Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P27512

- TNR5_MOUSE

UniProt

P27512 - TNR5_MOUSE

Protein

Tumor necrosis factor receptor superfamily member 5

Gene

Cd40

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 3 (26 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.1 Publication

    GO - Molecular functioni

    1. antigen binding Source: Ensembl
    2. protein binding Source: IntAct

    GO - Biological processi

    1. B cell activation Source: MGI
    2. cellular calcium ion homeostasis Source: BHF-UCL
    3. cellular response to lipopolysaccharide Source: Ensembl
    4. cellular response to mechanical stimulus Source: Ensembl
    5. defense response to virus Source: MGI
    6. immune response-regulating cell surface receptor signaling pathway Source: MGI
    7. inflammatory response Source: Ensembl
    8. positive regulation of B cell proliferation Source: MGI
    9. positive regulation of Cdc42 GTPase activity Source: Ensembl
    10. positive regulation of endothelial cell apoptotic process Source: Ensembl
    11. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: Ensembl
    12. positive regulation of interleukin-12 production Source: MGI
    13. positive regulation of isotype switching to IgG isotypes Source: MGI
    14. positive regulation of MAP kinase activity Source: Ensembl
    15. positive regulation of NF-kappaB transcription factor activity Source: Ensembl
    16. positive regulation of protein kinase C signaling Source: Ensembl
    17. positive regulation of Rac GTPase activity Source: Ensembl
    18. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    19. positive regulation of tyrosine phosphorylation of Stat1 protein Source: Ensembl
    20. protein kinase B signaling Source: MGI
    21. regulation of immune response Source: MGI
    22. regulation of immunoglobulin secretion Source: MGI

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Immunity

    Enzyme and pathway databases

    ReactomeiREACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tumor necrosis factor receptor superfamily member 5
    Alternative name(s):
    B-cell surface antigen CD40
    Bp50
    CD40L receptor
    CD_antigen: CD40
    Gene namesi
    Name:Cd40
    Synonyms:Tnfrsf5
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:88336. Cd40.

    Subcellular locationi

    GO - Cellular componenti

    1. CD40 receptor complex Source: BHF-UCL
    2. cell surface Source: MGI
    3. cytoplasm Source: Ensembl
    4. external side of plasma membrane Source: MGI
    5. extracellular space Source: Ensembl
    6. intracellular membrane-bounded organelle Source: MGI
    7. plasma membrane Source: BHF-UCL

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 289270Tumor necrosis factor receptor superfamily member 5PRO_0000034560Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi26 ↔ 37PROSITE-ProRule annotation
    Disulfide bondi38 ↔ 51PROSITE-ProRule annotation
    Disulfide bondi41 ↔ 59PROSITE-ProRule annotation
    Disulfide bondi62 ↔ 77PROSITE-ProRule annotation
    Disulfide bondi83 ↔ 103PROSITE-ProRule annotation
    Disulfide bondi105 ↔ 119PROSITE-ProRule annotation
    Disulfide bondi111 ↔ 116PROSITE-ProRule annotation
    Disulfide bondi125 ↔ 143PROSITE-ProRule annotation
    Glycosylationi153 – 1531N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP27512.
    PRIDEiP27512.

    PTM databases

    PhosphoSiteiP27512.

    Expressioni

    Gene expression databases

    ArrayExpressiP27512.
    BgeeiP27512.
    CleanExiMM_CD40.
    GenevestigatoriP27512.

    Interactioni

    Subunit structurei

    Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 By similarity. Interacts with TRAF3 and TRAF5. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BtkP359913EBI-525742,EBI-625119
    Traf6P701962EBI-525742,EBI-448028

    Protein-protein interaction databases

    BioGridi204251. 17 interactions.
    DIPiDIP-33295N.
    IntActiP27512. 3 interactions.
    MINTiMINT-1506277.

    Structurei

    3D structure databases

    ProteinModelPortaliP27512.
    SMRiP27512. Positions 26-187.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 193174ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini216 – 28974CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei194 – 21522HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati25 – 6036TNFR-Cys 1Add
    BLAST
    Repeati61 – 10343TNFR-Cys 2Add
    BLAST
    Repeati104 – 14441TNFR-Cys 3Add
    BLAST
    Repeati145 – 18743TNFR-Cys 4Add
    BLAST

    Sequence similaritiesi

    Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG28193.
    GeneTreeiENSGT00740000115372.
    HOVERGENiHBG005117.
    InParanoidiP27512.
    KOiK03160.
    OMAiEKCHPWT.
    OrthoDBiEOG786H2Q.
    PhylomeDBiP27512.
    TreeFamiTF331157.

    Family and domain databases

    InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR020435. TNFR_5.
    [Graphical view]
    PfamiPF00020. TNFR_c6. 1 hit.
    [Graphical view]
    PRINTSiPR01922. TNFACTORR5.
    SMARTiSM00208. TNFR. 4 hits.
    [Graphical view]
    PROSITEiPS00652. TNFR_NGFR_1. 1 hit.
    PS50050. TNFR_NGFR_2. 4 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform I (identifier: P27512-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH    50
    CTALEKTQCH PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD 100
    TVCTCKEGQH CTSKDCEACA QHTPCIPGFG VMEMATETTD TVCHPCPVGF 150
    FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS QTNVICGLKS RMRALLVIPV 200
    VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM EDYPGHNTAA 250
    PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV 289
    Length:289
    Mass (Da):32,093
    Last modified:February 26, 2008 - v3
    Checksum:iC7970DAD2FEA534A
    GO
    Isoform II (identifier: P27512-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
         204-289: Missing.

    Show »
    Length:203
    Mass (Da):22,468
    Checksum:i0C4C94E7CC426202
    GO
    Isoform III (identifier: P27512-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
         235-289: Missing.

    Show »
    Length:234
    Mass (Da):25,747
    Checksum:i00DB1DD38347E325
    GO
    Isoform IV (identifier: P27512-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         216-222: KKVVKKP → SGQETKG
         223-289: Missing.

    Show »
    Length:222
    Mass (Da):24,499
    Checksum:iEE21E6C76FB42DEF
    GO
    Isoform V (identifier: P27512-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

    Show »
    Length:260
    Mass (Da):28,878
    Checksum:i57A37C0E8CF2F142
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti21 – 211G → W in BAE31440. (PubMed:16141072)Curated
    Sequence conflicti24 – 241V → L in CAJ18551. 1 PublicationCurated
    Sequence conflicti24 – 241V → L in AAH29254. (PubMed:15489334)Curated
    Sequence conflicti92 – 921K → N in BAE36843. (PubMed:16141072)Curated
    Sequence conflicti104 – 1041T → A in CAJ18551. 1 PublicationCurated
    Sequence conflicti104 – 1041T → A in AAH29254. (PubMed:15489334)Curated
    Sequence conflicti194 – 1941A → T in BAE29991. (PubMed:16141072)Curated
    Sequence conflicti221 – 2211K → E in BAE31471. (PubMed:16141072)Curated
    Sequence conflicti227 – 2271I → M in AAB08705. (PubMed:1370315)Curated
    Sequence conflicti227 – 2271I → M in AAA37404. (PubMed:1281194)Curated
    Sequence conflicti227 – 2271I → M in CAC29430. (PubMed:11172023)Curated
    Sequence conflicti227 – 2271I → M in BAC40978. (PubMed:16141072)Curated
    Sequence conflicti227 – 2271I → M in BAE33789. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei166 – 20338SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. CuratedVSP_006474Add
    BLAST
    Alternative sequencei187 – 21630GLKSR…FLYIK → E in isoform V. CuratedVSP_006476Add
    BLAST
    Alternative sequencei204 – 28986Missing in isoform II. CuratedVSP_006475Add
    BLAST
    Alternative sequencei216 – 23419KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. CuratedVSP_006477Add
    BLAST
    Alternative sequencei216 – 2227KKVVKKP → SGQETKG in isoform IV. CuratedVSP_006479
    Alternative sequencei223 – 28967Missing in isoform IV. CuratedVSP_006480Add
    BLAST
    Alternative sequencei235 – 28955Missing in isoform III. CuratedVSP_006478Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M83312 mRNA. Translation: AAB08705.1.
    M94126
    , M94129, M94128, M94127 Genomic DNA. Translation: AAA37404.1.
    AJ401387 mRNA. Translation: CAC29427.1.
    AJ401388 mRNA. Translation: CAC29428.1.
    AJ401389 mRNA. Translation: CAC29429.1.
    AJ401390 mRNA. Translation: CAC29430.1.
    AK089861 mRNA. Translation: BAC40978.1.
    AK150959 mRNA. Translation: BAE29991.1.
    AK152716 mRNA. Translation: BAE31440.1.
    AK152756 mRNA. Translation: BAE31471.1.
    AK152942 mRNA. Translation: BAE31613.1.
    AK156644 mRNA. Translation: BAE33789.1.
    AK161978 mRNA. Translation: BAE36663.1.
    AK162305 mRNA. Translation: BAE36843.1.
    CT010343 mRNA. Translation: CAJ18551.1.
    AL591495, AL591411 Genomic DNA. Translation: CAM26470.1.
    BC029254 mRNA. Translation: AAH29254.1.
    CCDSiCCDS17069.1. [P27512-1]
    CCDS17070.1. [P27512-5]
    CCDS17071.1. [P27512-2]
    PIRiA46476.
    RefSeqiNP_035741.2. NM_011611.2. [P27512-1]
    NP_733803.2. NM_170702.2. [P27512-5]
    NP_733804.1. NM_170703.2. [P27512-2]
    NP_733805.1. NM_170704.2. [P27512-4]
    XP_006499216.1. XM_006499153.1. [P27512-1]
    UniGeneiMm.271833.

    Genome annotation databases

    EnsembliENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. [P27512-1]
    ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. [P27512-5]
    ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. [P27512-2]
    ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652. [P27512-3]
    GeneIDi21939.
    KEGGimmu:21939.
    UCSCiuc008nwx.1. mouse. [P27512-5]
    uc008nwy.1. mouse. [P27512-1]
    uc008nwz.1. mouse. [P27512-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M83312 mRNA. Translation: AAB08705.1 .
    M94126
    , M94129 , M94128 , M94127 Genomic DNA. Translation: AAA37404.1 .
    AJ401387 mRNA. Translation: CAC29427.1 .
    AJ401388 mRNA. Translation: CAC29428.1 .
    AJ401389 mRNA. Translation: CAC29429.1 .
    AJ401390 mRNA. Translation: CAC29430.1 .
    AK089861 mRNA. Translation: BAC40978.1 .
    AK150959 mRNA. Translation: BAE29991.1 .
    AK152716 mRNA. Translation: BAE31440.1 .
    AK152756 mRNA. Translation: BAE31471.1 .
    AK152942 mRNA. Translation: BAE31613.1 .
    AK156644 mRNA. Translation: BAE33789.1 .
    AK161978 mRNA. Translation: BAE36663.1 .
    AK162305 mRNA. Translation: BAE36843.1 .
    CT010343 mRNA. Translation: CAJ18551.1 .
    AL591495 , AL591411 Genomic DNA. Translation: CAM26470.1 .
    BC029254 mRNA. Translation: AAH29254.1 .
    CCDSi CCDS17069.1. [P27512-1 ]
    CCDS17070.1. [P27512-5 ]
    CCDS17071.1. [P27512-2 ]
    PIRi A46476.
    RefSeqi NP_035741.2. NM_011611.2. [P27512-1 ]
    NP_733803.2. NM_170702.2. [P27512-5 ]
    NP_733804.1. NM_170703.2. [P27512-2 ]
    NP_733805.1. NM_170704.2. [P27512-4 ]
    XP_006499216.1. XM_006499153.1. [P27512-1 ]
    UniGenei Mm.271833.

    3D structure databases

    ProteinModelPortali P27512.
    SMRi P27512. Positions 26-187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204251. 17 interactions.
    DIPi DIP-33295N.
    IntActi P27512. 3 interactions.
    MINTi MINT-1506277.

    PTM databases

    PhosphoSitei P27512.

    Proteomic databases

    PaxDbi P27512.
    PRIDEi P27512.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000017799 ; ENSMUSP00000017799 ; ENSMUSG00000017652 . [P27512-1 ]
    ENSMUST00000073707 ; ENSMUSP00000073386 ; ENSMUSG00000017652 . [P27512-5 ]
    ENSMUST00000081310 ; ENSMUSP00000080059 ; ENSMUSG00000017652 . [P27512-2 ]
    ENSMUST00000184221 ; ENSMUSP00000139193 ; ENSMUSG00000017652 . [P27512-3 ]
    GeneIDi 21939.
    KEGGi mmu:21939.
    UCSCi uc008nwx.1. mouse. [P27512-5 ]
    uc008nwy.1. mouse. [P27512-1 ]
    uc008nwz.1. mouse. [P27512-4 ]

    Organism-specific databases

    CTDi 958.
    MGIi MGI:88336. Cd40.

    Phylogenomic databases

    eggNOGi NOG28193.
    GeneTreei ENSGT00740000115372.
    HOVERGENi HBG005117.
    InParanoidi P27512.
    KOi K03160.
    OMAi EKCHPWT.
    OrthoDBi EOG786H2Q.
    PhylomeDBi P27512.
    TreeFami TF331157.

    Enzyme and pathway databases

    Reactomei REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

    Miscellaneous databases

    NextBioi 301554.
    PROi P27512.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P27512.
    Bgeei P27512.
    CleanExi MM_CD40.
    Genevestigatori P27512.

    Family and domain databases

    InterProi IPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR020435. TNFR_5.
    [Graphical view ]
    Pfami PF00020. TNFR_c6. 1 hit.
    [Graphical view ]
    PRINTSi PR01922. TNFACTORR5.
    SMARTi SM00208. TNFR. 4 hits.
    [Graphical view ]
    PROSITEi PS00652. TNFR_NGFR_1. 1 hit.
    PS50050. TNFR_NGFR_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Differential increase of an alternatively polyadenylated mRNA species of murine CD40 upon B lymphocyte activation."
      Torres R.M., Clark E.A.
      J. Immunol. 148:620-626(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM I).
      Strain: BALB/c.
    2. Torres R.M.
      Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "Genomic structure and chromosomal mapping of the murine CD40 gene."
      Grimaldi J.C., Torres R., Kozak C.A., Chang R., Clark E.A., Howard M., Cockayne D.A.
      J. Immunol. 149:3921-3926(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM I).
      Strain: BALB/c.
      Tissue: Liver.
    4. "Regulation of CD40 function by its isoforms generated through alternative splicing."
      Tone M., Tone Y., Fairchild P.J., Wykes M., Waldmann H.
      Proc. Natl. Acad. Sci. U.S.A. 98:1751-1756(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS II; III; IV AND V).
    5. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
      Strain: C57BL/6J and NOD.
      Tissue: Bone marrow macrophage, Cerebellum, Colon and Spleen.
    6. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
      Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
      Strain: Czech II.
      Tissue: Mammary tumor.
    9. "Involvement of CRAF1, a relative of TRAF, in CD40 signaling."
      Cheng G., Cleary A.M., Ye Z.S., Hong D.I., Lederman S., Baltimore D.
      Science 267:1494-1498(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRAF3.
    10. "TRAF5, a novel tumor necrosis factor receptor-associated factor family protein, mediates CD40 signaling."
      Ishida T., Tojo T., Aoki T., Kobayashi N., Ohishi T., Watanabe T., Yamamoto T., Inoue J.
      Proc. Natl. Acad. Sci. U.S.A. 93:9437-9442(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRAF5.
    11. "Tpl2 transduces CD40 and TNF signals that activate ERK and regulates IgE induction by CD40."
      Eliopoulos A.G., Wang C.C., Dumitru C.D., Tsichlis P.N.
      EMBO J. 22:3855-3864(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MAP3K8 AND TRAF6.

    Entry informationi

    Entry nameiTNR5_MOUSE
    AccessioniPrimary (citable) accession number: P27512
    Secondary accession number(s): Q3TS33
    , Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1992
    Last sequence update: February 26, 2008
    Last modified: October 1, 2014
    This is version 138 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3