Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P27512 (TNR5_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 136. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tumor necrosis factor receptor superfamily member 5
Alternative name(s):
B-cell surface antigen CD40
Bp50
CD40L receptor
CD_antigen=CD40
Gene names
Name:Cd40
Synonyms:Tnfrsf5
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length289 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Ref.11

Subunit structure

Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 By similarity. Interacts with TRAF3 and TRAF5. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation. Ref.9 Ref.10 Ref.11

Subcellular location

Isoform I: Cell membrane; Single-pass type I membrane protein.

Isoform III: Cell membrane; Single-pass type I membrane protein.

Isoform IV: Cell membrane; Single-pass type I membrane protein.

Isoform V: Cell membrane; Single-pass type I membrane protein.

Isoform II: Secreted.

Sequence similarities

Contains 4 TNFR-Cys repeats.

Ontologies

Keywords
   Biological processImmunity
   Cellular componentCell membrane
Membrane
Secreted
   Coding sequence diversityAlternative splicing
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processB cell activation

Inferred from direct assay PubMed 14594818. Source: MGI

cellular calcium ion homeostasis

Inferred from mutant phenotype PubMed 21410936. Source: BHF-UCL

cellular response to lipopolysaccharide

Inferred from electronic annotation. Source: Ensembl

cellular response to mechanical stimulus

Inferred from electronic annotation. Source: Ensembl

defense response to virus

Inferred from direct assay PubMed 17277142. Source: MGI

immune response-regulating cell surface receptor signaling pathway

Inferred from direct assay PubMed 15240714. Source: MGI

inflammatory response

Inferred from electronic annotation. Source: Ensembl

positive regulation of B cell proliferation

Inferred from direct assay PubMed 10979977PubMed 11894097PubMed 14607964PubMed 8666928PubMed 8920854. Source: MGI

positive regulation of Cdc42 GTPase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of I-kappaB kinase/NF-kappaB signaling

Inferred from electronic annotation. Source: Ensembl

positive regulation of MAP kinase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of NF-kappaB transcription factor activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of Rac GTPase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of endothelial cell apoptotic process

Inferred from electronic annotation. Source: Ensembl

positive regulation of interleukin-12 production

Inferred from direct assay PubMed 15240714. Source: MGI

positive regulation of isotype switching to IgG isotypes

Inferred from direct assay PubMed 12882831. Source: MGI

positive regulation of protein kinase C signaling

Inferred from electronic annotation. Source: Ensembl

positive regulation of transcription from RNA polymerase II promoter

Inferred from electronic annotation. Source: Ensembl

positive regulation of tyrosine phosphorylation of Stat1 protein

Inferred from electronic annotation. Source: Ensembl

regulation of immune response

Inferred from direct assay PubMed 12882831. Source: MGI

regulation of immunoglobulin secretion

Inferred from direct assay PubMed 12958312. Source: MGI

   Cellular_componentCD40 receptor complex

Inferred from direct assay PubMed 20614026. Source: BHF-UCL

cell surface

Inferred from direct assay PubMed 20685650. Source: MGI

cytoplasm

Inferred from electronic annotation. Source: Ensembl

external side of plasma membrane

Inferred from direct assay PubMed 10979977PubMed 14560001PubMed 15240714PubMed 17277142PubMed 18684012PubMed 8566034. Source: MGI

extracellular space

Inferred from electronic annotation. Source: Ensembl

intracellular membrane-bounded organelle

Inferred from direct assay PubMed 16708399. Source: MGI

plasma membrane

Inferred from direct assay PubMed 20614026. Source: BHF-UCL

   Molecular_functionantigen binding

Inferred from electronic annotation. Source: Ensembl

protein binding

Inferred from physical interaction PubMed 21441935PubMed 8910514. Source: IntAct

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform I (identifier: P27512-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform II (identifier: P27512-2)

The sequence of this isoform differs from the canonical sequence as follows:
     166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG
     204-289: Missing.
Isoform III (identifier: P27512-3)

The sequence of this isoform differs from the canonical sequence as follows:
     216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS
     235-289: Missing.
Isoform IV (identifier: P27512-4)

The sequence of this isoform differs from the canonical sequence as follows:
     216-222: KKVVKKP → SGQETKG
     223-289: Missing.
Isoform V (identifier: P27512-5)

The sequence of this isoform differs from the canonical sequence as follows:
     187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 289270Tumor necrosis factor receptor superfamily member 5
PRO_0000034560

Regions

Topological domain20 – 193174Extracellular Potential
Transmembrane194 – 21522Helical; Potential
Topological domain216 – 28974Cytoplasmic Potential
Repeat25 – 6036TNFR-Cys 1
Repeat61 – 10343TNFR-Cys 2
Repeat104 – 14441TNFR-Cys 3
Repeat145 – 18743TNFR-Cys 4

Amino acid modifications

Glycosylation1531N-linked (GlcNAc...) Potential
Disulfide bond26 ↔ 37 By similarity
Disulfide bond38 ↔ 51 By similarity
Disulfide bond41 ↔ 59 By similarity
Disulfide bond62 ↔ 77 By similarity
Disulfide bond83 ↔ 103 By similarity
Disulfide bond105 ↔ 119 By similarity
Disulfide bond111 ↔ 116 By similarity
Disulfide bond125 ↔ 143 By similarity

Natural variations

Alternative sequence166 – 20338SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II.
VSP_006474
Alternative sequence187 – 21630GLKSR…FLYIK → E in isoform V.
VSP_006476
Alternative sequence204 – 28986Missing in isoform II.
VSP_006475
Alternative sequence216 – 23419KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III.
VSP_006477
Alternative sequence216 – 2227KKVVKKP → SGQETKG in isoform IV.
VSP_006479
Alternative sequence223 – 28967Missing in isoform IV.
VSP_006480
Alternative sequence235 – 28955Missing in isoform III.
VSP_006478

Experimental info

Sequence conflict211G → W in BAE31440. Ref.5
Sequence conflict241V → L in CAJ18551. Ref.6
Sequence conflict241V → L in AAH29254. Ref.8
Sequence conflict921K → N in BAE36843. Ref.5
Sequence conflict1041T → A in CAJ18551. Ref.6
Sequence conflict1041T → A in AAH29254. Ref.8
Sequence conflict1941A → T in BAE29991. Ref.5
Sequence conflict2211K → E in BAE31471. Ref.5
Sequence conflict2271I → M in AAB08705. Ref.1
Sequence conflict2271I → M in AAA37404. Ref.3
Sequence conflict2271I → M in CAC29430. Ref.4
Sequence conflict2271I → M in BAC40978. Ref.5
Sequence conflict2271I → M in BAE33789. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform I [UniParc].

Last modified February 26, 2008. Version 3.
Checksum: C7970DAD2FEA534A

FASTA28932,093
        10         20         30         40         50         60 
MVSLPRLCAL WGCLLTAVHL GQCVTCSDKQ YLHDGQCCDL CQPGSRLTSH CTALEKTQCH 

        70         80         90        100        110        120 
PCDSGEFSAQ WNREIRCHQH RHCEPNQGLR VKKEGTAESD TVCTCKEGQH CTSKDCEACA 

       130        140        150        160        170        180 
QHTPCIPGFG VMEMATETTD TVCHPCPVGF FSNQSSLFEK CYPWTSCEDK NLEVLQKGTS 

       190        200        210        220        230        240 
QTNVICGLKS RMRALLVIPV VMGILITIFG VFLYIKKVVK KPKDNEILPP AARRQDPQEM 

       250        260        270        280 
EDYPGHNTAA PVQETLHGCQ PVTQEDGKES RISVQERQVT DSIALRPLV 

« Hide

Isoform II [UniParc].

Checksum: 0C4C94E7CC426202
Show »

FASTA20322,468
Isoform III [UniParc].

Checksum: 00DB1DD38347E325
Show »

FASTA23425,747
Isoform IV [UniParc].

Checksum: EE21E6C76FB42DEF
Show »

FASTA22224,499
Isoform V [UniParc].

Checksum: 57A37C0E8CF2F142
Show »

FASTA26028,878

References

« Hide 'large scale' references
[1]"Differential increase of an alternatively polyadenylated mRNA species of murine CD40 upon B lymphocyte activation."
Torres R.M., Clark E.A.
J. Immunol. 148:620-626(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM I).
Strain: BALB/c.
[2]Torres R.M.
Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"Genomic structure and chromosomal mapping of the murine CD40 gene."
Grimaldi J.C., Torres R., Kozak C.A., Chang R., Clark E.A., Howard M., Cockayne D.A.
J. Immunol. 149:3921-3926(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM I).
Strain: BALB/c.
Tissue: Liver.
[4]"Regulation of CD40 function by its isoforms generated through alternative splicing."
Tone M., Tone Y., Fairchild P.J., Wykes M., Waldmann H.
Proc. Natl. Acad. Sci. U.S.A. 98:1751-1756(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS II; III; IV AND V).
[5]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
Strain: C57BL/6J and NOD.
Tissue: Bone marrow macrophage, Cerebellum, Colon and Spleen.
[6]"Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
[7]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
Strain: Czech II.
Tissue: Mammary tumor.
[9]"Involvement of CRAF1, a relative of TRAF, in CD40 signaling."
Cheng G., Cleary A.M., Ye Z.S., Hong D.I., Lederman S., Baltimore D.
Science 267:1494-1498(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TRAF3.
[10]"TRAF5, a novel tumor necrosis factor receptor-associated factor family protein, mediates CD40 signaling."
Ishida T., Tojo T., Aoki T., Kobayashi N., Ohishi T., Watanabe T., Yamamoto T., Inoue J.
Proc. Natl. Acad. Sci. U.S.A. 93:9437-9442(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TRAF5.
[11]"Tpl2 transduces CD40 and TNF signals that activate ERK and regulates IgE induction by CD40."
Eliopoulos A.G., Wang C.C., Dumitru C.D., Tsichlis P.N.
EMBO J. 22:3855-3864(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH MAP3K8 AND TRAF6.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M83312 mRNA. Translation: AAB08705.1.
M94126 expand/collapse EMBL AC list , M94129, M94128, M94127 Genomic DNA. Translation: AAA37404.1.
AJ401387 mRNA. Translation: CAC29427.1.
AJ401388 mRNA. Translation: CAC29428.1.
AJ401389 mRNA. Translation: CAC29429.1.
AJ401390 mRNA. Translation: CAC29430.1.
AK089861 mRNA. Translation: BAC40978.1.
AK150959 mRNA. Translation: BAE29991.1.
AK152716 mRNA. Translation: BAE31440.1.
AK152756 mRNA. Translation: BAE31471.1.
AK152942 mRNA. Translation: BAE31613.1.
AK156644 mRNA. Translation: BAE33789.1.
AK161978 mRNA. Translation: BAE36663.1.
AK162305 mRNA. Translation: BAE36843.1.
CT010343 mRNA. Translation: CAJ18551.1.
AL591495, AL591411 Genomic DNA. Translation: CAM26470.1.
BC029254 mRNA. Translation: AAH29254.1.
CCDSCCDS17069.1. [P27512-1]
CCDS17070.1. [P27512-5]
CCDS17071.1. [P27512-2]
PIRA46476.
RefSeqNP_035741.2. NM_011611.2. [P27512-1]
NP_733803.2. NM_170702.2. [P27512-5]
NP_733804.1. NM_170703.2. [P27512-2]
NP_733805.1. NM_170704.2. [P27512-4]
XP_006499216.1. XM_006499153.1. [P27512-1]
UniGeneMm.271833.

3D structure databases

ProteinModelPortalP27512.
SMRP27512. Positions 26-187.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204251. 17 interactions.
DIPDIP-33295N.
IntActP27512. 3 interactions.
MINTMINT-1506277.

PTM databases

PhosphoSiteP27512.

Proteomic databases

PaxDbP27512.
PRIDEP27512.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. [P27512-1]
ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. [P27512-5]
ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. [P27512-2]
ENSMUST00000184221; ENSMUSP00000139193; ENSMUSG00000017652. [P27512-3]
GeneID21939.
KEGGmmu:21939.
UCSCuc008nwx.1. mouse. [P27512-5]
uc008nwy.1. mouse. [P27512-1]
uc008nwz.1. mouse. [P27512-4]

Organism-specific databases

CTD958.
MGIMGI:88336. Cd40.

Phylogenomic databases

eggNOGNOG28193.
GeneTreeENSGT00740000115372.
HOVERGENHBG005117.
InParanoidP27512.
KOK03160.
OMAEKCHPWT.
OrthoDBEOG786H2Q.
PhylomeDBP27512.
TreeFamTF331157.

Gene expression databases

ArrayExpressP27512.
BgeeP27512.
CleanExMM_CD40.
GenevestigatorP27512.

Family and domain databases

InterProIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR020435. TNFR_5.
[Graphical view]
PfamPF00020. TNFR_c6. 1 hit.
[Graphical view]
PRINTSPR01922. TNFACTORR5.
SMARTSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEPS00652. TNFR_NGFR_1. 1 hit.
PS50050. TNFR_NGFR_2. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio301554.
PROP27512.
SOURCESearch...

Entry information

Entry nameTNR5_MOUSE
AccessionPrimary (citable) accession number: P27512
Secondary accession number(s): Q3TS33 expand/collapse secondary AC list , Q3TSL2, Q3U799, Q3U7C9, Q3UBH3, Q542B1, Q8K2X6, Q99NE0, Q99NE1, Q99NE2, Q99NE3
Entry history
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 26, 2008
Last modified: July 9, 2014
This is version 136 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot