Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor III

Gene

Fcgr3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.

GO - Molecular functioni

  • IgG receptor activity Source: RGD

GO - Biological processi

  • Fc-gamma receptor signaling pathway Source: GOC
  • nerve development Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

IgG-binding protein

Enzyme and pathway databases

ReactomeiR-RNO-2029481. FCGR activation.
R-RNO-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-RNO-2029485. Role of phospholipids in phagocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor III
Short name:
IgG Fc receptor III
Alternative name(s):
Fc-gamma RIII
Short name:
FcRIII
CD_antigen: CD16
Gene namesi
Name:Fcgr3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 13

Organism-specific databases

RGDi71069. Fcgr3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini37 – 221185ExtracellularSequence analysisAdd
BLAST
Transmembranei222 – 24120HelicalSequence analysisAdd
BLAST
Topological domaini242 – 26726CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3636Sequence analysisAdd
BLAST
Chaini37 – 267231Low affinity immunoglobulin gamma Fc region receptor IIIPRO_0000015156Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi62 ↔ 104PROSITE-ProRule annotation
Glycosylationi70 – 701N-linked (GlcNAc...)Sequence analysis
Glycosylationi78 – 781N-linked (GlcNAc...)Sequence analysis
Glycosylationi97 – 971N-linked (GlcNAc...)Sequence analysis
Disulfide bondi143 ↔ 187PROSITE-ProRule annotation
Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence analysis
Glycosylationi178 – 1781N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP27645.
PRIDEiP27645.

PTM databases

PhosphoSiteiP27645.

Expressioni

Tissue specificityi

Expressed on natural killers cells and macrophages.

Gene expression databases

ExpressionAtlasiP27645. baseline.
GenevisibleiP27645. RN.

Interactioni

Subunit structurei

May form multisubunit complex with other heteroproteins. This association is required for efficient cell-surface expression. Does not associate with CD3 zeta.

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000039989.

Structurei

3D structure databases

ProteinModelPortaliP27645.
SMRiP27645. Positions 39-209.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini39 – 12183Ig-like C2-type 1Add
BLAST
Domaini122 – 20483Ig-like C2-type 2Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000251632.
HOVERGENiHBG051602.
InParanoidiP27645.
KOiK06463.
K06472.
K16824.
OMAiPWYQITF.
OrthoDBiEOG708W0N.
PhylomeDBiP27645.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform C (identifier: P27645-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLETQMFQN AHSGSQWLLP PLTMLLLFAF ADRQTANLPK AVVKRDPPWI
60 70 80 90 100
QVLKEDTVTL TCEGTHNPGN SSTQWFHNQS STWGQVQASY TFKATVNDSG
110 120 130 140 150
EYRCRMAHTS LSDPVHLEVI SDWLLLQTPQ LVFEEGETIT LRCHSWKNKQ
160 170 180 190 200
LTKVLLFQNG KPVRYYYQSS NFSIPKANHS HSGNYYCKAY LGRTMHVSKP
210 220 230 240 250
VTITVQGSAT ASTSSLVWFH AAFCLVMCLL FAVDTGLYFC VRRNLQTSGE
260
DWRKSLSVGK YKAPQDK
Length:267
Mass (Da):30,282
Last modified:August 1, 1992 - v1
Checksum:iDD4D6A7A3F70ED92
GO
Isoform A (identifier: P27645-3)

Sequence is not available
Length:
Mass (Da):
Isoform B (identifier: P27645-4)

Sequence is not available
Length:
Mass (Da):
Isoform D (identifier: P27645-5)

Sequence is not available
Length:
Mass (Da):
Isoform E (identifier: P27645-6)

Sequence is not available
Length:
Mass (Da):
Isoform F (identifier: P27645-7)

Sequence is not available
Length:
Mass (Da):
Isoform G (identifier: P27645-8)

Sequence is not available
Length:
Mass (Da):
Isoform H (identifier: P27645-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-176: SWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPK → GWKSIQLARISFLQNGEFVSFHPYNVSYSISN

Show »
Length:267
Mass (Da):30,108
Checksum:i340BF4A6538D3E4D
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti36 – 394ANLP → GDLL in isoform A and isoform H.
Natural varianti55 – 551E → D in isoform A and isoform H.
Natural varianti56 – 561D → G in isoform D.
Natural varianti115 – 1151V → I in isoform A and isoform B.
Natural varianti134 – 1341E → L in isoform H.
Natural varianti138 – 1381T → R in isoform H.
Natural varianti184 – 1841N → D in isoform H.
Natural varianti195 – 1951M → E in isoform H.
Natural varianti254 – 2541K → R in isoform H.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei145 – 17632SWKNK…FSIPK → GWKSIQLARISFLQNGEFVS FHPYNVSYSISN in isoform H. 1 PublicationVSP_002647Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64368 mRNA. Translation: AAA42049.1.
M64369 mRNA. Translation: AAA42048.1.
M64370 mRNA. Translation: AAA42050.1.
M32062 mRNA. Translation: AAA41148.1.
L08446 mRNA. Translation: AAA41151.1.
PIRiA35902.
I56110.
I72882.
RefSeqiNP_001129464.1. NM_001135992.1.
NP_446295.2. NM_053843.2.
XP_006250365.1. XM_006250303.2.
XP_006250367.1. XM_006250305.2.
XP_006250370.1. XM_006250308.2.
XP_008767970.1. XM_008769748.1.
XP_008767971.1. XM_008769749.1.
XP_008767972.1. XM_008769750.1.
XP_008767989.1. XM_008769767.1. [P27645-1]
XP_008767990.1. XM_008769768.1. [P27645-1]
XP_008767991.1. XM_008769769.1. [P27645-1]
XP_008767992.1. XM_008769770.1. [P27645-1]
XP_008767993.1. XM_008769771.1. [P27645-1]
XP_008767994.1. XM_008769772.1. [P27645-1]
XP_008767996.1. XM_008769774.1.
XP_008767997.1. XM_008769775.1.
XP_008767998.1. XM_008769776.1.
UniGeneiRn.154415.
Rn.6050.

Genome annotation databases

EnsembliENSRNOT00000004204; ENSRNOP00000004204; ENSRNOG00000049422. [P27645-1]
ENSRNOT00000047349; ENSRNOP00000039989; ENSRNOG00000049422. [P27645-1]
GeneIDi100911825.
103693683.
116591.
498276.
KEGGirno:100911825.
rno:103693683.
rno:116591.
rno:498276.
UCSCiRGD:71069. rat. [P27645-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64368 mRNA. Translation: AAA42049.1.
M64369 mRNA. Translation: AAA42048.1.
M64370 mRNA. Translation: AAA42050.1.
M32062 mRNA. Translation: AAA41148.1.
L08446 mRNA. Translation: AAA41151.1.
PIRiA35902.
I56110.
I72882.
RefSeqiNP_001129464.1. NM_001135992.1.
NP_446295.2. NM_053843.2.
XP_006250365.1. XM_006250303.2.
XP_006250367.1. XM_006250305.2.
XP_006250370.1. XM_006250308.2.
XP_008767970.1. XM_008769748.1.
XP_008767971.1. XM_008769749.1.
XP_008767972.1. XM_008769750.1.
XP_008767989.1. XM_008769767.1. [P27645-1]
XP_008767990.1. XM_008769768.1. [P27645-1]
XP_008767991.1. XM_008769769.1. [P27645-1]
XP_008767992.1. XM_008769770.1. [P27645-1]
XP_008767993.1. XM_008769771.1. [P27645-1]
XP_008767994.1. XM_008769772.1. [P27645-1]
XP_008767996.1. XM_008769774.1.
XP_008767997.1. XM_008769775.1.
XP_008767998.1. XM_008769776.1.
UniGeneiRn.154415.
Rn.6050.

3D structure databases

ProteinModelPortaliP27645.
SMRiP27645. Positions 39-209.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000039989.

PTM databases

PhosphoSiteiP27645.

Proteomic databases

PaxDbiP27645.
PRIDEiP27645.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000004204; ENSRNOP00000004204; ENSRNOG00000049422. [P27645-1]
ENSRNOT00000047349; ENSRNOP00000039989; ENSRNOG00000049422. [P27645-1]
GeneIDi100911825.
103693683.
116591.
498276.
KEGGirno:100911825.
rno:103693683.
rno:116591.
rno:498276.
UCSCiRGD:71069. rat. [P27645-1]

Organism-specific databases

CTDi2212.
RGDi71069. Fcgr3.

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000251632.
HOVERGENiHBG051602.
InParanoidiP27645.
KOiK06463.
K06472.
K16824.
OMAiPWYQITF.
OrthoDBiEOG708W0N.
PhylomeDBiP27645.

Enzyme and pathway databases

ReactomeiR-RNO-2029481. FCGR activation.
R-RNO-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-RNO-2029485. Role of phospholipids in phagocytosis.

Miscellaneous databases

PROiP27645.

Gene expression databases

ExpressionAtlasiP27645. baseline.
GenevisibleiP27645. RN.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Rat CD16 is defined by a family of class III Fc gamma receptors requiring co-expression of heteroprotein subunits."
    Farber D.L., Sears D.W.
    J. Immunol. 146:4352-4361(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D).
    Strain: Sprague-Dawley.
  2. "Characterization and expression of an Fc gamma receptor cDNA cloned from rat natural killer cells."
    Zeger D.L., Hogarth P.M., Sears D.W.
    Proc. Natl. Acad. Sci. U.S.A. 87:3425-3429(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Tissue: Natural killer cell.
  3. "Rat class III Fc gamma receptor isoforms differ in IgG subclass-binding specificity and fail to associate productively with rat CD3 zeta."
    Farber D.L., Giorda R., Nettleton M.Y., Trucco M., Kochan J.P., Sears D.W.
    J. Immunol. 150:4364-4375(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM H).
    Strain: Sprague-Dawley.
    Tissue: Brain.

Entry informationi

Entry nameiFCGR3_RAT
AccessioniPrimary (citable) accession number: P27645
Secondary accession number(s): Q04798, Q63204
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: August 1, 1992
Last modified: June 8, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.