Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P27512

- TNR5_MOUSE

UniProt

P27512 - TNR5_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tumor necrosis factor receptor superfamily member 5

Gene

Cd40

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.1 Publication

GO - Molecular functioni

  1. antigen binding Source: Ensembl

GO - Biological processi

  1. B cell activation Source: MGI
  2. cellular calcium ion homeostasis Source: BHF-UCL
  3. cellular response to lipopolysaccharide Source: Ensembl
  4. cellular response to mechanical stimulus Source: Ensembl
  5. defense response to virus Source: MGI
  6. immune response-regulating cell surface receptor signaling pathway Source: MGI
  7. inflammatory response Source: Ensembl
  8. positive regulation of B cell proliferation Source: MGI
  9. positive regulation of Cdc42 GTPase activity Source: Ensembl
  10. positive regulation of endothelial cell apoptotic process Source: Ensembl
  11. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: Ensembl
  12. positive regulation of interleukin-12 production Source: MGI
  13. positive regulation of isotype switching to IgG isotypes Source: MGI
  14. positive regulation of MAP kinase activity Source: Ensembl
  15. positive regulation of NF-kappaB transcription factor activity Source: Ensembl
  16. positive regulation of protein kinase C signaling Source: Ensembl
  17. positive regulation of Rac GTPase activity Source: Ensembl
  18. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  19. positive regulation of tyrosine phosphorylation of Stat1 protein Source: Ensembl
  20. protein kinase B signaling Source: MGI
  21. regulation of immune response Source: MGI
  22. regulation of immunoglobulin secretion Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Enzyme and pathway databases

ReactomeiREACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 5
Alternative name(s):
B-cell surface antigen CD40
Bp50
CD40L receptor
CD_antigen: CD40
Gene namesi
Name:Cd40
Synonyms:Tnfrsf5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:88336. Cd40.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 193174ExtracellularSequence AnalysisAdd
BLAST
Transmembranei194 – 21522HelicalSequence AnalysisAdd
BLAST
Topological domaini216 – 28974CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. CD40 receptor complex Source: BHF-UCL
  2. cell surface Source: MGI
  3. cytoplasm Source: Ensembl
  4. external side of plasma membrane Source: MGI
  5. extracellular space Source: Ensembl
  6. extracellular vesicular exosome Source: Ensembl
  7. intracellular membrane-bounded organelle Source: MGI
  8. plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 289270Tumor necrosis factor receptor superfamily member 5PRO_0000034560Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi26 ↔ 37PROSITE-ProRule annotation
Disulfide bondi38 ↔ 51PROSITE-ProRule annotation
Disulfide bondi41 ↔ 59PROSITE-ProRule annotation
Disulfide bondi62 ↔ 77PROSITE-ProRule annotation
Disulfide bondi83 ↔ 103PROSITE-ProRule annotation
Disulfide bondi105 ↔ 119PROSITE-ProRule annotation
Disulfide bondi111 ↔ 116PROSITE-ProRule annotation
Disulfide bondi125 ↔ 143PROSITE-ProRule annotation
Glycosylationi153 – 1531N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP27512.
PaxDbiP27512.
PRIDEiP27512.

PTM databases

PhosphoSiteiP27512.

Expressioni

Gene expression databases

BgeeiP27512.
CleanExiMM_CD40.
ExpressionAtlasiP27512. baseline and differential.
GenevestigatoriP27512.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 (By similarity). Interacts with TRAF3 and TRAF5. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BtkP359913EBI-525742,EBI-625119
Traf6P701962EBI-525742,EBI-448028

Protein-protein interaction databases

BioGridi204251. 19 interactions.
DIPiDIP-33295N.
IntActiP27512. 3 interactions.
MINTiMINT-1506277.

Structurei

3D structure databases

ProteinModelPortaliP27512.
SMRiP27512. Positions 26-187.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati25 – 6036TNFR-Cys 1Add
BLAST
Repeati61 – 10343TNFR-Cys 2Add
BLAST
Repeati104 – 14441TNFR-Cys 3Add
BLAST
Repeati145 – 18743TNFR-Cys 4Add
BLAST

Sequence similaritiesi

Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG28193.
GeneTreeiENSGT00760000119204.
HOVERGENiHBG005117.
InParanoidiP27512.
KOiK03160.
OMAiEKCHPWT.
OrthoDBiEOG786H2Q.
PhylomeDBiP27512.
TreeFamiTF331157.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR020435. TNFR_5.
[Graphical view]
PfamiPF00020. TNFR_c6. 1 hit.
[Graphical view]
PRINTSiPR01922. TNFACTORR5.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 1 hit.
PS50050. TNFR_NGFR_2. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform I (identifier: P27512-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH
60 70 80 90 100
CTALEKTQCH PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD
110 120 130 140 150
TVCTCKEGQH CTSKDCEACA QHTPCIPGFG VMEMATETTD TVCHPCPVGF
160 170 180 190 200
FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS QTNVICGLKS RMRALLVIPV
210 220 230 240 250
VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM EDYPGHNTAA
260 270 280
PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV
Length:289
Mass (Da):32,093
Last modified:February 26, 2008 - v3
Checksum:iC7970DAD2FEA534A
GO
Isoform II (identifier: P27512-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
     204-289: Missing.

Show »
Length:203
Mass (Da):22,468
Checksum:i0C4C94E7CC426202
GO
Isoform III (identifier: P27512-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
     235-289: Missing.

Show »
Length:234
Mass (Da):25,747
Checksum:i00DB1DD38347E325
GO
Isoform IV (identifier: P27512-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-222: KKVVKKP → SGQETKG
     223-289: Missing.

Show »
Length:222
Mass (Da):24,499
Checksum:iEE21E6C76FB42DEF
GO
Isoform V (identifier: P27512-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

Show »
Length:260
Mass (Da):28,878
Checksum:i57A37C0E8CF2F142
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti21 – 211G → W in BAE31440. (PubMed:16141072)Curated
Sequence conflicti24 – 241V → L in CAJ18551. 1 PublicationCurated
Sequence conflicti24 – 241V → L in AAH29254. (PubMed:15489334)Curated
Sequence conflicti92 – 921K → N in BAE36843. (PubMed:16141072)Curated
Sequence conflicti104 – 1041T → A in CAJ18551. 1 PublicationCurated
Sequence conflicti104 – 1041T → A in AAH29254. (PubMed:15489334)Curated
Sequence conflicti194 – 1941A → T in BAE29991. (PubMed:16141072)Curated
Sequence conflicti221 – 2211K → E in BAE31471. (PubMed:16141072)Curated
Sequence conflicti227 – 2271I → M in AAB08705. (PubMed:1370315)Curated
Sequence conflicti227 – 2271I → M in AAA37404. (PubMed:1281194)Curated
Sequence conflicti227 – 2271I → M in CAC29430. (PubMed:11172023)Curated
Sequence conflicti227 – 2271I → M in BAC40978. (PubMed:16141072)Curated
Sequence conflicti227 – 2271I → M in BAE33789. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei166 – 20338SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. CuratedVSP_006474Add
BLAST
Alternative sequencei187 – 21630GLKSR…FLYIK → E in isoform V. CuratedVSP_006476Add
BLAST
Alternative sequencei204 – 28986Missing in isoform II. CuratedVSP_006475Add
BLAST
Alternative sequencei216 – 23419KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. CuratedVSP_006477Add
BLAST
Alternative sequencei216 – 2227KKVVKKP → SGQETKG in isoform IV. CuratedVSP_006479
Alternative sequencei223 – 28967Missing in isoform IV. CuratedVSP_006480Add
BLAST
Alternative sequencei235 – 28955Missing in isoform III. CuratedVSP_006478Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA. Translation: AAB08705.1.
M94126
, M94129, M94128, M94127 Genomic DNA. Translation: AAA37404.1.
AJ401387 mRNA. Translation: CAC29427.1.
AJ401388 mRNA. Translation: CAC29428.1.
AJ401389 mRNA. Translation: CAC29429.1.
AJ401390 mRNA. Translation: CAC29430.1.
AK089861 mRNA. Translation: BAC40978.1.
AK150959 mRNA. Translation: BAE29991.1.
AK152716 mRNA. Translation: BAE31440.1.
AK152756 mRNA. Translation: BAE31471.1.
AK152942 mRNA. Translation: BAE31613.1.
AK156644 mRNA. Translation: BAE33789.1.
AK161978 mRNA. Translation: BAE36663.1.
AK162305 mRNA. Translation: BAE36843.1.
CT010343 mRNA. Translation: CAJ18551.1.
AL591495, AL591411 Genomic DNA. Translation: CAM26470.1.
BC029254 mRNA. Translation: AAH29254.1.
CCDSiCCDS17069.1. [P27512-1]
CCDS17070.1. [P27512-5]
CCDS17071.1. [P27512-2]
PIRiA46476.
RefSeqiNP_035741.2. NM_011611.2. [P27512-1]
NP_733803.2. NM_170702.2. [P27512-5]
NP_733804.1. NM_170703.2. [P27512-2]
NP_733805.1. NM_170704.2. [P27512-4]
XP_006499216.1. XM_006499153.1. [P27512-1]
UniGeneiMm.271833.

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652. [P27512-3]
GeneIDi21939.
KEGGimmu:21939.
UCSCiuc008nwx.1. mouse. [P27512-5]
uc008nwy.1. mouse. [P27512-1]
uc008nwz.1. mouse. [P27512-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA. Translation: AAB08705.1 .
M94126
, M94129 , M94128 , M94127 Genomic DNA. Translation: AAA37404.1 .
AJ401387 mRNA. Translation: CAC29427.1 .
AJ401388 mRNA. Translation: CAC29428.1 .
AJ401389 mRNA. Translation: CAC29429.1 .
AJ401390 mRNA. Translation: CAC29430.1 .
AK089861 mRNA. Translation: BAC40978.1 .
AK150959 mRNA. Translation: BAE29991.1 .
AK152716 mRNA. Translation: BAE31440.1 .
AK152756 mRNA. Translation: BAE31471.1 .
AK152942 mRNA. Translation: BAE31613.1 .
AK156644 mRNA. Translation: BAE33789.1 .
AK161978 mRNA. Translation: BAE36663.1 .
AK162305 mRNA. Translation: BAE36843.1 .
CT010343 mRNA. Translation: CAJ18551.1 .
AL591495 , AL591411 Genomic DNA. Translation: CAM26470.1 .
BC029254 mRNA. Translation: AAH29254.1 .
CCDSi CCDS17069.1. [P27512-1 ]
CCDS17070.1. [P27512-5 ]
CCDS17071.1. [P27512-2 ]
PIRi A46476.
RefSeqi NP_035741.2. NM_011611.2. [P27512-1 ]
NP_733803.2. NM_170702.2. [P27512-5 ]
NP_733804.1. NM_170703.2. [P27512-2 ]
NP_733805.1. NM_170704.2. [P27512-4 ]
XP_006499216.1. XM_006499153.1. [P27512-1 ]
UniGenei Mm.271833.

3D structure databases

ProteinModelPortali P27512.
SMRi P27512. Positions 26-187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204251. 19 interactions.
DIPi DIP-33295N.
IntActi P27512. 3 interactions.
MINTi MINT-1506277.

PTM databases

PhosphoSitei P27512.

Proteomic databases

MaxQBi P27512.
PaxDbi P27512.
PRIDEi P27512.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000017799 ; ENSMUSP00000017799 ; ENSMUSG00000017652 . [P27512-1 ]
ENSMUST00000073707 ; ENSMUSP00000073386 ; ENSMUSG00000017652 . [P27512-5 ]
ENSMUST00000081310 ; ENSMUSP00000080059 ; ENSMUSG00000017652 . [P27512-2 ]
ENSMUST00000184221 ; ENSMUSP00000139193 ; ENSMUSG00000017652 . [P27512-3 ]
GeneIDi 21939.
KEGGi mmu:21939.
UCSCi uc008nwx.1. mouse. [P27512-5 ]
uc008nwy.1. mouse. [P27512-1 ]
uc008nwz.1. mouse. [P27512-4 ]

Organism-specific databases

CTDi 958.
MGIi MGI:88336. Cd40.

Phylogenomic databases

eggNOGi NOG28193.
GeneTreei ENSGT00760000119204.
HOVERGENi HBG005117.
InParanoidi P27512.
KOi K03160.
OMAi EKCHPWT.
OrthoDBi EOG786H2Q.
PhylomeDBi P27512.
TreeFami TF331157.

Enzyme and pathway databases

Reactomei REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

NextBioi 301554.
PROi P27512.
SOURCEi Search...

Gene expression databases

Bgeei P27512.
CleanExi MM_CD40.
ExpressionAtlasi P27512. baseline and differential.
Genevestigatori P27512.

Family and domain databases

InterProi IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR020435. TNFR_5.
[Graphical view ]
Pfami PF00020. TNFR_c6. 1 hit.
[Graphical view ]
PRINTSi PR01922. TNFACTORR5.
SMARTi SM00208. TNFR. 4 hits.
[Graphical view ]
PROSITEi PS00652. TNFR_NGFR_1. 1 hit.
PS50050. TNFR_NGFR_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Differential increase of an alternatively polyadenylated mRNA species of murine CD40 upon B lymphocyte activation."
    Torres R.M., Clark E.A.
    J. Immunol. 148:620-626(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM I).
    Strain: BALB/c.
  2. Torres R.M.
    Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Genomic structure and chromosomal mapping of the murine CD40 gene."
    Grimaldi J.C., Torres R., Kozak C.A., Chang R., Clark E.A., Howard M., Cockayne D.A.
    J. Immunol. 149:3921-3926(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM I).
    Strain: BALB/c.
    Tissue: Liver.
  4. "Regulation of CD40 function by its isoforms generated through alternative splicing."
    Tone M., Tone Y., Fairchild P.J., Wykes M., Waldmann H.
    Proc. Natl. Acad. Sci. U.S.A. 98:1751-1756(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS II; III; IV AND V).
  5. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow macrophage, Cerebellum, Colon and Spleen.
  6. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
    Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
    Strain: Czech II.
    Tissue: Mammary tumor.
  9. "Involvement of CRAF1, a relative of TRAF, in CD40 signaling."
    Cheng G., Cleary A.M., Ye Z.S., Hong D.I., Lederman S., Baltimore D.
    Science 267:1494-1498(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF3.
  10. "TRAF5, a novel tumor necrosis factor receptor-associated factor family protein, mediates CD40 signaling."
    Ishida T., Tojo T., Aoki T., Kobayashi N., Ohishi T., Watanabe T., Yamamoto T., Inoue J.
    Proc. Natl. Acad. Sci. U.S.A. 93:9437-9442(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF5.
  11. "Tpl2 transduces CD40 and TNF signals that activate ERK and regulates IgE induction by CD40."
    Eliopoulos A.G., Wang C.C., Dumitru C.D., Tsichlis P.N.
    EMBO J. 22:3855-3864(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MAP3K8 AND TRAF6.

Entry informationi

Entry nameiTNR5_MOUSE
AccessioniPrimary (citable) accession number: P27512
Secondary accession number(s): Q3TS33
, Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 26, 2008
Last modified: October 29, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3