P27361 (MK03_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 155.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitogen-activated protein kinase 3 Short name=MAP kinase 3 Short name=MAPK 3 EC=2.7.11.24 Alternative name(s): ERT2 Extracellular signal-regulated kinase 1 Short name=ERK-1 Insulin-stimulated MAP2 kinase MAP kinase isoform p44 Short name=p44-MAPK Microtubule-associated protein 2 kinase p44-ERK1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 379 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Ref.11 Ref.13 Ref.14 Ref.15 Ref.18 Ref.19 Ref.22 Ref.24 Ref.25 Ref.26 Ref.28 Ref.35 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Phosphorylated by MAP2K1/MEK1 and MAP2K2/MEK2 on Thr-202 and Tyr-204 in response to external stimuli like insulin or NGF. Both phosphorylations are required for activity. This phosphorylation causes dramatic conformational changes, which enable full activation and interaction of MAPK1/ERK2 with its substrates. Dephosphorylated and inactivated by DUSP3, DUSP6 and DUSP9. Ref.19 Ref.39 |
| Subunit structure | Binds both upstream activators and downstream substrates in multimolecular complexes. Found in a complex with at least BRAF, HRAS1, MAP2K1/MEK1, MAPK3 and RGS14 By similarity. Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity. Interacts with ADAM15, ARRB2, CANX, DAPK1 (via death domain), HSF4, IER3, MAP2K1/MEK1, MORG1, NISCH, and SGK1. Interacts with PEA15 and MKNK2 By similarity. MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation By similarity. Interacts with TPR. Ref.12 Ref.15 Ref.17 Ref.19 Ref.20 Ref.23 Ref.28 Ref.30 Ref.31 Ref.33 Ref.37 Ref.39 |
| Subcellular location | Cytoplasm. Nucleus. Note: Autophosphorylation at Thr-207 promotes nuclear localization. Ref.17 Ref.39 |
| Domain | The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. Ref.17 |
| Post-translational modification | Phosphorylated upon KIT and FLT3 signaling By similarity. Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204. Ref.16 Ref.29 Ref.35 Ref.36 Ref.39 Ref.47 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DAPK1 | P53355 | 4 | EBI-73995,EBI-358616 | |
| SCRIB | Q14160 | 2 | EBI-73995,EBI-357345 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P27361-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P27361-2) The sequence of this isoform differs from the canonical sequence as follows: 259-302: Missing. | ||||||
| Isoform 3 (identifier: P27361-3) Also known as: ERK1b; The sequence of this isoform differs from the canonical sequence as follows: 340-379: PVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP → VGQSPAAVGLGAGEQGGT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 379 | 378 | Mitogen-activated protein kinase 3 | PRO_0000186251 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 42 – 330 | 289 | Protein kinase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 48 – 56 | 9 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 202 – 204 | 3 | TXY | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 166 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 71 | 1 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 170 | 1 | Phosphoserine Ref.38 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 198 | 1 | Phosphothreonine Ref.38 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 202 | 1 | Phosphothreonine; by MAP2K1 and MAP2K2 Ref.34 Ref.42 Ref.46 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 204 | 1 | Phosphotyrosine; by MAP2K1 and MAP2K2 Ref.34 Ref.36 Ref.42 Ref.46 Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 207 | 1 | Phosphothreonine; by autocatalysis Ref.39 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 259 – 302 | 44 | Missing in isoform 2. | VSP_041906 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 340 – 379 | 40 | PVAEE…VLEAP → VGQSPAAVGLGAGEQGGT in isoform 3. | VSP_041907 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 323 | 1 | E → K. Ref.48 Corresponds to variant rs55859133 [ dbSNP | Ensembl ]. | VAR_042253 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 174 | 1 | I → S in CAA42744. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 174 | 1 | I → S in AAK52329. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 39 – 41 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 42 – 49 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 55 – 61 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 62 – 65 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 73 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 79 – 94 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 107 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 112 – 114 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 123 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 128 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 129 – 135 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 140 – 159 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 171 – 174 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 182 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 193 – 195 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 210 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 217 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 240 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 261 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 266 – 268 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 275 – 283 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 295 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 301 – 310 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 315 – 317 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 325 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 328 – 330 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 331 – 333 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 336 – 338 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 354 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 357 – 367 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 369 – 371 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, expression, and characterization of the human mitogen-activated protein kinase p44erk1." Charest D.L., Jirik F., Harder K., Pelech S.L., Mordret G. Mol. Cell. Biol. 13:4679-4690(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hepatoma. |
| [2] | "Properties of human ERK1b." Aebersold D.M., Yung Y., Seger R. Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [3] | "Identification of dominant negative Erk1/2 variants in cancer cells." Cheng H., Ren S., Qiu R., Wang M., Feng Y.H. Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | SeattleSNPs variation discovery resource Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lymph. |
| [8] | Bienvenut W.V., Dhillon A.S., Kolch W. Submitted (FEB-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-15; 33-41; 88-94; 117-131; 212-220; 279-287; 303-318 AND 360-370, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Hepatoma. |
| [9] | "Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs." Owaki H., Makar R., Boulton T.G., Cobb M.H., Geppert T.D. Biochem. Biophys. Res. Commun. 182:1416-1422(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 14-379 (ISOFORM 1). |
| [10] | "Heterogeneous expression of four MAP kinase isoforms in human tissues." Gonzalez F.A., Raden D.L., Rigby M.R., Davis R.J. FEBS Lett. 304:170-178(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-379 (ISOFORM 1). |
| [11] | "Serine 25 of oncoprotein 18 is a major cytosolic target for the mitogen-activated protein kinase." Marklund U., Brattsand G., Shingler V., Gullberg M. J. Biol. Chem. 268:15039-15047(1993) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF STMN1. |
| [12] | "Human immunodeficiency virus type 1 Nef binds directly to LCK and mitogen-activated protein kinase, inhibiting kinase activity." Greenway A.L., Azad A., Mills J., McPhee D.A. J. Virol. 70:6701-6708(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HIV-1 NEF. |
| [13] | "MNK1, a new MAP kinase-activated protein kinase, isolated by a novel expression screening method for identifying protein kinase substrates." Fukunaga R., Hunter T. EMBO J. 16:1921-1933(1997) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MKNK1/MNK1. |
| [14] | "MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase." Ni H., Wang X.S., Diener K., Yao Z. Biochem. Biophys. Res. Commun. 243:492-496(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MAPKAPK5. |
| [15] | "Phosphorylation by CK2 and MAPK enhances calnexin association with ribosomes." Chevet E., Wong H.N., Gerber D., Cochet C., Fazel A., Cameron P.H., Gushue J.N., Thomas D.Y., Bergeron J.J. EMBO J. 18:3655-3666(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF CANX, INTERACTION WITH CANX. |
| [16] | "Extracellular regulated kinases (ERK) 1 and ERK2 are authentic substrates for the dual-specificity protein-tyrosine phosphatase VHR. A novel role in down-regulating the ERK pathway." Todd J.L., Tanner K.G., Denu J.M. J. Biol. Chem. 274:13271-13280(1999) [PubMed] [Europe PMC] [Abstract] Cited for: DEPHOSPHORYLATION BY DUSP3. |
| [17] | "Identification of a cytoplasmic-retention sequence in ERK2." Rubinfeld H., Hanoch T., Seger R. J. Biol. Chem. 274:30349-30352(1999) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH MAP2K1/MEK1, DOMAIN. |
| [18] | "Reduced MAP kinase phosphatase-1 degradation after p42/p44MAPK-dependent phosphorylation." Brondello J.M., Pouyssegur J., McKenzie F.R. Science 286:2514-2517(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF DUSP1. |
| [19] | "IEX-1: a new ERK substrate involved in both ERK survival activity and ERK activation." Garcia J., Ye Y., Arranz V., Letourneux C., Pezeron G., Porteu F. EMBO J. 21:5151-5163(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF IER3, INTERACTION WITH IER3, ENZYME REGULATION. |
| [20] | "Insulin receptor substrate 4 associates with the protein IRAS." Sano H., Liu S.C.H., Lane W.S., Piletz J.E., Lienhard G.E. J. Biol. Chem. 277:19439-19447(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NISCH. |
| [21] | "Signal transduction via the stem cell factor receptor/c-Kit." Ronnstrand L. Cell. Mol. Life Sci. 61:2535-2548(2004) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON ROLE IN KIT SIGNALING. |
| [22] | "Phosphorylation of Grb10 by mitogen-activated protein kinase: identification of Ser150 and Ser476 of human Grb10zeta as major phosphorylation sites." Langlais P., Wang C., Dong L.Q., Carroll C.A., Weintraub S.T., Liu F. Biochemistry 44:8890-8897(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF GRB10. |
| [23] | "Bidirectional signals transduced by DAPK-ERK interaction promote the apoptotic effect of DAPK." Chen C.H., Wang W.J., Kuo J.C., Tsai H.C., Lin J.R., Chang Z.F., Chen R.H. EMBO J. 24:294-304(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DAPK1. |
| [24] | "Growth factors can activate ATF2 via a two-step mechanism: phosphorylation of Thr71 through the Ras-MEK-ERK pathway and of Thr69 through RalGDS-Src-p38." Ouwens D.M., de Ruiter N.D., van der Zon G.C., Carter A.P., Schouten J., van der Burgt C., Kooistra K., Bos J.L., Maassen J.A., van Dam H. EMBO J. 21:3782-3793(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF ATF2. |
| [25] | "EGFR and FGFR signaling through FRS2 is subject to negative feedback control by ERK1/2." Wu Y., Chen Z., Ullrich A. Biol. Chem. 384:1215-1226(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF FRS2. |
| [26] | "Phosphorylation of serine 147 of tis21/BTG2/pc3 by p-Erk1/2 induces Pin-1 binding in cytoplasm and cell death." Hong J.W., Ryu M.S., Lim I.K. J. Biol. Chem. 280:21256-21263(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF BTG2. |
| [27] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [28] | "Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26." Hu Y., Mivechi N.F. Mol. Cell. Biol. 26:3282-3294(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH HSF4. |
| [29] | "ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation." Degoutin J., Vigny M., Gouzi J.Y. FEBS Lett. 581:727-734(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [30] | "Mutations of beta-arrestin 2 that limit self-association also interfere with interactions with the beta2-adrenoceptor and the ERK1/2 MAPKs: implications for beta2-adrenoceptor signalling via the ERK1/2 MAPKs." Xu T.-R., Baillie G.S., Bhari N., Houslay T.M., Pitt A.M., Adams D.R., Kolch W., Houslay M.D., Milligan G. Biochem. J. 413:51-60(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARRB2. |
| [31] | "Distinct functions of natural ADAM-15 cytoplasmic domain variants in human mammary carcinoma." Zhong J.L., Poghosyan Z., Pennington C.J., Scott X., Handsley M.M., Warn A., Gavrilovic J., Honert K., Kruger A., Span P.N., Sweep F.C., Edwards D.R. Mol. Cancer Res. 6:383-394(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ADAM15. |
| [32] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [33] | "Extracellular signal-regulated kinase 2 (ERK2) phosphorylation sites and docking domain on the nuclear pore complex protein Tpr cooperatively regulate ERK2-Tpr interaction." Vomastek T., Iwanicki M.P., Burack W.R., Tiwari D., Kumar D., Parsons J.T., Weber M.J., Nandicoori V.K. Mol. Cell. Biol. 28:6954-6966(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TPR. |
| [34] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [35] | "The D816V mutation of c-Kit circumvents a requirement for Src family kinases in c-Kit signal transduction." Sun J., Pedersen M., Ronnstrand L. J. Biol. Chem. 284:11039-11047(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN KIT SIGNALING PATHWAY, PHOSPHORYLATION. |
| [36] | "Tumor suppressor density-enhanced phosphatase-1 (DEP-1) inhibits the RAS pathway by direct dephosphorylation of ERK1/2 kinases." Sacco F., Tinti M., Palma A., Ferrari E., Nardozza A.P., Hooft van Huijsduijnen R., Takahashi T., Castagnoli L., Cesareni G. J. Biol. Chem. 284:22048-22058(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-204, DEPHOSPHORYLATION BY PTPRJ AT TYR-204. |
| [37] | "Protein kinase SGK1 enhances MEK/ERK complex formation through the phosphorylation of ERK2: implication for the positive regulatory role of SGK1 on the ERK function during liver regeneration." Won M., Park K.A., Byun H.S., Kim Y.R., Choi B.L., Hong J.H., Park J., Seok J.H., Lee Y.H., Cho C.H., Song I.S., Kim Y.K., Shen H.M., Hur G.M. J. Hepatol. 51:67-76(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SGK1. |
| [38] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-170 AND THR-198, MASS SPECTROMETRY. |
| [39] | "A new type of ERK1/2 autophosphorylation causes cardiac hypertrophy." Lorenz K., Schmitt J.P., Schmitteckert E.M., Lohse M.J. Nat. Med. 15:75-83(2009) [PubMed] [Europe PMC] [Abstract] Cited for: AUTOPHOSPHORYLATION AT THR-207, ENZYME REGULATION, SUBUNIT, SUBCELLULAR LOCATION. |
| [40] | "The extracellular signal-regulated kinase: multiple substrates regulate diverse cellular functions." Yoon S., Seger R. Growth Factors 24:21-44(2006) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [41] | "The ERK signaling cascade--views from different subcellular compartments." Yao Z., Seger R. BioFactors 35:407-416(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION, REVIEW ON SUBCELLULAR LOCATION. |
| [42] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [43] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [44] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [45] | "The ERK cascade: distinct functions within various subcellular organelles." Wortzel I., Seger R. Genes Cancer 2:195-209(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON ENZYME REGULATION, REVIEW ON FUNCTION. |
| [46] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-202 AND TYR-204, MASS SPECTROMETRY. |
| [47] | "Crystal structure of human mono-phosphorylated ERK1 at Tyr204." Kinoshita T., Yoshida I., Nakae S., Okita K., Gouda M., Matsubara M., Yokota K., Ishiguro H., Tada T. Biochem. Biophys. Res. Commun. 377:1123-1127(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.39 ANGSTROMS), PHOSPHORYLATION AT TYR-204. |
| [48] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-323. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X60188 mRNA. Translation: CAA42744.1. AY033607 mRNA. Translation: AAK52329.1. DQ399291 mRNA. Translation: ABD60302.1. EU332853 Genomic DNA. Translation: ABY87542.1. AC012645 Genomic DNA. No translation available. CH471238 Genomic DNA. Translation: EAW79912.1. CH471238 Genomic DNA. Translation: EAW79915.1. BC013992 mRNA. Translation: AAH13992.1. M84490 mRNA. Translation: AAA36142.1. Z11696 mRNA. Translation: CAA77754.1. | ||||||||||||
| IPI | IPI00018195. | ||||||||||||
| PIR | A48082. | ||||||||||||
| RefSeq | NP_001035145.1. NM_001040056.1. NP_001103361.1. NM_001109891.1. NP_002737.2. NM_002746.2. | ||||||||||||
| UniGene | Hs.861. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P27361. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-30985N. | ||||||||||||
| IntAct | P27361. 22 interactions. | ||||||||||||
| MINT | MINT-99599. | ||||||||||||
| STRING | 9606.ENSP00000263025. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P27361. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 232066. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P27361. | ||||||||||||
| PRIDE | P27361. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5595. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000263025; ENSP00000263025; ENSG00000102882. ENST00000322266; ENSP00000327293; ENSG00000102882. ENST00000395199; ENSP00000378625; ENSG00000102882. ENST00000395202; ENSP00000378628; ENSG00000102882. ENST00000403394; ENSP00000384895; ENSG00000102882. | ||||||||||||
| GeneID | 5595. | ||||||||||||
| KEGG | hsa:5595. | ||||||||||||
| UCSC | uc002dwr.3. human. uc002dwv.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5595. | ||||||||||||
| GeneCards | GC16M030125. | ||||||||||||
| HGNC | HGNC:6877. MAPK3. | ||||||||||||
| HPA | CAB002683. HPA003995. HPA005700. | ||||||||||||
| MIM | 601795. gene. | ||||||||||||
| neXtProt | NX_P27361. | ||||||||||||
| PharmGKB | PA30622. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOGENOM | HOG000233024. | ||||||||||||
| HOVERGEN | HBG014652. | ||||||||||||
| InParanoid | P27361. | ||||||||||||
| KO | K04371. | ||||||||||||
| OMA | KYQPPIM. | ||||||||||||
| OrthoDB | EOG45HRXM. | ||||||||||||
| PhylomeDB | P27361. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.7.11.24. 2681. | ||||||||||||
| Pathway_Interaction_DB | alphasynuclein_pathway. Alpha-synuclein signaling. angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. arf6downstreampathway. Arf6 downstream pathway. bcr_5pathway. BCR signaling pathway. anthraxpathway. Cellular roles of Anthrax toxin. ceramidepathway. Ceramide signaling pathway. cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. endothelinpathway. Endothelins. ephbfwdpathway. EPHB forward signaling. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. fgf_pathway. FGF signaling pathway. ifngpathway. IFN-gamma pathway. il2_1pathway. IL2-mediated signaling events. avb3_integrin_pathway. Integrins in angiogenesis. trkrpathway. Neurotrophic factor-mediated Trk receptor signaling. avb3_opn_pathway. Osteopontin-mediated events. ps1pathway. Presenilin action in Notch and Wnt signaling. tcrraspathway. Ras signaling in the CD4+ TCR pathway. smad2_3pathway. Regulation of cytoplasmic and nuclear SMAD2/3 signaling. telomerasepathway. Regulation of Telomerase. retinoic_acid_pathway. Retinoic acid receptors-mediated signaling. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. s1p_s1p1_pathway. S1P1 pathway. s1p_s1p2_pathway. S1P2 pathway. s1p_s1p3_pathway. S1P3 pathway. s1p_s1p4_pathway. S1P4 pathway. met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). prlsignalingeventspathway. Signaling events mediated by PRL. kitpathway. Signaling events mediated by Stem cell factor receptor (c-Kit). vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. ret_pathway. Signaling events regulated by Ret tyrosine kinase. syndecan_1_pathway. Syndecan-1-mediated signaling events. syndecan_2_pathway. Syndecan-2-mediated signaling events. trail_pathway. TRAIL signaling pathway. mapktrkpathway. Trk receptor signaling mediated by the MAPK pathway. vegfr1_pathway. VEGFR1 specific signals. lymphangiogenesis_pathway. VEGFR3 signaling in lymphatic endothelium. | ||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_115566. Cell Cycle. REACT_116125. Disease. REACT_1788. Transcription. REACT_21300. Mitotic M-M/G1 phases. REACT_604. Hemostasis. REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. REACT_71. Gene Expression. | ||||||||||||
| SignaLink | P27361. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P27361. | ||||||||||||
| Bgee | P27361. | ||||||||||||
| CleanEx | HS_MAPK3. | ||||||||||||
| Genevestigator | P27361. | ||||||||||||
| GermOnline | ENSG00000102882. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR003527. MAP_kinase_CS. IPR008349. MAPK_ERK1/2. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01770. ERK1ERK2MAPK. | ||||||||||||
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||
| PROSITE | PS01351. MAPK. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P27361. | ||||||||||||
| ChEMBL | CHEMBL3385. | ||||||||||||
| DrugBank | DB01169. Arsenic trioxide. DB01064. Isoproterenol. DB00641. Simvastatin. DB00605. Sulindac. | ||||||||||||
| EvolutionaryTrace | P27361. | ||||||||||||
| GenomeRNAi | 5595. | ||||||||||||
| NextBio | 21714. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MK03_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P27361 Secondary accession number(s): A8CZ58, B0LPG3, Q8NHX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
