Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P27216 (ANX13_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Annexin A13
Alternative name(s):
Annexin XIII
Annexin-13
Intestine-specific annexin
Short name=ISA
Gene names
Name:ANXA13
Synonyms:ANX13
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length316 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cell membrane. Note: Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.

Tissue specificity

Gut specific.

Domain

A pair of annexin repeats may form one binding site for calcium and phospholipid.

Sequence similarities

Belongs to the annexin family.

Contains 4 annexin repeats.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainAnnexin
Repeat
   LigandCalcium
Calcium/phospholipid-binding
   PTMLipoprotein
Myristate
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell differentiation

Non-traceable author statement Ref.1. Source: UniProtKB

negative regulation of Golgi to plasma membrane protein transport

Inferred from sequence or structural similarity. Source: UniProt

positive regulation of Golgi to plasma membrane protein transport

Inferred from sequence or structural similarity. Source: UniProt

   Cellular_componentapical plasma membrane

Inferred from sequence or structural similarity. Source: UniProt

basolateral plasma membrane

Inferred from sequence or structural similarity. Source: UniProt

exocytic vesicle

Inferred from sequence or structural similarity. Source: UniProt

extracellular space

Inferred from direct assay PubMed 22664934. Source: UniProt

extracellular vesicular exosome

Inferred from direct assay PubMed 19056867. Source: UniProt

membrane raft

Inferred from sequence or structural similarity. Source: UniProt

plasma membrane

Non-traceable author statement Ref.1. Source: UniProtKB

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

calcium-dependent phospholipid binding

Inferred from electronic annotation. Source: UniProtKB-KW

phosphatidylglycerol binding

Inferred from direct assay PubMed 15813707. Source: UniProt

phosphatidylserine binding

Inferred from direct assay PubMed 15813707. Source: UniProt

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: P27216-1)

Also known as: Anx13A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: P27216-2)

Also known as: Anx13B;

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed
Chain2 – 316315Annexin A13
PRO_0000067514

Regions

Repeat23 – 8361Annexin 1
Repeat95 – 15561Annexin 2
Repeat179 – 23961Annexin 3
Repeat254 – 31461Annexin 4

Amino acid modifications

Lipidation21N-myristoyl glycine Ref.1

Natural variations

Alternative sequence51H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B.
VSP_000291
Natural variant861R → H.
Corresponds to variant rs2294013 [ dbSNP | Ensembl ].
VAR_055501
Natural variant1081V → I.
Corresponds to variant rs6995099 [ dbSNP | Ensembl ].
VAR_055502
Natural variant2721V → I.
Corresponds to variant rs2294015 [ dbSNP | Ensembl ].
VAR_055503

Experimental info

Sequence conflict1121V → F in CAA77578. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform A (Anx13A) [UniParc].

Last modified December 15, 2009. Version 3.
Checksum: 3F61A1AECE5A067D

FASTA31635,415
        10         20         30         40         50         60 
MGNRHAKASS PQGFDVDRDA KKLNKACKGM GTNEAAIIEI LSGRTSDERQ QIKQKYKATY 

        70         80         90        100        110        120 
GKELEEVLKS ELSGNFEKTA LALLDRPSEY AARQLQKAMK GLGTDESVLI EVLCTRTNKE 

       130        140        150        160        170        180 
IIAIKEAYQR LFDRSLESDV KGDTSGNLKK ILVSLLQANR NEGDDVDKDL AGQDAKDLYD 

       190        200        210        220        230        240 
AGEGRWGTDE LAFNEVLAKR SYKQLRATFQ AYQILIGKDI EEAIEEETSG DLQKAYLTLV 

       250        260        270        280        290        300 
RCAQDCEDYF AERLYKSMKG AGTDEETLIR IVVTRAEVDL QGIKAKFQEK YQKSLSDMVR 

       310 
SDTSGDFRKL LVALLH 

« Hide

Isoform B (Anx13B) [UniParc].

Checksum: DAA5B275F248DDC0
Show »

FASTA35739,744

References

« Hide 'large scale' references
[1]"A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin."
Wice B.M., Gordon J.I.
J. Cell Biol. 116:405-422(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), MYRISTOYLATION AT GLY-2.
[2]"Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins."
Iglesias J.M., Morgan R.O., Jenkins N.A., Copeland N.G., Gilbert D.J., Fernandez M.-P.
Mol. Biol. Evol. 19:608-618(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
Tissue: Colon adenocarcinoma.
[3]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z11502 mRNA. Translation: CAA77578.1.
AJ306450 mRNA. Translation: CAC34622.1.
AC135166 Genomic DNA. No translation available.
PIRLUHUIS. A41733.
RefSeqNP_001003954.1. NM_001003954.1.
NP_004297.2. NM_004306.2.
UniGeneHs.181107.

3D structure databases

ProteinModelPortalP27216.
SMRP27216. Positions 10-315.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid106809. 2 interactions.
MINTMINT-137701.
STRING9606.ENSP00000262219.

PTM databases

PhosphoSiteP27216.

Polymorphism databases

DMDM281185504.

Proteomic databases

PaxDbP27216.
PRIDEP27216.

Protocols and materials databases

DNASU312.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
GeneID312.
KEGGhsa:312.
UCSCuc003yqt.3. human. [P27216-2]
uc003yqu.3. human. [P27216-1]

Organism-specific databases

CTD312.
GeneCardsGC08M124762.
HGNCHGNC:536. ANXA13.
HPACAB025135.
HPA018535.
HPA019569.
HPA019650.
MIM602573. gene.
neXtProtNX_P27216.
PharmGKBPA24826.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG267770.
HOGENOMHOG000158803.
HOVERGENHBG061815.
KOK17099.
OMAANRDEGL.
OrthoDBEOG74XS72.
PhylomeDBP27216.
TreeFamTF105452.

Gene expression databases

ArrayExpressP27216.
BgeeP27216.
CleanExHS_ANXA13.
GenevestigatorP27216.

Family and domain databases

Gene3D1.10.220.10. 4 hits.
InterProIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTSM00335. ANX. 4 hits.
[Graphical view]
PROSITEPS00223. ANNEXIN. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiANXA13.
GenomeRNAi312.
NextBio1267.
PROP27216.
SOURCESearch...

Entry information

Entry nameANX13_HUMAN
AccessionPrimary (citable) accession number: P27216
Secondary accession number(s): Q9BQR5
Entry history
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: December 15, 2009
Last modified: April 16, 2014
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM