Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P28481

- CO2A1_MOUSE

UniProt

P28481 - CO2A1_MOUSE

Protein

Collagen alpha-1(II) chain

Gene

Col2a1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 143 (01 Oct 2014)
      Sequence version 2 (06 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Type II collagen is specific for cartilaginous tissues. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressive forces.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei181 – 1822Cleavage; by procollagen N-endopeptidaseBy similarity
    Sitei1241 – 12422Cleavage; by procollagen C-endopeptidaseBy similarity
    Metal bindingi1301 – 13011CalciumBy similarity
    Metal bindingi1303 – 13031CalciumBy similarity
    Metal bindingi1304 – 13041Calcium; via carbonyl oxygenBy similarity
    Metal bindingi1306 – 13061Calcium; via carbonyl oxygenBy similarity
    Metal bindingi1309 – 13091CalciumBy similarity

    GO - Molecular functioni

    1. extracellular matrix structural constituent Source: InterPro
    2. identical protein binding Source: IntAct
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. bone development Source: MGI
    2. cartilage condensation Source: MGI
    3. cartilage development Source: MGI
    4. cartilage development involved in endochondral bone morphogenesis Source: MGI
    5. cellular response to BMP stimulus Source: MGI
    6. central nervous system development Source: UniProtKB
    7. chondrocyte differentiation Source: UniProtKB
    8. collagen fibril organization Source: MGI
    9. embryonic skeletal joint morphogenesis Source: Ensembl
    10. endochondral ossification Source: MGI
    11. heart morphogenesis Source: MGI
    12. inner ear development Source: MGI
    13. inner ear morphogenesis Source: MGI
    14. limb bud formation Source: UniProtKB
    15. limb morphogenesis Source: MGI
    16. negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: MGI
    17. notochord development Source: UniProtKB
    18. ossification Source: UniProtKB
    19. otic vesicle development Source: UniProtKB
    20. palate development Source: MGI
    21. proteoglycan metabolic process Source: MGI
    22. regulation of gene expression Source: MGI
    23. sensory perception of sound Source: Ensembl
    24. skeletal system morphogenesis Source: MGI
    25. tissue homeostasis Source: MGI
    26. visual perception Source: Ensembl

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_196606. ECM proteoglycans.
    REACT_196607. Non-integrin membrane-ECM interactions.
    REACT_198984. Collagen biosynthesis and modifying enzymes.
    REACT_199046. Assembly of collagen fibrils and other multimeric structures.
    REACT_199055. Collagen degradation.
    REACT_206066. Extracellular matrix organization.
    REACT_216309. Integrin cell surface interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Collagen alpha-1(II) chain
    Alternative name(s):
    Alpha-1 type II collagen
    Cleaved into the following 2 chains:
    Gene namesi
    Name:Col2a1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 15

    Organism-specific databases

    MGIiMGI:88452. Col2a1.

    Subcellular locationi

    Secretedextracellular spaceextracellular matrix PROSITE-ProRule annotation

    GO - Cellular componenti

    1. basement membrane Source: MGI
    2. collagen trimer Source: MGI
    3. collagen type II trimer Source: MGI
    4. cytoplasm Source: MGI
    5. extracellular matrix Source: MGI
    6. extracellular space Source: MGI
    7. proteinaceous extracellular matrix Source: MGI

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Defects in Col2a1 are the cause of a phenotype resembling human spondyloepiphyseal dysplasia congenita (sedc). Homozygous sedc mice can be identified at birth by their small size and shortened trunk. Adults have shortened noses, dysplastic vertebrae, femora and tibias, and retinoschisis and hearing loss.

    Keywords - Diseasei

    Disease mutation

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Propeptidei26 – 181156N-terminal propeptideBy similarityPRO_0000005732Add
    BLAST
    Chaini182 – 12411060Collagen alpha-1(II) chainPRO_0000005733Add
    BLAST
    Chaini1242 – 1487246ChondrocalcinPRO_0000005734Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei190 – 19015-hydroxylysineBy similarity
    Glycosylationi190 – 1901O-linked (Gal...)By similarity
    Modified residuei287 – 28715-hydroxylysineBy similarity
    Glycosylationi287 – 2871O-linked (Gal...)By similarity
    Modified residuei299 – 29915-hydroxylysineBy similarity
    Glycosylationi299 – 2991O-linked (Gal...)By similarity
    Modified residuei308 – 30815-hydroxylysineBy similarity
    Glycosylationi308 – 3081O-linked (Gal...)By similarity
    Modified residuei374 – 37415-hydroxylysineBy similarity
    Glycosylationi374 – 3741O-linked (Gal...)By similarity
    Modified residuei608 – 60815-hydroxylysineBy similarity
    Glycosylationi608 – 6081O-linked (Gal...)By similarity
    Modified residuei620 – 62015-hydroxylysineBy similarity
    Glycosylationi620 – 6201O-linked (Gal...)By similarity
    Modified residuei670 – 67013-hydroxyprolineBy similarity
    Modified residuei907 – 90713-hydroxyprolineBy similarity
    Modified residuei1144 – 114413-hydroxyprolineBy similarity
    Modified residuei1186 – 118613-hydroxyprolineBy similarity
    Modified residuei1201 – 120113-hydroxyprolineBy similarity
    Modified residuei1207 – 120713-hydroxyprolineBy similarity
    Modified residuei1213 – 121313-hydroxyprolineBy similarity
    Disulfide bondi1283 ↔ 1315PROSITE-ProRule annotation
    Disulfide bondi1289 – 1289Interchain (with C-1306)PROSITE-ProRule annotation
    Disulfide bondi1306 – 1306Interchain (with C-1289)PROSITE-ProRule annotation
    Disulfide bondi1323 ↔ 1485PROSITE-ProRule annotation
    Disulfide bondi1393 ↔ 1438PROSITE-ProRule annotation

    Post-translational modificationi

    Probably 3-hydroxylated on prolines by LEPREL1 By similarity. Proline residues at the third position of the tripeptide repeating unit (G-X-P) are hydroxylated in some or all of the chains. Proline residues at the second position of the tripeptide repeating unit (G-P-X) are hydroxylated in some of the chains.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Hydroxylation

    Proteomic databases

    PaxDbiP28481.
    PRIDEiP28481.

    PTM databases

    PhosphoSiteiP28481.

    Expressioni

    Developmental stagei

    Expressed in chondrogenic tissues in advance of chondrocyte differentiation. Expressed early in embryogenesis at 9.5 days both in the cranial mesenchyme destined for the chondrocranium, and the sclerotome of the somites, and at 12.5 days in the primordia of the hyoid and the laryngeal cartilage. Detected in all the chondrogenic tissues of the axial and appendicular skeleton until the onset of endochondral ossification. Expression also observed in non-chondrogenic tissues such as the notochord. Also expressed much later in the tail tendon, at 16.5-18.5 days. Transiently expressed in the heart at 9.5-12.5 days, the epidermis at 10.5-14.5 days, the calvarial mesenchyme at 12.5-16.5 days, the inner ear at 14.5 days and the fetal brain from 9.5-14.5 days. Within the neural tube, expression is localized to the proliferative ventricular cells of the forebrain and midbrain of 9.5-10.5 day embryos, and subsequently, restricted to the rhombencephalic basal plate, the ventricular layer of the hindbrain and the cervical spinal cord.1 Publication

    Gene expression databases

    BgeeiP28481.
    CleanExiMM_COL2A1.
    GenevestigatoriP28481.

    Interactioni

    Subunit structurei

    Homotrimers of alpha 1(II) chains.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-738477,EBI-738477

    Protein-protein interaction databases

    IntActiP28481. 1 interaction.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2W65X-ray2.21E530-538[»]
    4BKLX-ray3.25E/F/G744-780[»]
    ProteinModelPortaliP28481.
    SMRiP28481. Positions 29-96, 1271-1487.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP28481.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini32 – 8958VWFCPROSITE-ProRule annotationAdd
    BLAST
    Domaini1253 – 1487235Fibrillar collagen NC1PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni201 – 12141014Triple-helical regionAdd
    BLAST
    Regioni1215 – 124127Nonhelical region (C-terminal)Add
    BLAST

    Domaini

    The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function By similarity.By similarity

    Sequence similaritiesi

    Belongs to the fibrillar collagen family.PROSITE-ProRule annotation
    Contains 1 fibrillar collagen NC1 domain.PROSITE-ProRule annotation
    Contains 1 VWFC domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Collagen, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG12793.
    GeneTreeiENSGT00740000114967.
    HOVERGENiHBG004933.
    InParanoidiP28481.
    KOiK06236.
    OMAiPLQYMRA.
    OrthoDBiEOG7TJ3HH.
    PhylomeDBiP28481.
    TreeFamiTF344135.

    Family and domain databases

    InterProiIPR008160. Collagen.
    IPR000885. Fib_collagen_C.
    IPR001007. VWF_C.
    [Graphical view]
    PfamiPF01410. COLFI. 1 hit.
    PF01391. Collagen. 11 hits.
    PF00093. VWC. 1 hit.
    [Graphical view]
    ProDomiPD002078. Fib_collagen_C. 1 hit.
    [Graphical view] [Entries sharing at least one domain]
    SMARTiSM00038. COLFI. 1 hit.
    SM00214. VWC. 1 hit.
    [Graphical view]
    PROSITEiPS51461. NC1_FIB. 1 hit.
    PS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P28481-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIRLGAPQSL VLLTLLIAAV LRCQGQDAQE AGSCLQNGQR YKDKDVWKPS     50
    SCRICVCDTG NVLCDDIICE DPDCLNPEIP FGECCPICPA DLATASGKLG 100
    PKGQKGEPGD IRDIIGPRGP PGPQGPAGEQ GPRGDRGDKG EKGAPGPRGR 150
    DGEPGTPGNP GPAGPPGPPG PPGLSAGNFA AQMAGGYDEK AGGAQMGVMQ 200
    GPMGPMGPRG PPGPAGAPGP QGFQGNPGEP GEPGVSGPMG PRGPPGPAGK 250
    PGDDGEAGKP GKSGERGLPG PQGARGFPGT PGLPGVKGHR GYPGLDGAKG 300
    EAGAPGVKGE SGSPGENGSP GPMGPRGLPG ERGRTGPAGA AGARGNDGQP 350
    GPAGPPGPVG PAGGPGFPGA PGAKGEAGPT GARGPEGAQG SRGEPGNPGS 400
    PGPAGASGNP GTDGIPGAKG SAGAPGIAGA PGFPGPRGPP GPQGATGPLG 450
    PKGQAGEPGI AGFKGDQGPK GETGPAGPQG APGPAGEEGK RGARGEPGGA 500
    GPIGPPGERG APGNRGFPGQ DGLAGPKGAP GERGPSGLTG PKGANGDPGR 550
    PGEPGLPGAR GLTGRPGDAG PQGKVGPSGA PGEDGRPGPP GPQGARGQPG 600
    VMGFPGPKGA NGEPGKAGEK GLAGAPGLRG LPGKDGETGA AGPPGPSGPA 650
    GERGEQGAPG PSGFQGLPGP PGPPGEGGKQ GDQGIPGEAG APGLVGPRGE 700
    RGFPGERGSP GAQGLQGPRG LPGTPGTDGP KGAAGPDGPP GAQGPPGLQG 750
    MPGERGAAGI AGPKGDRGDV GEKGPEGAPG KDGGRGLTGP IGPPGPAGAN 800
    GEKGEVGPPG PSGSTGARGA PGERGETGPP GPAGFAGPPG ADGQPGAKGD 850
    QGEAGQKGDA GAPGPQGPSG APGPQGPTGV TGPKGARGAQ GPPGATGFPG 900
    AAGRVGPPGA NGNPGPAGPP GPAGKDGPKG VRGDSGPPGR AGDPGLQGPA 950
    GAPGEKGEPG DDGPSGLDGP PGPQGLAGQR GIVGLPGQRG ERGFPGLPGP 1000
    SGEPGKQGAP GASGDRGPPG PVGPPGLTGP AGEPGREGSP GADGPPGRDG 1050
    AAGVKGDRGE TGALGAPGAP GPPGSPGPAG PTGKQGDRGE AGAQGPMGPS 1100
    GPAGARGIAG PQGPRGDKGE SGEQGERGLK GHRGFTGLQG LPGPPGPSGD 1150
    QGASGPAGPS GPRGPPGPVG PSGKDGSNGI PGPIGPPGPR GRSGETGPVG 1200
    PPGSPGPPGP PGPPGPGIDM SAFAGLGQRE KGPDPMQYMR ADEADSTLRQ 1250
    HDVEVDATLK SLNNQIESIR SPDGSRKNPA RTCQDLKLCH PEWKSGDYWI 1300
    DPNQGCTLDA MKVFCNMETG ETCVYPNPAT VPRKNWWSSK SKEKKHIWFG 1350
    ETMNGGFHFS YGDGNLAPNT ANVQMTFLRL LSTEGSQNIT YHCKNSIAYL 1400
    DEAAGNLKKA LLIQGSNDVE MRAEGNSRFT YTALKDGCTK HTGKWGKTVI 1450
    EYRSQKTSRL PIIDIAPMDI GGAEQEFGVD IGPVCFL 1487

    Note: No experimental confirmation available.

    Length:1,487
    Mass (Da):141,973
    Last modified:February 6, 2007 - v2
    Checksum:iE52A7F3951C76701
    GO
    Isoform 2 (identifier: P28481-1) [UniParc]FASTAAdd to Basket

    Also known as: Long

    The sequence of this isoform differs from the canonical sequence as follows:
         114-142: Missing.

    Show »
    Length:1,458
    Mass (Da):139,110
    Checksum:i5B28FCBC6BFB3A95
    GO
    Isoform 3 (identifier: P28481-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         29-97: QEAGSCLQNGQRYKDKDVWKPSSCRICVCDTGNVLCDDIICEDPDCLNPEIPFGECCPICPADLATASG → R
         114-142: Missing.

    Show »
    Length:1,390
    Mass (Da):131,859
    Checksum:i514E8A3086208F1B
    GO
    Isoform 4 (identifier: P28481-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         103-113: Missing.
         125-142: Missing.

    Show »
    Length:1,458
    Mass (Da):139,027
    Checksum:i0D7D97A4DD9E1540
    GO
    Isoform 5 (identifier: P28481-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         114-124: Missing.
         143-177: Missing.

    Show »
    Length:1,441
    Mass (Da):137,868
    Checksum:i88086B838B2876F9
    GO
    Isoform 6 (identifier: P28481-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         103-113: Missing.
         143-177: Missing.

    Show »
    Length:1,441
    Mass (Da):137,785
    Checksum:iAB4C30D6A44C5DDE
    GO
    Isoform 7 (identifier: P28481-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         29-97: QEAGSCLQNGQRYKDKDVWKPSSCRICVCDTGNVLCDDIICEDPDCLNPEIPFGECCPICPADLATASG → R

    Note: No experimental confirmation available.

    Show »
    Length:1,419
    Mass (Da):134,722
    Checksum:iF0173B07E7C72D5C
    GO

    Sequence cautioni

    The sequence BAC25865.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti97 – 971G → GR in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti97 – 971G → GR in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti97 – 971G → GR in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti97 – 971G → GR in AAA68102. (PubMed:1885613)Curated
    Sequence conflicti272 – 2721Q → M in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti272 – 2721Q → M in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti272 – 2721Q → M in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti272 – 2721Q → M in AAA68102. (PubMed:1885613)Curated
    Sequence conflicti539 – 5391T → A in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti539 – 5391T → A in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti539 – 5391T → A in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti539 – 5391T → A in AAA68102. (PubMed:1885613)Curated
    Sequence conflicti806 – 8061V → A in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti806 – 8061V → A in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti806 – 8061V → A in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti806 – 8061V → A in AAA68102. (PubMed:1885613)Curated
    Sequence conflicti824 – 8241R → P in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti824 – 8241R → P in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti824 – 8241R → P in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti947 – 9471Q → E in AAA68100. (PubMed:1885613)Curated
    Sequence conflicti947 – 9471Q → E in AAA68101. (PubMed:1885613)Curated
    Sequence conflicti947 – 9471Q → E in AAA68099. (PubMed:1885613)Curated
    Sequence conflicti947 – 9471Q → E in AAA68102. (PubMed:1885613)Curated
    Sequence conflicti1119 – 11191G → R in AAH51383. (PubMed:15489334)Curated
    Sequence conflicti1141 – 11455LPGPP → SAWPS in AAC06113. (PubMed:1797232)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti989 – 9891R → C in sedc mice. 1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei29 – 9769QEAGS…ATASG → R in isoform 3 and isoform 7. 1 PublicationVSP_022780Add
    BLAST
    Alternative sequencei103 – 11311Missing in isoform 4 and isoform 6. CuratedVSP_022781Add
    BLAST
    Alternative sequencei114 – 14229Missing in isoform 2 and isoform 3. CuratedVSP_022782Add
    BLAST
    Alternative sequencei114 – 12411Missing in isoform 5. CuratedVSP_022783Add
    BLAST
    Alternative sequencei125 – 14218Missing in isoform 4. CuratedVSP_022784Add
    BLAST
    Alternative sequencei143 – 17735Missing in isoform 5 and isoform 6. CuratedVSP_022785Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M65161 Genomic DNA. Translation: AAA68099.1.
    M65161 Genomic DNA. Translation: AAA68100.1.
    M65161 Genomic DNA. Translation: AAA68101.1.
    M65161 Genomic DNA. Translation: AAA68102.1.
    BC030913 mRNA. Translation: AAH30913.1.
    BC051383 mRNA. Translation: AAH51383.1.
    BC052326 mRNA. Translation: AAH52326.1.
    BC082331 mRNA. Translation: AAH82331.1.
    S63190 Genomic DNA. Translation: AAB19627.1.
    M63708 Genomic DNA. Translation: AAA37436.1.
    M63709 Genomic DNA. Translation: AAC06113.1.
    M63710 Genomic DNA. Translation: AAA37435.1.
    AK028295 mRNA. Translation: BAC25865.1. Different initiation.
    X57982 Genomic DNA. Translation: CAA41047.1.
    CCDSiCCDS37189.2. [P28481-3]
    CCDS49716.1. [P28481-7]
    PIRiA41182.
    B41182.
    RefSeqiNP_001106987.2. NM_001113515.2. [P28481-7]
    NP_112440.2. NM_031163.3. [P28481-3]
    UniGeneiMm.2423.

    Genome annotation databases

    EnsembliENSMUST00000023123; ENSMUSP00000023123; ENSMUSG00000022483. [P28481-3]
    ENSMUST00000088355; ENSMUSP00000085693; ENSMUSG00000022483. [P28481-7]
    GeneIDi12824.
    KEGGimmu:12824.
    UCSCiuc007xlp.2. mouse. [P28481-3]
    uc007xlq.2. mouse. [P28481-7]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M65161 Genomic DNA. Translation: AAA68099.1 .
    M65161 Genomic DNA. Translation: AAA68100.1 .
    M65161 Genomic DNA. Translation: AAA68101.1 .
    M65161 Genomic DNA. Translation: AAA68102.1 .
    BC030913 mRNA. Translation: AAH30913.1 .
    BC051383 mRNA. Translation: AAH51383.1 .
    BC052326 mRNA. Translation: AAH52326.1 .
    BC082331 mRNA. Translation: AAH82331.1 .
    S63190 Genomic DNA. Translation: AAB19627.1 .
    M63708 Genomic DNA. Translation: AAA37436.1 .
    M63709 Genomic DNA. Translation: AAC06113.1 .
    M63710 Genomic DNA. Translation: AAA37435.1 .
    AK028295 mRNA. Translation: BAC25865.1 . Different initiation.
    X57982 Genomic DNA. Translation: CAA41047.1 .
    CCDSi CCDS37189.2. [P28481-3 ]
    CCDS49716.1. [P28481-7 ]
    PIRi A41182.
    B41182.
    RefSeqi NP_001106987.2. NM_001113515.2. [P28481-7 ]
    NP_112440.2. NM_031163.3. [P28481-3 ]
    UniGenei Mm.2423.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2W65 X-ray 2.21 E 530-538 [» ]
    4BKL X-ray 3.25 E/F/G 744-780 [» ]
    ProteinModelPortali P28481.
    SMRi P28481. Positions 29-96, 1271-1487.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi P28481. 1 interaction.

    PTM databases

    PhosphoSitei P28481.

    Proteomic databases

    PaxDbi P28481.
    PRIDEi P28481.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000023123 ; ENSMUSP00000023123 ; ENSMUSG00000022483 . [P28481-3 ]
    ENSMUST00000088355 ; ENSMUSP00000085693 ; ENSMUSG00000022483 . [P28481-7 ]
    GeneIDi 12824.
    KEGGi mmu:12824.
    UCSCi uc007xlp.2. mouse. [P28481-3 ]
    uc007xlq.2. mouse. [P28481-7 ]

    Organism-specific databases

    CTDi 1280.
    MGIi MGI:88452. Col2a1.

    Phylogenomic databases

    eggNOGi NOG12793.
    GeneTreei ENSGT00740000114967.
    HOVERGENi HBG004933.
    InParanoidi P28481.
    KOi K06236.
    OMAi PLQYMRA.
    OrthoDBi EOG7TJ3HH.
    PhylomeDBi P28481.
    TreeFami TF344135.

    Enzyme and pathway databases

    Reactomei REACT_196606. ECM proteoglycans.
    REACT_196607. Non-integrin membrane-ECM interactions.
    REACT_198984. Collagen biosynthesis and modifying enzymes.
    REACT_199046. Assembly of collagen fibrils and other multimeric structures.
    REACT_199055. Collagen degradation.
    REACT_206066. Extracellular matrix organization.
    REACT_216309. Integrin cell surface interactions.

    Miscellaneous databases

    ChiTaRSi COL2A1. mouse.
    EvolutionaryTracei P28481.
    NextBioi 282306.
    PROi P28481.
    SOURCEi Search...

    Gene expression databases

    Bgeei P28481.
    CleanExi MM_COL2A1.
    Genevestigatori P28481.

    Family and domain databases

    InterProi IPR008160. Collagen.
    IPR000885. Fib_collagen_C.
    IPR001007. VWF_C.
    [Graphical view ]
    Pfami PF01410. COLFI. 1 hit.
    PF01391. Collagen. 11 hits.
    PF00093. VWC. 1 hit.
    [Graphical view ]
    ProDomi PD002078. Fib_collagen_C. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    SMARTi SM00038. COLFI. 1 hit.
    SM00214. VWC. 1 hit.
    [Graphical view ]
    PROSITEi PS51461. NC1_FIB. 1 hit.
    PS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mouse type II collagen gene. Complete nucleotide sequence, exon structure, and alternative splicing."
      Metsaeranta M., Toman D., de Crombrugghe B., Vuorio E.
      J. Biol. Chem. 266:16862-16869(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 7).
      Strain: C57BL/6.
      Tissue: Brain, Eye and Olfactory epithelium.
    3. "Expression of the mouse alpha 1(II) collagen gene is not restricted to cartilage during development."
      Cheah K.S., Lau E.T., Au P.K., Tam P.P.
      Development 111:945-953(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28, DEVELOPMENTAL STAGE.
    4. "The mouse Col2a-1 gene is highly conserved and is linked to Int-1 on chromosome 15."
      Cheah K.S., Au P.K., Lau E.T., Little P.F., Stubbs L.
      Mamm. Genome 1:171-183(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28; 1031-1145 AND 1359-1487.
    5. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 597-1487.
      Strain: C57BL/6J.
      Tissue: Head.
    6. "Specific hybridization probes for mouse type I, II, III and IX collagen mRNAs."
      Metsaeranta M., Toman D., de Crombrugghe B., Vuorio E.
      Biochim. Biophys. Acta 1089:241-243(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1483-1487.
    7. "A missense mutation in the mouse Col2a1 gene causes spondyloepiphyseal dysplasia congenita, hearing loss, and retinoschisis."
      Donahue L.R., Chang B., Mohan S., Miyakoshi N., Wergedal J.E., Baylink D.J., Hawes N.L., Rosen C.J., Ward-Bailey P., Zheng Q.Y., Bronson R.T., Johnson K.R., Davisson M.T.
      J. Bone Miner. Res. 18:1612-1621(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT SEDC CYS-989.

    Entry informationi

    Entry nameiCO2A1_MOUSE
    AccessioniPrimary (citable) accession number: P28481
    Secondary accession number(s): Q61428
    , Q62031, Q62032, Q62033, Q641K3, Q6LDB1, Q6LDI8, Q6LDI9, Q80VY3, Q80X38, Q8CEF7, Q8K0N6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 1992
    Last sequence update: February 6, 2007
    Last modified: October 1, 2014
    This is version 143 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3