P27216 (ANX13_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Annexin A13 Alternative name(s): Annexin XIII Annexin-13 Intestine-specific annexin Short name=ISA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cell membrane. Note: Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes. |
| Tissue specificity | Gut specific. |
| Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
| Sequence similarities | Belongs to the annexin family. Contains 4 annexin repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Annexin Repeat |
| Ligand | Calcium Calcium/phospholipid-binding |
| PTM | Lipoprotein Myristate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell differentiation Non-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | plasma membrane Non-traceable author statement Ref.1. Source: UniProtKB |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro calcium-dependent phospholipid bindingNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P27216-1) Also known as: Anx13A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P27216-2) Also known as: Anx13B; The sequence of this isoform differs from the canonical sequence as follows: 5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 316 | 315 | Annexin A13 | PRO_0000067514 | |||||
Regions | |||||||||
| Repeat | 23 – 83 | 61 | Annexin 1 | ||||||
| Repeat | 95 – 155 | 61 | Annexin 2 | ||||||
| Repeat | 179 – 239 | 61 | Annexin 3 | ||||||
| Repeat | 254 – 314 | 61 | Annexin 4 | ||||||
Amino acid modifications | |||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.1 | ||||||
Natural variations | |||||||||
| Alternative sequence | 5 | 1 | H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B. | VSP_000291 | |||||
| Natural variant | 86 | 1 | R → H. Corresponds to variant rs2294013 [ dbSNP | Ensembl ]. | VAR_055501 | |||||
| Natural variant | 108 | 1 | V → I. Corresponds to variant rs6995099 [ dbSNP | Ensembl ]. | VAR_055502 | |||||
| Natural variant | 272 | 1 | V → I. Corresponds to variant rs2294015 [ dbSNP | Ensembl ]. | VAR_055503 | |||||
Experimental info | |||||||||
| Sequence conflict | 112 | 1 | V → F in CAA77578. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin." Wice B.M., Gordon J.I. J. Cell Biol. 116:405-422(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), MYRISTOYLATION AT GLY-2. |
| [2] | "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins." Iglesias J.M., Morgan R.O., Jenkins N.A., Copeland N.G., Gilbert D.J., Fernandez M.-P. Mol. Biol. Evol. 19:608-618(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Tissue: Colon adenocarcinoma. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z11502 mRNA. Translation: CAA77578.1. AJ306450 mRNA. Translation: CAC34622.1. AC135166 Genomic DNA. No translation available. |
| IPI | IPI00017337. IPI00465213. |
| PIR | LUHUIS. A41733. |
| RefSeq | NP_001003954.1. NM_001003954.1. NP_004297.2. NM_004306.2. |
| UniGene | Hs.181107. |
3D structure databases | |
| ProteinModelPortal | P27216. |
| SMR | P27216. Positions 10-315. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-137701. |
| STRING | 9606.ENSP00000262219. |
PTM databases | |
| PhosphoSite | P27216. |
Polymorphism databases | |
| DMDM | 281185504. |
Proteomic databases | |
| PaxDb | P27216. |
| PRIDE | P27216. |
Protocols and materials databases | |
| DNASU | 312. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262219; ENSP00000262219; ENSG00000104537. ENST00000419625; ENSP00000390809; ENSG00000104537. |
| GeneID | 312. |
| KEGG | hsa:312. |
| UCSC | uc003yqt.3. human. uc003yqu.3. human. |
Organism-specific databases | |
| CTD | 312. |
| GeneCards | GC08M124762. |
| HGNC | HGNC:536. ANXA13. |
| HPA | CAB025135. HPA018535. HPA019569. HPA019650. |
| MIM | 602573. gene. |
| neXtProt | NX_P27216. |
| PharmGKB | PA24826. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG267770. |
| HOGENOM | HOG000158803. |
| HOVERGEN | HBG061815. |
| OMA | YQILIGK. |
| OrthoDB | EOG4J9N0C. |
Gene expression databases | |
| ArrayExpress | P27216. |
| Bgee | P27216. |
| CleanEx | HS_ANXA13. |
| Genevestigator | P27216. |
| GermOnline | ENSG00000104537. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.220.10. 4 hits. |
| InterPro | IPR001464. Annexin. IPR018502. Annexin_repeat. IPR018252. Annexin_repeat_CS. IPR009166. AnnexinXIII. [Graphical view] |
| PANTHER | PTHR10502. PTHR10502. 1 hit. |
| Pfam | PF00191. Annexin. 4 hits. [Graphical view] |
| PRINTS | PR00196. ANNEXIN. PR01811. ANNEXINXIII. |
| SMART | SM00335. ANX. 4 hits. [Graphical view] |
| SUPFAM | SSF47874. Annexin. 1 hit. |
| PROSITE | PS00223. ANNEXIN. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 312. |
| NextBio | 1267. |
| SOURCE | Search... |
Entry information
| Entry name | ANX13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P27216 Secondary accession number(s): Q9BQR5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
