGRPSTGG
360 370 380 390 400
GVVRGGRCDV CGKVFSQRSN LLRHQKIHTG ERPFVCSECG RSFSRSSHLL
410 420 430 440 450
RHQLTHTEER PFVCGDCGQG FVRSARLEEH RRVHTGEQPF RCAECGQSFR
460 470 480 490 500
QRSNLLQHQR IHGDPPGPGA KPPAPPGAPE PPGPFPCSEC RESFARRAVL
510 520 530 540 550
LEHQAVHTGD KSFGCVECGE RFGRRSVLLQ HRRVHSGERP FACAECGQSF
560 570 580 590 600
RQRSNLTQHR RIHTGERPFA CAECGKAFRQ RPTLTQHLRV HTGEKPFACP
610 620 630 640 650
ECGQRFSQRL KLTRHQRTHT GEKPYHCGEC GLGFTQVSRL TEHQRIHTGE
660 670 680 690 700
RPFACPECGQ SFRQHANLTQ HRRIHTGERP YACPECGKAF RQRPTLTQHL
710 720 730
RTHRREKPFA CQDCGRRFHQ STKLIQHQRV HSAE
Length:734
Mass (Da):82,055
Last modified:November 25, 2008 - v3
Checksum:iB804766A0B008048
GO
Isoform MZF1B-C (identifier: P28698-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-249: Missing.
     250-257: EAGGIFSP → MNGPLVYA

Show »
Length:485
Mass (Da):54,392
Checksum:i60243378A7B2B6F4
GO
Isoform 3 (identifier: P28698-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-290: FALQLGSISAGPGSVSPHLHVPWDLGMAGLSG → AGAGAAPALGAGWLGAAVAMYVARCSANAATC
     291-734: Missing.

Show »
Length:290
Mass (Da):31,460
Checksum:i28940B137E71394F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti304 – 305AL → RV in AAA59898 (PubMed:1860835).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04767751R → H.2 PublicationsCorresponds to variant rs3752109dbSNPEnsembl.1
Natural variantiVAR_047678103R → H.Corresponds to variant rs3752110dbSNPEnsembl.1
Natural variantiVAR_047679130R → Q.Corresponds to variant rs3752111dbSNPEnsembl.1
Natural variantiVAR_014826331I → V.Corresponds to variant rs4756dbSNPEnsembl.1
Natural variantiVAR_047680441R → P.Corresponds to variant rs2229255dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0068891 – 249Missing in isoform MZF1B-C. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_006890250 – 257EAGGIFSP → MNGPLVYA in isoform MZF1B-C. 1 Publication8
Alternative sequenceiVSP_047013259 – 290FALQL…AGLSG → AGAGAAPALGAGWLGAAVAM YVARCSANAATC in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047014291 – 734Missing in isoform 3. 1 PublicationAdd BLAST444

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58297 mRNA. Translation: AAA59898.1.
AF055077 mRNA. Translation: AAD55809.1.
AF055078 mRNA. Translation: AAD55810.1.
AF161886 Genomic DNA. Translation: AAF80465.1.
AF161886 Genomic DNA. Translation: AAF80466.1.
AC016629 Genomic DNA. No translation available.
AC016630 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72617.1.
BC007777 mRNA. Translation: AAH07777.1.
BC053316 mRNA. Translation: AAH53316.1.
CCDSiCCDS12988.1. [P28698-1]
CCDS59427.1. [P28698-3]
PIRiA40751.
RefSeqiNP_001253962.1. NM_001267033.1. [P28698-3]
NP_003413.2. NM_003422.2. [P28698-1]
NP_932172.1. NM_198055.1. [P28698-1]
UniGeneiHs.399810.
Hs.684624.

Genome annotation databases

EnsembliENST00000215057; ENSP00000215057; ENSG00000099326. [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326. [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326. [P28698-1]
GeneIDi7593.
KEGGihsa:7593.
UCSCiuc002qtn.4. human. [P28698-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58297 mRNA. Translation: AAA59898.1.
AF055077 mRNA. Translation: AAD55809.1.
AF055078 mRNA. Translation: AAD55810.1.
AF161886 Genomic DNA. Translation: AAF80465.1.
AF161886 Genomic DNA. Translation: AAF80466.1.
AC016629 Genomic DNA. No translation available.
AC016630 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72617.1.
BC007777 mRNA. Translation: AAH07777.1.
BC053316 mRNA. Translation: AAH53316.1.
CCDSiCCDS12988.1. [P28698-1]
CCDS59427.1. [P28698-3]
PIRiA40751.
RefSeqiNP_001253962.1. NM_001267033.1. [P28698-3]
NP_003413.2. NM_003422.2. [P28698-1]
NP_932172.1. NM_198055.1. [P28698-1]
UniGeneiHs.399810.
Hs.684624.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2FI2NMR-A/B37-128[»]
ProteinModelPortaliP28698.
SMRiP28698.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113419. 8 interactors.
IntActiP28698. 3 interactors.
STRINGi9606.ENSP00000215057.

PTM databases

iPTMnetiP28698.
PhosphoSitePlusiP28698.

Polymorphism and mutation databases

BioMutaiMZF1.
DMDMi215274121.

Proteomic databases

MaxQBiP28698.
PaxDbiP28698.
PeptideAtlasiP28698.
PRIDEiP28698.

Protocols and materials databases

DNASUi7593.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000215057; ENSP00000215057; ENSG00000099326. [P28698-1]
ENST00000594234; ENSP00000469378; ENSG00000099326. [P28698-3]
ENST00000599369; ENSP00000469493; ENSG00000099326. [P28698-1]
GeneIDi7593.
KEGGihsa:7593.
UCSCiuc002qtn.4. human. [P28698-1]

Organism-specific databases

CTDi7593.
DisGeNETi7593.
GeneCardsiMZF1.
HGNCiHGNC:13108. MZF1.
HPAiHPA001757.
MIMi194550. gene.
neXtProtiNX_P28698.
OpenTargetsiENSG00000099326.
PharmGKBiPA37683.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00730000111047.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiP28698.
KOiK09221.
OMAiVRGGRCD.
OrthoDBiEOG091G02KC.
PhylomeDBiP28698.
TreeFamiTF337913.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000099326-MONOMER.
SignaLinkiP28698.
SIGNORiP28698.

Miscellaneous databases

EvolutionaryTraceiP28698.
GeneWikiiMZF1.
GenomeRNAii7593.
PROiP28698.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000099326.
CleanExiHS_MZF1.
ExpressionAtlasiP28698. baseline and differential.
GenevisibleiP28698. HS.

Family and domain databases

Gene3Di3.30.160.60. 13 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 5 hits.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 13 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 13 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMZF1_HUMAN
AccessioniPrimary (citable) accession number: P28698
Secondary accession number(s): M0QXU0
, Q7Z729, Q96I71, Q9NRY0, Q9UBW2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: November 25, 2008
Last modified: November 2, 2016
This is version 172 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.