Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor III

Gene

Fcgr3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma (PubMed:1692135). Low affinity receptor which binds to IgG1, IgG2a and IgG2b (By similarity). Mediates neutrophil activation by IgG complexes redundantly with Fcgr4 (By similarity).By similarity1 Publication

GO - Molecular functioni

  • IgG binding Source: UniProtKB-KW
  • immunoglobulin receptor binding Source: RGD

GO - Biological processi

  • nerve development Source: RGD
  • regulation of antibody-dependent cellular cytotoxicity Source: RGD
  • regulation of Fc-gamma receptor signaling pathway involved in phagocytosis Source: RGD
  • regulation of tumor necrosis factor secretion Source: RGD

Keywordsi

Molecular functionIgG-binding protein, Receptor

Enzyme and pathway databases

ReactomeiR-RNO-2029481 FCGR activation
R-RNO-2029482 Regulation of actin dynamics for phagocytic cup formation
R-RNO-2029485 Role of phospholipids in phagocytosis
R-RNO-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor III
Short name:
IgG Fc receptor III
Alternative name(s):
Fc-gamma RIII
Short name:
FcRIII
CD_antigen: CD16
Gene namesi
Name:Fcgr3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 13

Organism-specific databases

RGDi71069 Fcgr3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini37 – 221ExtracellularSequence analysisAdd BLAST185
Transmembranei222 – 241HelicalSequence analysisAdd BLAST20
Topological domaini242 – 267CytoplasmicSequence analysisAdd BLAST26

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 36Sequence analysisAdd BLAST36
ChainiPRO_000001515637 – 267Low affinity immunoglobulin gamma Fc region receptor IIIAdd BLAST231

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi62 ↔ 104PROSITE-ProRule annotation
Glycosylationi70N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi78N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi97N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi143 ↔ 187PROSITE-ProRule annotation
Glycosylationi171N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi178N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP27645
PRIDEiP27645

PTM databases

PhosphoSitePlusiP27645

Expressioni

Tissue specificityi

Expressed on natural killer cells and macrophages.

Gene expression databases

BgeeiENSRNOG00000049422
GenevisibleiP27645 RN

Interactioni

Subunit structurei

May form multisubunit complex with other heteroproteins. This association is required for efficient cell-surface expression. Does not associate with CD3 zeta.

GO - Molecular functioni

  • immunoglobulin receptor binding Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000039989

Structurei

3D structure databases

ProteinModelPortaliP27645
SMRiP27645
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini39 – 121Ig-like C2-type 1Add BLAST83
Domaini122 – 204Ig-like C2-type 2Add BLAST83

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP Eukaryota
ENOG410YXNK LUCA
GeneTreeiENSGT00760000119130
HOGENOMiHOG000251632
HOVERGENiHBG051602
InParanoidiP27645
KOiK06463
K06472
K16824
OMAiXAENTIT
OrthoDBiEOG091G0JSA
PhylomeDBiP27645

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform C (identifier: P27645-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLETQMFQN AHSGSQWLLP PLTMLLLFAF ADRQTANLPK AVVKRDPPWI
60 70 80 90 100
QVLKEDTVTL TCEGTHNPGN SSTQWFHNQS STWGQVQASY TFKATVNDSG
110 120 130 140 150
EYRCRMAHTS LSDPVHLEVI SDWLLLQTPQ LVFEEGETIT LRCHSWKNKQ
160 170 180 190 200
LTKVLLFQNG KPVRYYYQSS NFSIPKANHS HSGNYYCKAY LGRTMHVSKP
210 220 230 240 250
VTITVQGSAT ASTSSLVWFH AAFCLVMCLL FAVDTGLYFC VRRNLQTSGE
260
DWRKSLSVGK YKAPQDK
Length:267
Mass (Da):30,282
Last modified:August 1, 1992 - v1
Checksum:iDD4D6A7A3F70ED92
GO
Isoform A (identifier: P27645-3)
Sequence is not available
Length:
Mass (Da):
Isoform B (identifier: P27645-4)
Sequence is not available
Length:
Mass (Da):
Isoform D (identifier: P27645-5)
Sequence is not available
Length:
Mass (Da):
Isoform E (identifier: P27645-6)
Sequence is not available
Length:
Mass (Da):
Isoform F (identifier: P27645-7)
Sequence is not available
Length:
Mass (Da):
Isoform G (identifier: P27645-8)
Sequence is not available
Length:
Mass (Da):
Isoform H (identifier: P27645-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-176: SWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPK → GWKSIQLARISFLQNGEFVSFHPYNVSYSISN

Show »
Length:267
Mass (Da):30,108
Checksum:i340BF4A6538D3E4D
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti36 – 39ANLP → GDLL in isoform A and isoform H. 4
Natural varianti55E → D in isoform A and isoform H. 1
Natural varianti56D → G in isoform D. 1
Natural varianti115V → I in isoform A and isoform B. 1
Natural varianti134E → L in isoform H. 1
Natural varianti138T → R in isoform H. 1
Natural varianti184N → D in isoform H. 1
Natural varianti195M → E in isoform H. 1
Natural varianti254K → R in isoform H. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002647145 – 176SWKNK…FSIPK → GWKSIQLARISFLQNGEFVS FHPYNVSYSISN in isoform H. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64368 mRNA Translation: AAA42049.1
M64369 mRNA Translation: AAA42048.1
M64370 mRNA Translation: AAA42050.1
M32062 mRNA Translation: AAA41148.1
L08446 mRNA Translation: AAA41151.1
PIRiA35902
I56110
I72882
RefSeqiNP_001129464.1, NM_001135992.1
NP_446295.2, NM_053843.2
XP_006250365.1, XM_006250303.3
XP_006250367.1, XM_006250305.3
XP_008767970.1, XM_008769748.2
XP_008767989.1, XM_008769767.1 [P27645-1]
XP_008767990.1, XM_008769768.2 [P27645-1]
XP_008767991.1, XM_008769769.2 [P27645-1]
XP_008767993.1, XM_008769771.2 [P27645-1]
XP_008767994.1, XM_008769772.2 [P27645-1]
XP_008767996.1, XM_008769774.2
XP_008767997.1, XM_008769775.2
XP_008767998.1, XM_008769776.2
XP_017454126.1, XM_017598637.1
UniGeneiRn.154415
Rn.6050

Genome annotation databases

EnsembliENSRNOT00000004204; ENSRNOP00000004204; ENSRNOG00000049422 [P27645-1]
ENSRNOT00000047349; ENSRNOP00000039989; ENSRNOG00000049422 [P27645-1]
GeneIDi100911825
108348047
116591
498276
KEGGirno:100911825
rno:108348047
rno:116591
rno:498276
UCSCiRGD:71069 rat [P27645-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFCGR3_RAT
AccessioniPrimary (citable) accession number: P27645
Secondary accession number(s): Q04798, Q63204
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: August 1, 1992
Last modified: May 23, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health