Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calnexin

Gene

CANX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi74Calcium; via carbonyl oxygenBy similarity1
Metal bindingi117Calcium; via carbonyl oxygenBy similarity1
Binding sitei164CarbohydrateBy similarity1
Binding sitei166CarbohydrateBy similarity1
Binding sitei185CarbohydrateBy similarity1
Binding sitei216CarbohydrateBy similarity1
Metal bindingi436CalciumBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone
LigandCalcium, Lectin, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-168316 Assembly of Viral Components at the Budding Site
R-HSA-2132295 MHC class II antigen presentation
R-HSA-8984722 Interleukin-35 Signalling
R-HSA-901042 Calnexin/calreticulin cycle
R-HSA-9020956 Interleukin-27 signaling
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Names & Taxonomyi

Protein namesi
Recommended name:
Calnexin
Alternative name(s):
IP90
Major histocompatibility complex class I antigen-binding protein p88
p90
Gene namesi
Name:CANX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000127022.14
HGNCiHGNC:1473 CANX
MIMi114217 gene
neXtProtiNX_P27824

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 481LumenalSequence analysisAdd BLAST461
Transmembranei482 – 502HelicalSequence analysisAdd BLAST21
Topological domaini503 – 592CytoplasmicSequence analysisAdd BLAST90

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi821
OpenTargetsiENSG00000127022
PharmGKBiPA26055

Chemistry databases

ChEMBLiCHEMBL2719
DrugBankiDB00025 Antihemophilic Factor (Recombinant)
DB00031 Tenecteplase

Polymorphism and mutation databases

BioMutaiCANX
DMDMi543920

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisCombined sourcesAdd BLAST20
ChainiPRO_000000419821 – 592CalnexinAdd BLAST572

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei137N6-acetyllysineCombined sources1
Disulfide bondi160 ↔ 194By similarity
Disulfide bondi360 ↔ 366By similarity
Lipidationi502S-palmitoyl cysteine1 Publication1
Lipidationi503S-palmitoyl cysteine1 Publication1
Modified residuei554PhosphoserineCombined sources1
Modified residuei562PhosphothreonineCombined sources1
Modified residuei564Phosphoserine; by MAPK3Combined sources1
Modified residuei583PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated at Ser-564 by MAPK3/ERK1. phosphorylation by MAPK3/ERK1 increases its association with ribosomes (By similarity).By similarity
Palmitoylation by DHHC6 leads to the preferential localization to the perinuclear rough ER. It mediates the association of calnexin with the ribosome-translocon complex (RTC) which is required for efficient folding of glycosylated proteins.1 Publication
Ubiquitinated, leading to proteasomal degradation. Probably ubiquitinated by ZNRF4.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP27824
MaxQBiP27824
PaxDbiP27824
PeptideAtlasiP27824
PRIDEiP27824
TopDownProteomicsiP27824
P27824-1 [P27824-1]

PTM databases

iPTMnetiP27824
PhosphoSitePlusiP27824
SwissPalmiP27824

Expressioni

Gene expression databases

BgeeiENSG00000127022
CleanExiHS_CANX
ExpressionAtlasiP27824 baseline and differential
GenevisibleiP27824 HS

Organism-specific databases

HPAiCAB004738
HPA009433
HPA009696

Interactioni

Subunit structurei

Interacts with MAPK3/ERK1 (By similarity). Interacts with KCNH2 (PubMed:16361248). Associates with ribosomes (By similarity). Interacts with SGIP1; involved in negative regulation of endocytosis (By similarity). The palmitoylated form interacts with the ribosome-translocon complex component SSR1, promoting efficient folding of glycoproteins (PubMed:22314232). Interacts with SERPINA2P/SERPINA2 and with the S and Z variants of SERPINA1 (PubMed:23826168). Interacts with PPIB (PubMed:20801878). Interacts with ZNRF4 (PubMed:21205830).By similarity5 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107271, 257 interactors
CORUMiP27824
DIPiDIP-457N
IntActiP27824, 395 interactors
MINTiP27824
STRINGi9606.ENSP00000247461

Chemistry databases

BindingDBiP27824

Structurei

3D structure databases

ProteinModelPortaliP27824
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati278 – 2901-1Add BLAST13
Repeati295 – 3071-2Add BLAST13
Repeati314 – 3261-3Add BLAST13
Repeati333 – 3451-4Add BLAST13
Repeati348 – 3582-1Add BLAST11
Repeati367 – 3772-2Add BLAST11
Repeati381 – 3912-3Add BLAST11
Repeati395 – 4052-4Add BLAST11

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni276 – 409P domain (Extended arm)By similarityAdd BLAST134
Regioni278 – 3454 X approximate repeatsAdd BLAST68
Regioni326 – 359Interaction with PPIBBy similarityAdd BLAST34
Regioni348 – 4054 X approximate repeatsAdd BLAST58
Regioni503 – 592Sufficient to mediate interaction with SGIP1By similarityAdd BLAST90

Sequence similaritiesi

Belongs to the calreticulin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0675 Eukaryota
ENOG410XP7T LUCA
GeneTreeiENSGT00430000030841
HOGENOMiHOG000192436
HOVERGENiHBG005407
InParanoidiP27824
KOiK08054
OMAiIICADRR
OrthoDBiEOG091G04SS
PhylomeDBiP27824
TreeFamiTF300618

Family and domain databases

Gene3Di2.10.250.10, 1 hit
InterProiView protein in InterPro
IPR001580 Calret/calnex
IPR018124 Calret/calnex_CS
IPR009033 Calreticulin/calnexin_P_dom_sf
IPR013320 ConA-like_dom_sf
PANTHERiPTHR11073 PTHR11073, 1 hit
PfamiView protein in Pfam
PF00262 Calreticulin, 1 hit
PRINTSiPR00626 CALRETICULIN
SUPFAMiSSF49899 SSF49899, 2 hits
SSF63887 SSF63887, 1 hit
PROSITEiView protein in PROSITE
PS00803 CALRETICULIN_1, 1 hit
PS00804 CALRETICULIN_2, 1 hit
PS00805 CALRETICULIN_REPEAT, 3 hits

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P27824-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGKWLLCML LVLGTAIVEA HDGHDDDVID IEDDLDDVIE EVEDSKPDTT
60 70 80 90 100
APPSSPKVTY KAPVPTGEVY FADSFDRGTL SGWILSKAKK DDTDDEIAKY
110 120 130 140 150
DGKWEVEEMK ESKLPGDKGL VLMSRAKHHA ISAKLNKPFL FDTKPLIVQY
160 170 180 190 200
EVNFQNGIEC GGAYVKLLSK TPELNLDQFH DKTPYTIMFG PDKCGEDYKL
210 220 230 240 250
HFIFRHKNPK TGIYEEKHAK RPDADLKTYF TDKKTHLYTL ILNPDNSFEI
260 270 280 290 300
LVDQSVVNSG NLLNDMTPPV NPSREIEDPE DRKPEDWDER PKIPDPEAVK
310 320 330 340 350
PDDWDEDAPA KIPDEEATKP EGWLDDEPEY VPDPDAEKPE DWDEDMDGEW
360 370 380 390 400
EAPQIANPRC ESAPGCGVWQ RPVIDNPNYK GKWKPPMIDN PSYQGIWKPR
410 420 430 440 450
KIPNPDFFED LEPFRMTPFS AIGLELWSMT SDIFFDNFII CADRRIVDDW
460 470 480 490 500
ANDGWGLKKA ADGAAEPGVV GQMIEAAEER PWLWVVYILT VALPVFLVIL
510 520 530 540 550
FCCSGKKQTS GMEYKKTDAP QPDVKEEEEE KEEEKDKGDE EEEGEEKLEE
560 570 580 590
KQKSDAEEDG GTVSQEEEDR KPKAEEDEIL NRSPRNRKPR RE
Length:592
Mass (Da):67,568
Last modified:June 1, 1994 - v2
Checksum:iEDE094D9B82261EE
GO
Isoform 2 (identifier: P27824-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADRRTPTPFAGCRLPRQRRARDASQVSAPGTRRIM

Note: No experimental confirmation available.
Show »
Length:627
Mass (Da):71,503
Checksum:iE9AD69A866261080
GO
Isoform 3 (identifier: P27824-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Note: No experimental confirmation available.
Show »
Length:484
Mass (Da):55,598
Checksum:i61BB56B36E8C7A4C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti179F → L in AAA21749 (PubMed:8136357).Curated1
Sequence conflicti431 – 433SDI → LTF in AAA35696 (PubMed:1326756).Curated3
Sequence conflicti480R → L in AAA35696 (PubMed:1326756).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0555151 – 108Missing in isoform 3. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_0555161M → MADRRTPTPFAGCRLPRQRR ARDASQVSAPGTRRIM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10284 mRNA Translation: AAA36125.1
L18887 mRNA Translation: AAA21013.1
M94859 mRNA Translation: AAA21749.1
M98452 mRNA Translation: AAA35696.1
AK294702 mRNA Translation: BAG57859.1
AK304420 mRNA Translation: BAG65250.1
AK312334 mRNA Translation: BAG35255.1
AC113426 Genomic DNA No translation available.
AC136604 Genomic DNA No translation available.
CH471165 Genomic DNA Translation: EAW53802.1
CH471165 Genomic DNA Translation: EAW53803.1
CH471165 Genomic DNA Translation: EAW53805.1
BC003552 mRNA Translation: AAH03552.1
BC042843 mRNA Translation: AAH42843.1
AJ271880 mRNA Translation: CAB72137.1
CCDSiCCDS4447.1 [P27824-1]
PIRiA46164
A46673
I53260
RefSeqiNP_001019820.1, NM_001024649.1 [P27824-1]
NP_001737.1, NM_001746.3 [P27824-1]
XP_011532967.1, XM_011534665.2 [P27824-1]
UniGeneiHs.567968

Genome annotation databases

EnsembliENST00000247461; ENSP00000247461; ENSG00000127022 [P27824-1]
ENST00000452673; ENSP00000391646; ENSG00000127022 [P27824-1]
ENST00000504734; ENSP00000424063; ENSG00000127022 [P27824-1]
ENST00000638425; ENSP00000492372; ENSG00000283777 [P27824-1]
ENST00000638706; ENSP00000492868; ENSG00000283777 [P27824-1]
ENST00000639938; ENSP00000491760; ENSG00000283777 [P27824-1]
GeneIDi821
KEGGihsa:821
UCSCiuc003mkk.4 human [P27824-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCALX_HUMAN
AccessioniPrimary (citable) accession number: P27824
Secondary accession number(s): B2R5V8
, B4DGP8, B4E2T8, D3DWQ3, D6R9K3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: June 1, 1994
Last modified: May 23, 2018
This is version 205 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health