Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitogen-activated protein kinase 3

Gene

MAPK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.12 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mg2+By similarity

Enzyme regulationi

Phosphorylated by MAP2K1/MEK1 and MAP2K2/MEK2 on Thr-202 and Tyr-204 in response to external stimuli like insulin or NGF. Both phosphorylations are required for activity. This phosphorylation causes dramatic conformational changes, which enable full activation and interaction of MAPK1/ERK2 with its substrates. Dephosphorylated and inactivated by DUSP3, DUSP6 and DUSP9.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei71 – 711ATPPROSITE-ProRule annotation
Active sitei166 – 1661Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi48 – 569ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • MAP kinase activity Source: UniProtKB
  • phosphatase binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Apoptosis, Cell cycle, Host-virus interaction

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.24. 2681.
ReactomeiREACT_1100. Golgi Cisternae Pericentriolar Stack Reorganization.
REACT_111133. Growth hormone receptor signaling.
REACT_115831. ISG15 antiviral mechanism.
REACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
REACT_12436. ERKs are inactivated.
REACT_12599. ERK/MAPK targets.
REACT_1391. ERK1 activation.
REACT_160086. Regulation of actin dynamics for phagocytic cup formation.
REACT_163701. FCERI mediated MAPK activation.
REACT_169168. Senescence-Associated Secretory Phenotype (SASP).
REACT_169325. Oncogene Induced Senescence.
REACT_169436. Oxidative Stress Induced Senescence.
REACT_18334. NCAM signaling for neurite out-growth.
REACT_21326. Activation of the AP-1 family of transcription factors.
REACT_21384. Thrombin signalling through proteinase activated receptors (PARs).
REACT_22272. Signal transduction by L1.
REACT_2232. RNA Polymerase I Promoter Opening.
REACT_25195. Advanced glycosylation endproduct receptor signaling.
REACT_252852. Signaling by FGFR3.
REACT_264487. Regulation of HSF1-mediated heat shock response.
REACT_355144. Negative regulation of FGFR3 signaling.
REACT_355200. Signaling by FGFR2.
REACT_355218. Negative regulation of FGFR1 signaling.
REACT_355227. Negative regulation of FGFR2 signaling.
REACT_355289. Signaling by FGFR1.
REACT_355372. RHO GTPases Activate WASPs and WAVEs.
REACT_355408. Signaling by FGFR4.
REACT_355588. Negative regulation of FGFR4 signaling.
REACT_508. Signal attenuation.
SignaLinkiP27361.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitogen-activated protein kinase 3 (EC:2.7.11.24)
Short name:
MAP kinase 3
Short name:
MAPK 3
Alternative name(s):
ERT2
Extracellular signal-regulated kinase 1
Short name:
ERK-1
Insulin-stimulated MAP2 kinase
MAP kinase isoform p44
Short name:
p44-MAPK
Microtubule-associated protein 2 kinase
p44-ERK1
Gene namesi
Name:MAPK3
Synonyms:ERK1, PRKM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:6877. MAPK3.

Subcellular locationi

  • Cytoplasm
  • Nucleus

  • Note: Autophosphorylation at Thr-207 promotes nuclear localization.

GO - Cellular componenti

  • caveola Source: UniProtKB
  • cytoskeleton Source: UniProtKB
  • cytosol Source: UniProtKB
  • early endosome Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • focal adhesion Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • late endosome Source: UniProtKB
  • microtubule cytoskeleton Source: HPA
  • mitochondrion Source: UniProtKB
  • nuclear envelope Source: BHF-UCL
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • pseudopodium Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30622.

Chemistry

DrugBankiDB01169. Arsenic trioxide.
DB00605. Sulindac.

Polymorphism and mutation databases

BioMutaiMAPK3.
DMDMi232066.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed4 Publications
Chaini2 – 379378Mitogen-activated protein kinase 3PRO_0000186251Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine4 Publications
Modified residuei198 – 1981Phosphothreonine1 Publication
Modified residuei202 – 2021Phosphothreonine; by MAP2K1 and MAP2K23 Publications
Modified residuei204 – 2041Phosphotyrosine; by MAP2K1 and MAP2K25 Publications
Modified residuei207 – 2071Phosphothreonine; by autocatalysis1 Publication

Post-translational modificationi

Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204.By similarity5 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP27361.
PaxDbiP27361.
PRIDEiP27361.

PTM databases

PhosphoSiteiP27361.

Expressioni

Gene expression databases

BgeeiP27361.
CleanExiHS_MAPK3.
ExpressionAtlasiP27361. baseline.
GenevisibleiP27361. HS.

Organism-specific databases

HPAiCAB002683.
HPA003995.
HPA005700.
HPA030069.

Interactioni

Subunit structurei

Binds both upstream activators and downstream substrates in multimolecular complexes. Found in a complex with at least BRAF, HRAS, MAP2K1/MEK1, MAPK3 and RGS14 (By similarity). Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity. Interacts with ADAM15, ARRB2, CANX, DAPK1 (via death domain), HSF4, IER3, MAP2K1/MEK1, MORG1, NISCH, and SGK1. Interacts with PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with TPR. Interacts with CDKN2AIP.By similarity13 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DAPK1P533555EBI-73995,EBI-358616
DHPSP493662EBI-73995,EBI-741925
DUSP1P285625EBI-73995,EBI-975493
ELK1P194192EBI-73995,EBI-726632
MAP2K1Q027502EBI-73995,EBI-492564
MAPK1P284823EBI-73995,EBI-959949
MAPK14Q165395EBI-73995,EBI-73946
NsmfQ9EPI62EBI-73995,EBI-6899705From a different organism.
PKMP14618-13EBI-73995,EBI-4304679
PNKDQ8N4904EBI-73995,EBI-746368
PTPRBP234672EBI-73995,EBI-1265766
PTPRJQ129135EBI-73995,EBI-2264500
PtprrQ621323EBI-73995,EBI-6954051From a different organism.
RPS6KA2Q153492EBI-73995,EBI-1384149
SCRIBQ141602EBI-73995,EBI-357345

Protein-protein interaction databases

BioGridi111581. 130 interactions.
DIPiDIP-30985N.
IntActiP27361. 60 interactions.
MINTiMINT-99599.
STRINGi9606.ENSP00000263025.

Structurei

Secondary structure

1
379
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi29 – 313Combined sources
Beta strandi34 – 363Combined sources
Turni39 – 413Combined sources
Beta strandi42 – 5110Combined sources
Beta strandi54 – 618Combined sources
Turni62 – 654Combined sources
Beta strandi66 – 738Combined sources
Helixi79 – 9416Combined sources
Beta strandi105 – 1073Combined sources
Turni112 – 1143Combined sources
Beta strandi118 – 1225Combined sources
Beta strandi126 – 1283Combined sources
Helixi129 – 1357Combined sources
Helixi140 – 15920Combined sources
Helixi169 – 1713Combined sources
Beta strandi172 – 1743Combined sources
Beta strandi180 – 1823Combined sources
Helixi193 – 1953Combined sources
Helixi208 – 2103Combined sources
Helixi213 – 2153Combined sources
Turni216 – 2183Combined sources
Helixi225 – 24016Combined sources
Helixi250 – 26112Combined sources
Helixi266 – 2694Combined sources
Helixi275 – 2828Combined sources
Helixi292 – 2954Combined sources
Helixi301 – 31010Combined sources
Helixi315 – 3173Combined sources
Helixi321 – 3255Combined sources
Helixi328 – 3303Combined sources
Turni331 – 3333Combined sources
Helixi336 – 3383Combined sources
Helixi350 – 3545Combined sources
Helixi357 – 36812Combined sources
Helixi369 – 3713Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2ZOQX-ray2.39A/B1-379[»]
4QTBX-ray1.40A/B1-379[»]
ProteinModelPortaliP27361.
SMRiP27361. Positions 24-374.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP27361.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini42 – 330289Protein kinasePROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi202 – 2043TXY

Domaini

The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.1 Publication

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00550000074298.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiP27361.
KOiK04371.
OMAiQETAPFQ.
OrthoDBiEOG7M3J0K.
PhylomeDBiP27361.
TreeFamiTF105097.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR003527. MAP_kinase_CS.
IPR008349. MAPK_ERK1/2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
PRINTSiPR01770. ERK1ERK2MAPK.
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS01351. MAPK. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P27361-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAAQGGG GGEPRRTEGV GPGVPGEVEM VKGQPFDVGP RYTQLQYIGE
60 70 80 90 100
GAYGMVSSAY DHVRKTRVAI KKISPFEHQT YCQRTLREIQ ILLRFRHENV
110 120 130 140 150
IGIRDILRAS TLEAMRDVYI VQDLMETDLY KLLKSQQLSN DHICYFLYQI
160 170 180 190 200
LRGLKYIHSA NVLHRDLKPS NLLINTTCDL KICDFGLARI ADPEHDHTGF
210 220 230 240 250
LTEYVATRWY RAPEIMLNSK GYTKSIDIWS VGCILAEMLS NRPIFPGKHY
260 270 280 290 300
LDQLNHILGI LGSPSQEDLN CIINMKARNY LQSLPSKTKV AWAKLFPKSD
310 320 330 340 350
SKALDLLDRM LTFNPNKRIT VEEALAHPYL EQYYDPTDEP VAEEPFTFAM
360 370
ELDDLPKERL KELIFQETAR FQPGVLEAP
Length:379
Mass (Da):43,136
Last modified:January 23, 2007 - v4
Checksum:iE6020CE413EC41F7
GO
Isoform 2 (identifier: P27361-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-302: Missing.

Show »
Length:335
Mass (Da):38,275
Checksum:i54DA760A09F1F2F5
GO
Isoform 3 (identifier: P27361-3) [UniParc]FASTAAdd to basket

Also known as: ERK1b

The sequence of this isoform differs from the canonical sequence as follows:
     340-379: PVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP → VGQSPAAVGLGAGEQGGT

Show »
Length:357
Mass (Da):40,088
Checksum:iF2C6D29C623AC072
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti174 – 1741I → S in CAA42744 (PubMed:7687743).Curated
Sequence conflicti174 – 1741I → S in AAK52329 (Ref. 2) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti323 – 3231E → K.1 Publication
Corresponds to variant rs55859133 [ dbSNP | Ensembl ].
VAR_042253

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei259 – 30244Missing in isoform 2. 1 PublicationVSP_041906Add
BLAST
Alternative sequencei340 – 37940PVAEE…VLEAP → VGQSPAAVGLGAGEQGGT in isoform 3. 1 PublicationVSP_041907Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60188 mRNA. Translation: CAA42744.1.
AY033607 mRNA. Translation: AAK52329.1.
DQ399291 mRNA. Translation: ABD60302.1.
EU332853 Genomic DNA. Translation: ABY87542.1.
AC012645 Genomic DNA. No translation available.
CH471238 Genomic DNA. Translation: EAW79912.1.
CH471238 Genomic DNA. Translation: EAW79915.1.
BC013992 mRNA. Translation: AAH13992.1.
M84490 mRNA. Translation: AAA36142.1.
Z11696 mRNA. Translation: CAA77754.1.
CCDSiCCDS10672.1. [P27361-1]
CCDS42148.1. [P27361-2]
CCDS42149.1. [P27361-3]
PIRiA48082.
RefSeqiNP_001035145.1. NM_001040056.2. [P27361-3]
NP_001103361.1. NM_001109891.1. [P27361-2]
NP_002737.2. NM_002746.2. [P27361-1]
UniGeneiHs.861.

Genome annotation databases

EnsembliENST00000263025; ENSP00000263025; ENSG00000102882. [P27361-1]
ENST00000322266; ENSP00000327293; ENSG00000102882. [P27361-2]
ENST00000395199; ENSP00000378625; ENSG00000102882. [P27361-3]
ENST00000395202; ENSP00000378628; ENSG00000102882. [P27361-2]
GeneIDi5595.
KEGGihsa:5595.
UCSCiuc002dwr.3. human. [P27361-1]
uc002dwt.3. human. [P27361-3]
uc002dwv.4. human. [P27361-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60188 mRNA. Translation: CAA42744.1.
AY033607 mRNA. Translation: AAK52329.1.
DQ399291 mRNA. Translation: ABD60302.1.
EU332853 Genomic DNA. Translation: ABY87542.1.
AC012645 Genomic DNA. No translation available.
CH471238 Genomic DNA. Translation: EAW79912.1.
CH471238 Genomic DNA. Translation: EAW79915.1.
BC013992 mRNA. Translation: AAH13992.1.
M84490 mRNA. Translation: AAA36142.1.
Z11696 mRNA. Translation: CAA77754.1.
CCDSiCCDS10672.1. [P27361-1]
CCDS42148.1. [P27361-2]
CCDS42149.1. [P27361-3]
PIRiA48082.
RefSeqiNP_001035145.1. NM_001040056.2. [P27361-3]
NP_001103361.1. NM_001109891.1. [P27361-2]
NP_002737.2. NM_002746.2. [P27361-1]
UniGeneiHs.861.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2ZOQX-ray2.39A/B1-379[»]
4QTBX-ray1.40A/B1-379[»]
ProteinModelPortaliP27361.
SMRiP27361. Positions 24-374.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111581. 130 interactions.
DIPiDIP-30985N.
IntActiP27361. 60 interactions.
MINTiMINT-99599.
STRINGi9606.ENSP00000263025.

Chemistry

BindingDBiP27361.
ChEMBLiCHEMBL1907606.
DrugBankiDB01169. Arsenic trioxide.
DB00605. Sulindac.
GuidetoPHARMACOLOGYi1494.

PTM databases

PhosphoSiteiP27361.

Polymorphism and mutation databases

BioMutaiMAPK3.
DMDMi232066.

Proteomic databases

MaxQBiP27361.
PaxDbiP27361.
PRIDEiP27361.

Protocols and materials databases

DNASUi5595.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263025; ENSP00000263025; ENSG00000102882. [P27361-1]
ENST00000322266; ENSP00000327293; ENSG00000102882. [P27361-2]
ENST00000395199; ENSP00000378625; ENSG00000102882. [P27361-3]
ENST00000395202; ENSP00000378628; ENSG00000102882. [P27361-2]
GeneIDi5595.
KEGGihsa:5595.
UCSCiuc002dwr.3. human. [P27361-1]
uc002dwt.3. human. [P27361-3]
uc002dwv.4. human. [P27361-2]

Organism-specific databases

CTDi5595.
GeneCardsiGC16M030125.
HGNCiHGNC:6877. MAPK3.
HPAiCAB002683.
HPA003995.
HPA005700.
HPA030069.
MIMi601795. gene.
neXtProtiNX_P27361.
PharmGKBiPA30622.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00550000074298.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiP27361.
KOiK04371.
OMAiQETAPFQ.
OrthoDBiEOG7M3J0K.
PhylomeDBiP27361.
TreeFamiTF105097.

Enzyme and pathway databases

BRENDAi2.7.11.24. 2681.
ReactomeiREACT_1100. Golgi Cisternae Pericentriolar Stack Reorganization.
REACT_111133. Growth hormone receptor signaling.
REACT_115831. ISG15 antiviral mechanism.
REACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
REACT_12436. ERKs are inactivated.
REACT_12599. ERK/MAPK targets.
REACT_1391. ERK1 activation.
REACT_160086. Regulation of actin dynamics for phagocytic cup formation.
REACT_163701. FCERI mediated MAPK activation.
REACT_169168. Senescence-Associated Secretory Phenotype (SASP).
REACT_169325. Oncogene Induced Senescence.
REACT_169436. Oxidative Stress Induced Senescence.
REACT_18334. NCAM signaling for neurite out-growth.
REACT_21326. Activation of the AP-1 family of transcription factors.
REACT_21384. Thrombin signalling through proteinase activated receptors (PARs).
REACT_22272. Signal transduction by L1.
REACT_2232. RNA Polymerase I Promoter Opening.
REACT_25195. Advanced glycosylation endproduct receptor signaling.
REACT_252852. Signaling by FGFR3.
REACT_264487. Regulation of HSF1-mediated heat shock response.
REACT_355144. Negative regulation of FGFR3 signaling.
REACT_355200. Signaling by FGFR2.
REACT_355218. Negative regulation of FGFR1 signaling.
REACT_355227. Negative regulation of FGFR2 signaling.
REACT_355289. Signaling by FGFR1.
REACT_355372. RHO GTPases Activate WASPs and WAVEs.
REACT_355408. Signaling by FGFR4.
REACT_355588. Negative regulation of FGFR4 signaling.
REACT_508. Signal attenuation.
SignaLinkiP27361.

Miscellaneous databases

EvolutionaryTraceiP27361.
GeneWikiiMAPK3.
GenomeRNAii5595.
NextBioi21714.
PROiP27361.
SOURCEiSearch...

Gene expression databases

BgeeiP27361.
CleanExiHS_MAPK3.
ExpressionAtlasiP27361. baseline.
GenevisibleiP27361. HS.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR003527. MAP_kinase_CS.
IPR008349. MAPK_ERK1/2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
PRINTSiPR01770. ERK1ERK2MAPK.
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS01351. MAPK. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, expression, and characterization of the human mitogen-activated protein kinase p44erk1."
    Charest D.L., Jirik F., Harder K., Pelech S.L., Mordret G.
    Mol. Cell. Biol. 13:4679-4690(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hepatoma.
  2. "Properties of human ERK1b."
    Aebersold D.M., Yung Y., Seger R.
    Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Identification of dominant negative Erk1/2 variants in cancer cells."
    Cheng H., Ren S., Qiu R., Wang M., Feng Y.H.
    Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  4. SeattleSNPs variation discovery resource
    Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lymph.
  8. Bienvenut W.V., Dhillon A.S., Kolch W.
    Submitted (FEB-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-15; 33-41; 88-94; 117-131; 212-220; 279-287; 303-318 AND 360-370, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Hepatoma.
  9. "Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs."
    Owaki H., Makar R., Boulton T.G., Cobb M.H., Geppert T.D.
    Biochem. Biophys. Res. Commun. 182:1416-1422(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 14-379 (ISOFORM 1).
  10. "Heterogeneous expression of four MAP kinase isoforms in human tissues."
    Gonzalez F.A., Raden D.L., Rigby M.R., Davis R.J.
    FEBS Lett. 304:170-178(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-379 (ISOFORM 1).
  11. "Serine 25 of oncoprotein 18 is a major cytosolic target for the mitogen-activated protein kinase."
    Marklund U., Brattsand G., Shingler V., Gullberg M.
    J. Biol. Chem. 268:15039-15047(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF STMN1.
  12. "Human immunodeficiency virus type 1 Nef binds directly to LCK and mitogen-activated protein kinase, inhibiting kinase activity."
    Greenway A.L., Azad A., Mills J., McPhee D.A.
    J. Virol. 70:6701-6708(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HIV-1 NEF.
  13. "MNK1, a new MAP kinase-activated protein kinase, isolated by a novel expression screening method for identifying protein kinase substrates."
    Fukunaga R., Hunter T.
    EMBO J. 16:1921-1933(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF MKNK1/MNK1.
  14. "MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase."
    Ni H., Wang X.S., Diener K., Yao Z.
    Biochem. Biophys. Res. Commun. 243:492-496(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF MAPKAPK5.
  15. "Phosphorylation by CK2 and MAPK enhances calnexin association with ribosomes."
    Chevet E., Wong H.N., Gerber D., Cochet C., Fazel A., Cameron P.H., Gushue J.N., Thomas D.Y., Bergeron J.J.
    EMBO J. 18:3655-3666(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF CANX, INTERACTION WITH CANX.
  16. "Extracellular regulated kinases (ERK) 1 and ERK2 are authentic substrates for the dual-specificity protein-tyrosine phosphatase VHR. A novel role in down-regulating the ERK pathway."
    Todd J.L., Tanner K.G., Denu J.M.
    J. Biol. Chem. 274:13271-13280(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEPHOSPHORYLATION BY DUSP3.
  17. "Identification of a cytoplasmic-retention sequence in ERK2."
    Rubinfeld H., Hanoch T., Seger R.
    J. Biol. Chem. 274:30349-30352(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH MAP2K1/MEK1, DOMAIN.
  18. "Reduced MAP kinase phosphatase-1 degradation after p42/p44MAPK-dependent phosphorylation."
    Brondello J.M., Pouyssegur J., McKenzie F.R.
    Science 286:2514-2517(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF DUSP1.
  19. "IEX-1: a new ERK substrate involved in both ERK survival activity and ERK activation."
    Garcia J., Ye Y., Arranz V., Letourneux C., Pezeron G., Porteu F.
    EMBO J. 21:5151-5163(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF IER3, INTERACTION WITH IER3, ENZYME REGULATION.
  20. "Insulin receptor substrate 4 associates with the protein IRAS."
    Sano H., Liu S.C.H., Lane W.S., Piletz J.E., Lienhard G.E.
    J. Biol. Chem. 277:19439-19447(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NISCH.
  21. "Signal transduction via the stem cell factor receptor/c-Kit."
    Ronnstrand L.
    Cell. Mol. Life Sci. 61:2535-2548(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON ROLE IN KIT SIGNALING.
  22. "Phosphorylation of Grb10 by mitogen-activated protein kinase: identification of Ser150 and Ser476 of human Grb10zeta as major phosphorylation sites."
    Langlais P., Wang C., Dong L.Q., Carroll C.A., Weintraub S.T., Liu F.
    Biochemistry 44:8890-8897(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF GRB10.
  23. "Bidirectional signals transduced by DAPK-ERK interaction promote the apoptotic effect of DAPK."
    Chen C.H., Wang W.J., Kuo J.C., Tsai H.C., Lin J.R., Chang Z.F., Chen R.H.
    EMBO J. 24:294-304(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DAPK1.
  24. "Growth factors can activate ATF2 via a two-step mechanism: phosphorylation of Thr71 through the Ras-MEK-ERK pathway and of Thr69 through RalGDS-Src-p38."
    Ouwens D.M., de Ruiter N.D., van der Zon G.C., Carter A.P., Schouten J., van der Burgt C., Kooistra K., Bos J.L., Maassen J.A., van Dam H.
    EMBO J. 21:3782-3793(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF ATF2.
  25. "EGFR and FGFR signaling through FRS2 is subject to negative feedback control by ERK1/2."
    Wu Y., Chen Z., Ullrich A.
    Biol. Chem. 384:1215-1226(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF FRS2.
  26. "Phosphorylation of serine 147 of tis21/BTG2/pc3 by p-Erk1/2 induces Pin-1 binding in cytoplasm and cell death."
    Hong J.W., Ryu M.S., Lim I.K.
    J. Biol. Chem. 280:21256-21263(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF BTG2.
  27. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  28. "Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26."
    Hu Y., Mivechi N.F.
    Mol. Cell. Biol. 26:3282-3294(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HSF4.
  29. "ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation."
    Degoutin J., Vigny M., Gouzi J.Y.
    FEBS Lett. 581:727-734(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION.
  30. "Mutations of beta-arrestin 2 that limit self-association also interfere with interactions with the beta2-adrenoceptor and the ERK1/2 MAPKs: implications for beta2-adrenoceptor signalling via the ERK1/2 MAPKs."
    Xu T.-R., Baillie G.S., Bhari N., Houslay T.M., Pitt A.M., Adams D.R., Kolch W., Houslay M.D., Milligan G.
    Biochem. J. 413:51-60(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ARRB2.
  31. "Distinct functions of natural ADAM-15 cytoplasmic domain variants in human mammary carcinoma."
    Zhong J.L., Poghosyan Z., Pennington C.J., Scott X., Handsley M.M., Warn A., Gavrilovic J., Honert K., Kruger A., Span P.N., Sweep F.C., Edwards D.R.
    Mol. Cancer Res. 6:383-394(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ADAM15.
  32. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  33. "Extracellular signal-regulated kinase 2 (ERK2) phosphorylation sites and docking domain on the nuclear pore complex protein Tpr cooperatively regulate ERK2-Tpr interaction."
    Vomastek T., Iwanicki M.P., Burack W.R., Tiwari D., Kumar D., Parsons J.T., Weber M.J., Nandicoori V.K.
    Mol. Cell. Biol. 28:6954-6966(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TPR.
  34. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  35. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  36. "The D816V mutation of c-Kit circumvents a requirement for Src family kinases in c-Kit signal transduction."
    Sun J., Pedersen M., Ronnstrand L.
    J. Biol. Chem. 284:11039-11047(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN KIT SIGNALING PATHWAY, PHOSPHORYLATION.
  37. "Tumor suppressor density-enhanced phosphatase-1 (DEP-1) inhibits the RAS pathway by direct dephosphorylation of ERK1/2 kinases."
    Sacco F., Tinti M., Palma A., Ferrari E., Nardozza A.P., Hooft van Huijsduijnen R., Takahashi T., Castagnoli L., Cesareni G.
    J. Biol. Chem. 284:22048-22058(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT TYR-204, DEPHOSPHORYLATION AT TYR-204 BY PTPRJ.
  38. "Protein kinase SGK1 enhances MEK/ERK complex formation through the phosphorylation of ERK2: implication for the positive regulatory role of SGK1 on the ERK function during liver regeneration."
    Won M., Park K.A., Byun H.S., Kim Y.R., Choi B.L., Hong J.H., Park J., Seok J.H., Lee Y.H., Cho C.H., Song I.S., Kim Y.K., Shen H.M., Hur G.M.
    J. Hepatol. 51:67-76(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SGK1.
  39. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-198, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  40. "A new type of ERK1/2 autophosphorylation causes cardiac hypertrophy."
    Lorenz K., Schmitt J.P., Schmitteckert E.M., Lohse M.J.
    Nat. Med. 15:75-83(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT THR-207, ENZYME REGULATION, SUBUNIT, SUBCELLULAR LOCATION.
  41. "The extracellular signal-regulated kinase: multiple substrates regulate diverse cellular functions."
    Yoon S., Seger R.
    Growth Factors 24:21-44(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON FUNCTION.
  42. "The ERK signaling cascade--views from different subcellular compartments."
    Yao Z., Seger R.
    BioFactors 35:407-416(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON FUNCTION, REVIEW ON SUBCELLULAR LOCATION.
  43. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  44. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  45. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  46. "The ERK cascade: distinct functions within various subcellular organelles."
    Wortzel I., Seger R.
    Genes Cancer 2:195-209(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON ENZYME REGULATION, REVIEW ON FUNCTION.
  47. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  48. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  49. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  50. "Collaborator of ARF (CARF) regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling."
    Cheung C.T., Singh R., Kalra R.S., Kaul S.C., Wadhwa R.
    J. Biol. Chem. 289:18258-18269(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CDKN2AIP.
  51. Cited for: X-RAY CRYSTALLOGRAPHY (2.39 ANGSTROMS), PHOSPHORYLATION AT TYR-204.
  52. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-323.

Entry informationi

Entry nameiMK03_HUMAN
AccessioniPrimary (citable) accession number: P27361
Secondary accession number(s): A8CZ58, B0LPG3, Q8NHX1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: January 23, 2007
Last modified: June 24, 2015
This is version 179 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.