Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A13

Gene

ANXA13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • calcium-dependent phospholipid binding Source: UniProtKB-KW
  • calcium ion binding Source: InterPro
  • phosphatidylglycerol binding Source: UniProtKB
  • phosphatidylserine binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000104537-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A13
Alternative name(s):
Annexin XIII
Annexin-13
Intestine-specific annexin
Short name:
ISA
Gene namesi
Name:ANXA13
Synonyms:ANX13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:536. ANXA13.

Subcellular locationi

  • Cell membrane

  • Note: Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.

GO - Cellular componenti

  • apical plasma membrane Source: UniProtKB
  • basolateral plasma membrane Source: UniProtKB
  • exocytic vesicle Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB
  • membrane raft Source: UniProtKB
  • nucleoplasm Source: HPA
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi312.
OpenTargetsiENSG00000104537.
PharmGKBiPA24826.

Polymorphism and mutation databases

BioMutaiANXA13.
DMDMi281185504.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00000675142 – 316Annexin A13Add BLAST315

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine1 Publication1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

EPDiP27216.
MaxQBiP27216.
PaxDbiP27216.
PeptideAtlasiP27216.
PRIDEiP27216.

PTM databases

iPTMnetiP27216.
PhosphoSitePlusiP27216.

Expressioni

Tissue specificityi

Gut specific.

Gene expression databases

BgeeiENSG00000104537.
CleanExiHS_ANXA13.
ExpressionAtlasiP27216. baseline and differential.
GenevisibleiP27216. HS.

Organism-specific databases

HPAiCAB025135.
HPA018535.
HPA019569.
HPA019650.

Interactioni

Protein-protein interaction databases

BioGridi106809. 7 interactors.
MINTiMINT-137701.
STRINGi9606.ENSP00000262219.

Structurei

3D structure databases

ProteinModelPortaliP27216.
SMRiP27216.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati23 – 83Annexin 1Add BLAST61
Repeati95 – 155Annexin 2Add BLAST61
Repeati179 – 239Annexin 3Add BLAST61
Repeati254 – 314Annexin 4Add BLAST61

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.

Sequence similaritiesi

Belongs to the annexin family.Curated
Contains 4 annexin repeats.Curated

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiP27216.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG091G0H6H.
PhylomeDBiP27216.
TreeFamiTF105452.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: P27216-1) [UniParc]FASTAAdd to basket
Also known as: Anx13A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNRHAKASS PQGFDVDRDA KKLNKACKGM GTNEAAIIEI LSGRTSDERQ
60 70 80 90 100
QIKQKYKATY GKELEEVLKS ELSGNFEKTA LALLDRPSEY AARQLQKAMK
110 120 130 140 150
GLGTDESVLI EVLCTRTNKE IIAIKEAYQR LFDRSLESDV KGDTSGNLKK
160 170 180 190 200
ILVSLLQANR NEGDDVDKDL AGQDAKDLYD AGEGRWGTDE LAFNEVLAKR
210 220 230 240 250
SYKQLRATFQ AYQILIGKDI EEAIEEETSG DLQKAYLTLV RCAQDCEDYF
260 270 280 290 300
AERLYKSMKG AGTDEETLIR IVVTRAEVDL QGIKAKFQEK YQKSLSDMVR
310
SDTSGDFRKL LVALLH
Length:316
Mass (Da):35,415
Last modified:December 15, 2009 - v3
Checksum:i3F61A1AECE5A067D
GO
Isoform B (identifier: P27216-2) [UniParc]FASTAAdd to basket
Also known as: Anx13B

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP

Show »
Length:357
Mass (Da):39,744
Checksum:iDAA5B275F248DDC0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti112V → F in CAA77578 (PubMed:1530946).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05550186R → H.Corresponds to variant rs2294013dbSNPEnsembl.1
Natural variantiVAR_055502108V → I.Corresponds to variant rs6995099dbSNPEnsembl.1
Natural variantiVAR_055503272V → I.Corresponds to variant rs2294015dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0002915H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z11502 mRNA. Translation: CAA77578.1.
AJ306450 mRNA. Translation: CAC34622.1.
AC135166 Genomic DNA. No translation available.
CCDSiCCDS34939.1. [P27216-2]
CCDS47917.1. [P27216-1]
PIRiA41733. LUHUIS.
RefSeqiNP_001003954.1. NM_001003954.2. [P27216-2]
NP_004297.2. NM_004306.3. [P27216-1]
UniGeneiHs.181107.

Genome annotation databases

EnsembliENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
GeneIDi312.
KEGGihsa:312.
UCSCiuc003yqt.4. human. [P27216-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z11502 mRNA. Translation: CAA77578.1.
AJ306450 mRNA. Translation: CAC34622.1.
AC135166 Genomic DNA. No translation available.
CCDSiCCDS34939.1. [P27216-2]
CCDS47917.1. [P27216-1]
PIRiA41733. LUHUIS.
RefSeqiNP_001003954.1. NM_001003954.2. [P27216-2]
NP_004297.2. NM_004306.3. [P27216-1]
UniGeneiHs.181107.

3D structure databases

ProteinModelPortaliP27216.
SMRiP27216.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106809. 7 interactors.
MINTiMINT-137701.
STRINGi9606.ENSP00000262219.

PTM databases

iPTMnetiP27216.
PhosphoSitePlusiP27216.

Polymorphism and mutation databases

BioMutaiANXA13.
DMDMi281185504.

Proteomic databases

EPDiP27216.
MaxQBiP27216.
PaxDbiP27216.
PeptideAtlasiP27216.
PRIDEiP27216.

Protocols and materials databases

DNASUi312.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
GeneIDi312.
KEGGihsa:312.
UCSCiuc003yqt.4. human. [P27216-1]

Organism-specific databases

CTDi312.
DisGeNETi312.
GeneCardsiANXA13.
HGNCiHGNC:536. ANXA13.
HPAiCAB025135.
HPA018535.
HPA019569.
HPA019650.
MIMi602573. gene.
neXtProtiNX_P27216.
OpenTargetsiENSG00000104537.
PharmGKBiPA24826.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiP27216.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG091G0H6H.
PhylomeDBiP27216.
TreeFamiTF105452.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000104537-MONOMER.

Miscellaneous databases

GeneWikiiANXA13.
GenomeRNAii312.
PROiP27216.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000104537.
CleanExiHS_ANXA13.
ExpressionAtlasiP27216. baseline and differential.
GenevisibleiP27216. HS.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANX13_HUMAN
AccessioniPrimary (citable) accession number: P27216
Secondary accession number(s): Q9BQR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: December 15, 2009
Last modified: November 2, 2016
This is version 150 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.