Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 5

Gene

Cd40

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-MMU-5668541. TNFR2 non-canonical NF-kB pathway.
R-MMU-5676594. TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 5
Alternative name(s):
B-cell surface antigen CD40
Bp50
CD40L receptor
CD_antigen: CD40
Gene namesi
Name:Cd40
Synonyms:Tnfrsf5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:88336. Cd40.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 193ExtracellularSequence analysisAdd BLAST174
Transmembranei194 – 215HelicalSequence analysisAdd BLAST22
Topological domaini216 – 289CytoplasmicSequence analysisAdd BLAST74

GO - Cellular componenti

  • CD40 receptor complex Source: BHF-UCL
  • cell surface Source: MGI
  • cytoplasm Source: Ensembl
  • external side of plasma membrane Source: MGI
  • extracellular exosome Source: MGI
  • extracellular space Source: Ensembl
  • intracellular membrane-bounded organelle Source: MGI
  • plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000003456020 – 289Tumor necrosis factor receptor superfamily member 5Add BLAST270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi26 ↔ 37PROSITE-ProRule annotation
Disulfide bondi38 ↔ 51PROSITE-ProRule annotation
Disulfide bondi41 ↔ 59PROSITE-ProRule annotation
Disulfide bondi62 ↔ 77PROSITE-ProRule annotation
Disulfide bondi83 ↔ 103PROSITE-ProRule annotation
Disulfide bondi105 ↔ 119PROSITE-ProRule annotation
Disulfide bondi111 ↔ 116PROSITE-ProRule annotation
Disulfide bondi125 ↔ 143PROSITE-ProRule annotation
Glycosylationi153N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP27512.
PaxDbiP27512.
PeptideAtlasiP27512.
PRIDEiP27512.

PTM databases

iPTMnetiP27512.
PhosphoSitePlusiP27512.

Expressioni

Gene expression databases

BgeeiENSMUSG00000017652.
CleanExiMM_CD40.
ExpressionAtlasiP27512. baseline and differential.
GenevisibleiP27512. MM.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 (By similarity). Interacts with TRAF3 and TRAF5. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BtkP359913EBI-525742,EBI-625119
Traf6P701962EBI-525742,EBI-448028

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204251. 18 interactors.
DIPiDIP-33295N.
IntActiP27512. 3 interactors.
MINTiMINT-1506277.
STRINGi10090.ENSMUSP00000017799.

Structurei

3D structure databases

ProteinModelPortaliP27512.
SMRiP27512.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati25 – 60TNFR-Cys 1Add BLAST36
Repeati61 – 103TNFR-Cys 2Add BLAST43
Repeati104 – 144TNFR-Cys 3Add BLAST41
Repeati145 – 187TNFR-Cys 4Add BLAST43

Sequence similaritiesi

Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IY0H. Eukaryota.
ENOG4112DB5. LUCA.
GeneTreeiENSGT00760000119204.
HOVERGENiHBG005117.
InParanoidiP27512.
KOiK03160.
OMAiEKCHPWT.
OrthoDBiEOG091G03XW.
PhylomeDBiP27512.
TreeFamiTF331157.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR020435. TNFR_5.
[Graphical view]
PfamiPF00020. TNFR_c6. 1 hit.
[Graphical view]
PRINTSiPR01922. TNFACTORR5.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 1 hit.
PS50050. TNFR_NGFR_2. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform I (identifier: P27512-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH
60 70 80 90 100
CTALEKTQCH PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD
110 120 130 140 150
TVCTCKEGQH CTSKDCEACA QHTPCIPGFG VMEMATETTD TVCHPCPVGF
160 170 180 190 200
FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS QTNVICGLKS RMRALLVIPV
210 220 230 240 250
VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM EDYPGHNTAA
260 270 280
PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV
Length:289
Mass (Da):32,093
Last modified:February 26, 2008 - v3
Checksum:iC7970DAD2FEA534A
GO
Isoform II (identifier: P27512-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
     204-289: Missing.

Show »
Length:203
Mass (Da):22,468
Checksum:i0C4C94E7CC426202
GO
Isoform III (identifier: P27512-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
     235-289: Missing.

Show »
Length:234
Mass (Da):25,747
Checksum:i00DB1DD38347E325
GO
Isoform IV (identifier: P27512-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-222: KKVVKKP → SGQETKG
     223-289: Missing.

Show »
Length:222
Mass (Da):24,499
Checksum:iEE21E6C76FB42DEF
GO
Isoform V (identifier: P27512-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

Show »
Length:260
Mass (Da):28,878
Checksum:i57A37C0E8CF2F142
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti21G → W in BAE31440 (PubMed:16141072).Curated1
Sequence conflicti24V → L in CAJ18551 (Ref. 6) Curated1
Sequence conflicti24V → L in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti92K → N in BAE36843 (PubMed:16141072).Curated1
Sequence conflicti104T → A in CAJ18551 (Ref. 6) Curated1
Sequence conflicti104T → A in AAH29254 (PubMed:15489334).Curated1
Sequence conflicti194A → T in BAE29991 (PubMed:16141072).Curated1
Sequence conflicti221K → E in BAE31471 (PubMed:16141072).Curated1
Sequence conflicti227I → M in AAB08705 (PubMed:1370315).Curated1
Sequence conflicti227I → M in AAA37404 (PubMed:1281194).Curated1
Sequence conflicti227I → M in CAC29430 (PubMed:11172023).Curated1
Sequence conflicti227I → M in BAC40978 (PubMed:16141072).Curated1
Sequence conflicti227I → M in BAE33789 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006474166 – 203SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. CuratedAdd BLAST38
Alternative sequenceiVSP_006476187 – 216GLKSR…FLYIK → E in isoform V. CuratedAdd BLAST30
Alternative sequenceiVSP_006475204 – 289Missing in isoform II. CuratedAdd BLAST86
Alternative sequenceiVSP_006477216 – 234KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. CuratedAdd BLAST19
Alternative sequenceiVSP_006479216 – 222KKVVKKP → SGQETKG in isoform IV. Curated7
Alternative sequenceiVSP_006480223 – 289Missing in isoform IV. CuratedAdd BLAST67
Alternative sequenceiVSP_006478235 – 289Missing in isoform III. CuratedAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA. Translation: AAB08705.1.
M94126
, M94129, M94128, M94127 Genomic DNA. Translation: AAA37404.1.
AJ401387 mRNA. Translation: CAC29427.1.
AJ401388 mRNA. Translation: CAC29428.1.
AJ401389 mRNA. Translation: CAC29429.1.
AJ401390 mRNA. Translation: CAC29430.1.
AK089861 mRNA. Translation: BAC40978.1.
AK150959 mRNA. Translation: BAE29991.1.
AK152716 mRNA. Translation: BAE31440.1.
AK152756 mRNA. Translation: BAE31471.1.
AK152942 mRNA. Translation: BAE31613.1.
AK156644 mRNA. Translation: BAE33789.1.
AK161978 mRNA. Translation: BAE36663.1.
AK162305 mRNA. Translation: BAE36843.1.
CT010343 mRNA. Translation: CAJ18551.1.
AL591495, AL591411 Genomic DNA. Translation: CAM26470.1.
BC029254 mRNA. Translation: AAH29254.1.
CCDSiCCDS17069.1. [P27512-1]
CCDS17070.1. [P27512-5]
CCDS17071.1. [P27512-2]
PIRiA46476.
RefSeqiNP_035741.2. NM_011611.2. [P27512-1]
NP_733803.2. NM_170702.2. [P27512-5]
NP_733804.1. NM_170703.2. [P27512-2]
NP_733805.1. NM_170704.2. [P27512-4]
UniGeneiMm.271833.

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652. [P27512-3]
GeneIDi21939.
KEGGimmu:21939.
UCSCiuc008nwx.1. mouse. [P27512-5]
uc008nwy.1. mouse. [P27512-1]
uc008nwz.1. mouse. [P27512-4]
uc008nxb.1. mouse. [P27512-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83312 mRNA. Translation: AAB08705.1.
M94126
, M94129, M94128, M94127 Genomic DNA. Translation: AAA37404.1.
AJ401387 mRNA. Translation: CAC29427.1.
AJ401388 mRNA. Translation: CAC29428.1.
AJ401389 mRNA. Translation: CAC29429.1.
AJ401390 mRNA. Translation: CAC29430.1.
AK089861 mRNA. Translation: BAC40978.1.
AK150959 mRNA. Translation: BAE29991.1.
AK152716 mRNA. Translation: BAE31440.1.
AK152756 mRNA. Translation: BAE31471.1.
AK152942 mRNA. Translation: BAE31613.1.
AK156644 mRNA. Translation: BAE33789.1.
AK161978 mRNA. Translation: BAE36663.1.
AK162305 mRNA. Translation: BAE36843.1.
CT010343 mRNA. Translation: CAJ18551.1.
AL591495, AL591411 Genomic DNA. Translation: CAM26470.1.
BC029254 mRNA. Translation: AAH29254.1.
CCDSiCCDS17069.1. [P27512-1]
CCDS17070.1. [P27512-5]
CCDS17071.1. [P27512-2]
PIRiA46476.
RefSeqiNP_035741.2. NM_011611.2. [P27512-1]
NP_733803.2. NM_170702.2. [P27512-5]
NP_733804.1. NM_170703.2. [P27512-2]
NP_733805.1. NM_170704.2. [P27512-4]
UniGeneiMm.271833.

3D structure databases

ProteinModelPortaliP27512.
SMRiP27512.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204251. 18 interactors.
DIPiDIP-33295N.
IntActiP27512. 3 interactors.
MINTiMINT-1506277.
STRINGi10090.ENSMUSP00000017799.

PTM databases

iPTMnetiP27512.
PhosphoSitePlusiP27512.

Proteomic databases

MaxQBiP27512.
PaxDbiP27512.
PeptideAtlasiP27512.
PRIDEiP27512.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652. [P27512-3]
GeneIDi21939.
KEGGimmu:21939.
UCSCiuc008nwx.1. mouse. [P27512-5]
uc008nwy.1. mouse. [P27512-1]
uc008nwz.1. mouse. [P27512-4]
uc008nxb.1. mouse. [P27512-2]

Organism-specific databases

CTDi958.
MGIiMGI:88336. Cd40.

Phylogenomic databases

eggNOGiENOG410IY0H. Eukaryota.
ENOG4112DB5. LUCA.
GeneTreeiENSGT00760000119204.
HOVERGENiHBG005117.
InParanoidiP27512.
KOiK03160.
OMAiEKCHPWT.
OrthoDBiEOG091G03XW.
PhylomeDBiP27512.
TreeFamiTF331157.

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-MMU-5668541. TNFR2 non-canonical NF-kB pathway.
R-MMU-5676594. TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway.

Miscellaneous databases

PROiP27512.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000017652.
CleanExiMM_CD40.
ExpressionAtlasiP27512. baseline and differential.
GenevisibleiP27512. MM.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR020435. TNFR_5.
[Graphical view]
PfamiPF00020. TNFR_c6. 1 hit.
[Graphical view]
PRINTSiPR01922. TNFACTORR5.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 1 hit.
PS50050. TNFR_NGFR_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTNR5_MOUSE
AccessioniPrimary (citable) accession number: P27512
Secondary accession number(s): Q3TS33
, Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 26, 2008
Last modified: November 30, 2016
This is version 157 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.