P27512 (TNR5_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor necrosis factor receptor superfamily member 5 Alternative name(s): B-cell surface antigen CD40 Bp50 CD40L receptor CD_antigen=CD40 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 289 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for TNFSF5/CD40LG. |
| Subunit structure | Monomer and homodimer. Interacts with TRAF1, TRAF2 and TRAF6 By similarity. Interacts with TRAF3 and TRAF5. Ref.9 Ref.10 |
| Subcellular location | Isoform I: Cell membrane; Single-pass type I membrane protein. Isoform III: Cell membrane; Single-pass type I membrane protein. Isoform IV: Cell membrane; Single-pass type I membrane protein. Isoform V: Cell membrane; Single-pass type I membrane protein. |
| Sequence similarities | Contains 4 TNFR-Cys repeats. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Btk | P35991 | 3 | EBI-525742,EBI-625119 | |
| Traf6 | P70196 | 2 | EBI-525742,EBI-448028 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform I (identifier: P27512-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform II (identifier: P27512-2) The sequence of this isoform differs from the canonical sequence as follows: 166-203: SCEDKNLEVL...ALLVIPVVMG → RFKVPDASPA...YQKGGQETKG 204-289: Missing. | ||||||
| Isoform III (identifier: P27512-3) The sequence of this isoform differs from the canonical sequence as follows: 216-234: KKVVKKPKDNEILPPAARR → SECSGEEREGGFSPVEPAS 235-289: Missing. | ||||||
| Isoform IV (identifier: P27512-4) The sequence of this isoform differs from the canonical sequence as follows: 216-222: KKVVKKP → SGQETKG 223-289: Missing. | ||||||
| Isoform V (identifier: P27512-5) The sequence of this isoform differs from the canonical sequence as follows: 187-216: GLKSRMRALLVIPVVMGILITIFGVFLYIK → E |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 289 | 270 | Tumor necrosis factor receptor superfamily member 5 | PRO_0000034560 | |||||||
Regions | |||||||||||
| Topological domain | 20 – 193 | 174 | Extracellular Potential | ||||||||
| Transmembrane | 194 – 215 | 22 | Helical; Potential | ||||||||
| Topological domain | 216 – 289 | 74 | Cytoplasmic Potential | ||||||||
| Repeat | 25 – 60 | 36 | TNFR-Cys 1 | ||||||||
| Repeat | 61 – 103 | 43 | TNFR-Cys 2 | ||||||||
| Repeat | 104 – 144 | 41 | TNFR-Cys 3 | ||||||||
| Repeat | 145 – 187 | 43 | TNFR-Cys 4 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 273 | 1 | Phosphoserine Ref.11 | ||||||||
| Glycosylation | 153 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 26 ↔ 37 | By similarity | |||||||||
| Disulfide bond | 38 ↔ 51 | By similarity | |||||||||
| Disulfide bond | 41 ↔ 59 | By similarity | |||||||||
| Disulfide bond | 62 ↔ 77 | By similarity | |||||||||
| Disulfide bond | 83 ↔ 103 | By similarity | |||||||||
| Disulfide bond | 105 ↔ 119 | By similarity | |||||||||
| Disulfide bond | 111 ↔ 116 | By similarity | |||||||||
| Disulfide bond | 125 ↔ 143 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 166 – 203 | 38 | SCEDK…PVVMG → RFKVPDASPAGHSCRDGHPH HHFRGVSLYQKGGQETKG in isoform II. | VSP_006474 | |||||||
| Alternative sequence | 187 – 216 | 30 | GLKSR…FLYIK → E in isoform V. | VSP_006476 | |||||||
| Alternative sequence | 204 – 289 | 86 | Missing in isoform II. | VSP_006475 | |||||||
| Alternative sequence | 216 – 234 | 19 | KKVVK…PAARR → SECSGEEREGGFSPVEPAS in isoform III. | VSP_006477 | |||||||
| Alternative sequence | 216 – 222 | 7 | KKVVKKP → SGQETKG in isoform IV. | VSP_006479 | |||||||
| Alternative sequence | 223 – 289 | 67 | Missing in isoform IV. | VSP_006480 | |||||||
| Alternative sequence | 235 – 289 | 55 | Missing in isoform III. | VSP_006478 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 21 | 1 | G → W in BAE31440. Ref.5 | ||||||||
| Sequence conflict | 24 | 1 | V → L in CAJ18551. Ref.6 | ||||||||
| Sequence conflict | 24 | 1 | V → L in AAH29254. Ref.8 | ||||||||
| Sequence conflict | 92 | 1 | K → N in BAE36843. Ref.5 | ||||||||
| Sequence conflict | 104 | 1 | T → A in CAJ18551. Ref.6 | ||||||||
| Sequence conflict | 104 | 1 | T → A in AAH29254. Ref.8 | ||||||||
| Sequence conflict | 194 | 1 | A → T in BAE29991. Ref.5 | ||||||||
| Sequence conflict | 221 | 1 | K → E in BAE31471. Ref.5 | ||||||||
| Sequence conflict | 227 | 1 | I → M in AAB08705. Ref.1 | ||||||||
| Sequence conflict | 227 | 1 | I → M in AAA37404. Ref.3 | ||||||||
| Sequence conflict | 227 | 1 | I → M in CAC29430. Ref.4 | ||||||||
| Sequence conflict | 227 | 1 | I → M in BAC40978. Ref.5 | ||||||||
| Sequence conflict | 227 | 1 | I → M in BAE33789. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential increase of an alternatively polyadenylated mRNA species of murine CD40 upon B lymphocyte activation." Torres R.M., Clark E.A. J. Immunol. 148:620-626(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM I). Strain: BALB/c. |
| [2] | Torres R.M. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Genomic structure and chromosomal mapping of the murine CD40 gene." Grimaldi J.C., Torres R., Kozak C.A., Chang R., Clark E.A., Howard M., Cockayne D.A. J. Immunol. 149:3921-3926(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM I). Strain: BALB/c. Tissue: Liver. |
| [4] | "Regulation of CD40 function by its isoforms generated through alternative splicing." Tone M., Tone Y., Fairchild P.J., Wykes M., Waldmann H. Proc. Natl. Acad. Sci. U.S.A. 98:1751-1756(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS II; III; IV AND V). |
| [5] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I). Strain: C57BL/6J and NOD. Tissue: Bone marrow macrophage, Cerebellum, Colon and Spleen. |
| [6] | "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)." Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I). |
| [7] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I). Strain: Czech II. Tissue: Mammary tumor. |
| [9] | "Involvement of CRAF1, a relative of TRAF, in CD40 signaling." Cheng G., Cleary A.M., Ye Z.S., Hong D.I., Lederman S., Baltimore D. Science 267:1494-1498(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRAF3. |
| [10] | "TRAF5, a novel tumor necrosis factor receptor-associated factor family protein, mediates CD40 signaling." Ishida T., Tojo T., Aoki T., Kobayashi N., Ohishi T., Watanabe T., Yamamoto T., Inoue J. Proc. Natl. Acad. Sci. U.S.A. 93:9437-9442(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRAF5. |
| [11] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-273, MASS SPECTROMETRY. Tissue: Macrophage. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M83312 mRNA. Translation: AAB08705.1. M94126 M94127 Genomic DNA. Translation: AAA37404.1.AJ401387 mRNA. Translation: CAC29427.1. AJ401388 mRNA. Translation: CAC29428.1. AJ401389 mRNA. Translation: CAC29429.1. AJ401390 mRNA. Translation: CAC29430.1. AK089861 mRNA. Translation: BAC40978.1. AK150959 mRNA. Translation: BAE29991.1. AK152716 mRNA. Translation: BAE31440.1. AK152756 mRNA. Translation: BAE31471.1. AK152942 mRNA. Translation: BAE31613.1. AK156644 mRNA. Translation: BAE33789.1. AK161978 mRNA. Translation: BAE36663.1. AK162305 mRNA. Translation: BAE36843.1. CT010343 mRNA. Translation: CAJ18551.1. AL591495, AL591411 Genomic DNA. Translation: CAM26470.1. BC029254 mRNA. Translation: AAH29254.1. |
| IPI | IPI00117572. IPI00230174. IPI00230175. IPI00230176. IPI00845784. |
| PIR | A46476. |
| RefSeq | NP_035741.2. NM_011611.2. NP_733803.2. NM_170702.2. NP_733804.1. NM_170703.2. NP_733805.1. NM_170704.2. |
| UniGene | Mm.271833. |
3D structure databases | |
| ProteinModelPortal | P27512. |
| SMR | P27512. Positions 26-187. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P27512. 2 interactions. |
| MINT | MINT-1506277. |
PTM databases | |
| PhosphoSite | P27512. |
Proteomic databases | |
| PaxDb | P27512. |
| PRIDE | P27512. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000017799; ENSMUSP00000017799; ENSMUSG00000017652. ENSMUST00000073707; ENSMUSP00000073386; ENSMUSG00000017652. ENSMUST00000081310; ENSMUSP00000080059; ENSMUSG00000017652. |
| GeneID | 21939. |
| KEGG | mmu:21939. |
| UCSC | uc008nwx.1. mouse. uc008nwy.1. mouse. uc008nwz.1. mouse. |
Organism-specific databases | |
| CTD | 958. |
| MGI | MGI:88336. Cd40. |
Phylogenomic databases | |
| eggNOG | NOG28193. |
| GeneTree | ENSGT00700000104362. |
| HOVERGEN | HBG005117. |
| InParanoid | P27512. |
| KO | K03160. |
| OMA | EKCHPWT. |
Gene expression databases | |
| ArrayExpress | P27512. |
| Bgee | P27512. |
| CleanEx | MM_CD40. |
| Genevestigator | P27512. |
| GermOnline | ENSMUSG00000017652. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001368. TNFR/NGFR_Cys_rich_reg. IPR020435. TNFR_5. [Graphical view] |
| Pfam | PF00020. TNFR_c6. 1 hit. [Graphical view] |
| PRINTS | PR01922. TNFACTORR5. |
| SMART | SM00208. TNFR. 4 hits. [Graphical view] |
| PROSITE | PS00652. TNFR_NGFR_1. 1 hit. PS50050. TNFR_NGFR_2. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 301554. |
| SOURCE | Search... |
Entry information
| Entry name | TNR5_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P27512 Secondary accession number(s): Q3TS33 Q99NE3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
