P28074 (PSB5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 151.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proteasome subunit beta type-5 EC=3.4.25.1 Alternative name(s): Macropain epsilon chain Multicatalytic endopeptidase complex epsilon chain Proteasome chain 6 Proteasome epsilon chain Proteasome subunit MB1 Proteasome subunit X | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 263 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib. May catalyze basal processing of intracellular antigens. Plays a role in the protection against oxidative damage through the Nrf2-ARE pathway By similarity. Ref.21 Ref.22 |
| Catalytic activity | Cleavage of peptide bonds with very broad specificity. |
| Subunit structure | The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. The catalytic chamber with the active sites is on the inside of the barrel. This subunit can be displaced by the equivalent immune-specific subunit PSMB8. Directly interacts with POMP. Interacts with HIV-1 TAT protein. Interacts with ABCB1 and TAP1. Ref.13 Ref.16 Ref.17 Ref.18 |
| Subcellular location | |
| Induction | Down-regulated by IFNG/IFN-gamma (at protein level). Induced in breast cancer tissue. Up-regulated by sulforaphane in breast cancer cells. Ref.8 Ref.15 Ref.20 Ref.24 |
| Sequence similarities | Belongs to the peptidase T1B family. |
| Sequence caution | The sequence AAP35423.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA06097.1 differs from that shown. Reason: Erroneous initiation. The sequence CAD97956.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PSMB7 | Q99436 | 6 | EBI-357828,EBI-603319 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P28074-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P28074-2) The sequence of this isoform differs from the canonical sequence as follows: 169-263: GLYYVDSEGN...LHEKYSGSTP → VSEVLCLKPKSFGMYLFCGCAERIGNMARPLLRGQ | ||||||
| Isoform 3 (identifier: P28074-3) The sequence of this isoform differs from the canonical sequence as follows: 1-103: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 59 | 59 | Removed in mature form | PRO_0000026589 | |||||
| Chain | 60 – 263 | 204 | Proteasome subunit beta type-5 | PRO_0000026590 | |||||
Sites | |||||||||
| Active site | 60 | 1 | Nucleophile | ||||||
| Binding site | 108 | 1 | Bortezomib; via amide nitrogen By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 103 | 103 | Missing in isoform 3. | VSP_045686 | |||||
| Alternative sequence | 169 – 263 | 95 | GLYYV…SGSTP → VSEVLCLKPKSFGMYLFCGC AERIGNMARPLLRGQ in isoform 2. | VSP_041263 | |||||
| Natural variant | 24 | 1 | R → C. Corresponds to variant rs11543947 [ dbSNP | Ensembl ]. | VAR_051549 | |||||
Experimental info | |||||||||
| Mutagenesis | 108 | 1 | A → T: Displays resistance to the bortezomib, a proteasome inhibitor of the chymotrypsin-like activity. Displays high resistance to the bortezomib, a proteasome inhibitor of the chymotrypsin-like activity; when associated with V-109. Ref.21 Ref.22 Ref.23 | ||||||
| Mutagenesis | 108 | 1 | A → V: Displays high resistance to the bortezomib, a proteasome inhibitor of the chymotrypsin-like activity. Ref.21 Ref.22 Ref.23 | ||||||
| Mutagenesis | 109 | 1 | A → V: Displays high resistance to the bortezomib, a proteasome inhibitor of the chymotrypsin-like activity; when associated with T-108. Ref.23 | ||||||
| Sequence conflict | 3 – 6 | 4 | LASV → IRGR in BAA06097. Ref.8 | ||||||
| Sequence conflict | 3 – 5 | 3 | LAS → HEG in BC004146. Ref.6 | ||||||
| Sequence conflict | 85 | 1 | I → F AA sequence Ref.11 | ||||||
| Sequence conflict | 109 | 1 | A → G in AAB33092. Ref.9 | ||||||
| Sequence conflict | 158 | 1 | T → S in AAB33092. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Divergent intron arrangement in the MB1/LMP7 proteasome gene pair." Abdulla S., Beck S., Belich M., Jackson A., Nakamura T., Trowsdale J. Immunogenetics 44:254-258(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Skeletal muscle. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Endometrial adenocarcinoma. |
| [4] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Embryonic stem cell, Hypothalamus and Skin. |
| [7] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-203 (ISOFORM 2). Tissue: Cervix carcinoma. |
| [8] | "cDNA cloning and interferon gamma down-regulation of proteasomal subunits X and Y." Akiyama K.-Y., Yokota K.-Y., Kagawa S., Shimbara N., Tamura T., Akioka H., Nothwang H.G., Noda C., Tanaka K., Ichihara A. Science 265:1231-1234(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-263 (ISOFORM 1), INDUCTION. |
| [9] | "Proteasome components with reciprocal expression to that of the MHC-encoded LMP proteins." Belich M.P., Glynne R.J., Senger G., Sheer D., Trowsdale J. Curr. Biol. 4:769-776(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 49-263 (ISOFORM 1). |
| [10] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 56-263 (ISOFORM 1). |
| [11] | "Relationships among the subunits of the high molecular weight proteinase, macropain (proteasome)." Lee L.W., Moomaw C.R., Orth K., McGuire M.J., DeMartino G.N., Slaughter C.A. Biochim. Biophys. Acta 1037:178-185(1990) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 60-85. |
| [12] | "Human proteasome subunits from 2-dimensional gels identified by partial sequencing." Kristensen P., Johnsen A.H., Uerkvitz W., Tanaka K., Hendil K.B. Biochem. Biophys. Res. Commun. 205:1785-1789(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 201-216 AND 226-239. |
| [13] | "Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing." Akiyama K., Kagawa S., Tamura T., Shimbara N., Takashina M., Kristensen P., Hendil K.B., Tanaka K., Ichihara A. FEBS Lett. 343:85-88(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 201-216, SUBUNIT. Tissue: Kidney. |
| [14] | Erratum Kristensen P., Johnsen A.H., Uerkvitz W., Tanaka K., Hendil K.B. Biochem. Biophys. Res. Commun. 207:1059-1059(1995) [PubMed] [Europe PMC] [Abstract] |
| [15] | "Proteasome subunits X and Y alter peptidase activities in opposite ways to the interferon-gamma-induced subunits LMP2 and LMP7." Gaczynska M., Goldberg A.L., Tanaka K., Hendil K.B., Rock K.L. J. Biol. Chem. 271:17275-17280(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [16] | "Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits." Apcher G.S., Heink S., Zantopf D., Kloetzel P.-M., Schmid H.-P., Mayer R.J., Krueger E. FEBS Lett. 553:200-204(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HIV-1 TAT. |
| [17] | "Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome." Begley G.S., Horvath A.R., Taylor J.C., Higgins C.F. Mol. Immunol. 42:137-141(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ABCB1 AND TAP1. |
| [18] | "IFN-gamma-induced immune adaptation of the proteasome system is an accelerated and transient response." Heink S., Ludwig D., Kloetzel P.-M., Krueger E. Proc. Natl. Acad. Sci. U.S.A. 102:9241-9246(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH POMP. |
| [19] | "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex." Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L. Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Embryonic kidney. |
| [20] | "Over-expression of genes and proteins of ubiquitin specific peptidases (USPs) and proteasome subunits (PSs) in breast cancer tissue observed by the methods of RFDD-PCR and proteomics." Deng S., Zhou H., Xiong R., Lu Y., Yan D., Xing T., Dong L., Tang E., Yang H. Breast Cancer Res. Treat. 104:21-30(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [21] | "Molecular basis of bortezomib resistance: proteasome subunit beta5 (PSMB5) gene mutation and overexpression of PSMB5 protein." Oerlemans R., Franke N.E., Assaraf Y.G., Cloos J., van Zantwijk I., Berkers C.R., Scheffer G.L., Debipersad K., Vojtekova K., Lemos C., van der Heijden J.W., Ylstra B., Peters G.J., Kaspers G.L., Dijkmans B.A., Scheper R.J., Jansen G. Blood 112:2489-2499(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ALA-108. |
| [22] | "Point mutation of the proteasome beta5 subunit gene is an important mechanism of bortezomib resistance in bortezomib-selected variants of Jurkat T cell lymphoblastic lymphoma/leukemia line." Lue S., Yang J., Song X., Gong S., Zhou H., Guo L., Song N., Bao X., Chen P., Wang J. J. Pharmacol. Exp. Ther. 326:423-431(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ALA-108. |
| [23] | "Different mutants of PSMB5 confer varying bortezomib resistance in T lymphoblastic lymphoma/leukemia cells derived from the Jurkat cell line." Lue S., Yang J., Chen Z., Gong S., Zhou H., Xu X., Wang J. Exp. Hematol. 37:831-837(2009) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF ALA-108 AND ALA-109. |
| [24] | "Regulation of estrogen receptor alpha expression in human breast cancer cells by sulforaphane." Ramirez M.C., Singletary K. J. Nutr. Biochem. 20:195-201(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY SULFORAPHANE. |
| [25] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X95586 Genomic DNA. Translation: CAA64838.1. AK300714 mRNA. Translation: BAG62391.1. AK311895 mRNA. Translation: BAG34836.1. BX538001 mRNA. Translation: CAD97956.1. Different initiation. AL132780 Genomic DNA. No translation available. CH471078 Genomic DNA. Translation: EAW66193.1. CH471078 Genomic DNA. Translation: EAW66195.1. BC004146 mRNA. No translation available. BC057840 mRNA. Translation: AAH57840.1. BC107720 mRNA. Translation: AAI07721.1. CD048996 mRNA. No translation available. BX248299 mRNA. Translation: CAD62626.1. D29011 mRNA. Translation: BAA06097.1. Different initiation. S74378 mRNA. Translation: AAB33092.1. BT006777 mRNA. Translation: AAP35423.1. Different initiation. |
| IPI | IPI00383971. IPI00479306. IPI00910237. |
| PIR | A54589. I52906. PC2328. S08189. |
| RefSeq | NP_001124197.1. NM_001130725.1. NP_001138404.1. NM_001144932.1. NP_002788.1. NM_002797.3. |
| UniGene | Hs.422990. |
3D structure databases | |
| ProteinModelPortal | P28074. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-27540N. |
| IntAct | P28074. 19 interactions. |
| MINT | MINT-1161576. |
| STRING | 9606.ENSP00000355325. |
Protein family/group databases | |
| MEROPS | T01.P01. |
PTM databases | |
| PhosphoSite | P28074. |
Polymorphism databases | |
| DMDM | 187608890. |
2D gel databases | |
| REPRODUCTION-2DPAGE | IPI00479306. |
Proteomic databases | |
| PaxDb | P28074. |
| PRIDE | P28074. |
Protocols and materials databases | |
| DNASU | 5693. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361611; ENSP00000355325; ENSG00000100804. ENST00000425762; ENSP00000395206; ENSG00000100804. ENST00000493471; ENSP00000452424; ENSG00000100804. |
| GeneID | 5693. |
| KEGG | hsa:5693. |
| UCSC | uc001wii.3. human. uc001wij.3. human. |
Organism-specific databases | |
| CTD | 5693. |
| GeneCards | GC14M023485. |
| HGNC | HGNC:9542. PSMB5. |
| HPA | HPA049518. |
| MIM | 600306. gene. |
| neXtProt | NX_P28074. |
| PharmGKB | PA33887. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0638. |
| HOVERGEN | HBG108297. |
| InParanoid | P28074. |
| KO | K02737. |
| OMA | QTFAYGV. |
| OrthoDB | EOG4M91S6. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. REACT_111217. Metabolism. REACT_115566. Cell Cycle. REACT_116125. Disease. REACT_13505. Proteasome mediated degradation of PAK-2p34. REACT_21257. Metabolism of RNA. REACT_21300. Mitotic M-M/G1 phases. REACT_383. DNA Replication. REACT_578. Apoptosis. REACT_6850. Cdc20:Phospho-APC/C mediated degradation of Cyclin A. REACT_6900. Immune System. REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | P28074. |
| Bgee | P28074. |
| CleanEx | HS_PSMB5. |
| Genevestigator | P28074. |
| GermOnline | ENSG00000100804. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000243. Pept_T1A_subB. IPR016050. Proteasome_bsu_CS. IPR001353. Proteasome_sua/b. IPR023333. Proteasome_suB-type. [Graphical view] |
| Pfam | PF00227. Proteasome. 1 hit. [Graphical view] |
| PRINTS | PR00141. PROTEASOME. |
| PROSITE | PS00854. PROTEASOME_B_1. 1 hit. PS51476. PROTEASOME_B_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P28074. |
| ChEMBL | CHEMBL4662. |
| DrugBank | DB00188. Bortezomib. |
| GenomeRNAi | 5693. |
| NextBio | 22114. |
| SOURCE | Search... |
Entry information
| Entry name | PSB5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P28074 Secondary accession number(s): B2R4N9 Q9TNN9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
