Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P27216

- ANX13_HUMAN

UniProt

P27216 - ANX13_HUMAN

Protein

Annexin A13

Gene

ANXA13

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 3 (15 Dec 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium-dependent phospholipid binding Source: UniProtKB-KW
    2. calcium ion binding Source: InterPro
    3. phosphatidylglycerol binding Source: UniProt
    4. phosphatidylserine binding Source: UniProt

    GO - Biological processi

    1. cell differentiation Source: UniProtKB
    2. negative regulation of Golgi to plasma membrane protein transport Source: UniProt
    3. positive regulation of Golgi to plasma membrane protein transport Source: UniProt

    Keywords - Ligandi

    Calcium, Calcium/phospholipid-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Annexin A13
    Alternative name(s):
    Annexin XIII
    Annexin-13
    Intestine-specific annexin
    Short name:
    ISA
    Gene namesi
    Name:ANXA13
    Synonyms:ANX13
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:536. ANXA13.

    Subcellular locationi

    Cell membrane
    Note: Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.

    GO - Cellular componenti

    1. apical plasma membrane Source: UniProt
    2. basolateral plasma membrane Source: UniProt
    3. exocytic vesicle Source: UniProt
    4. extracellular space Source: UniProt
    5. extracellular vesicular exosome Source: UniProt
    6. membrane raft Source: UniProt
    7. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24826.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed
    Chaini2 – 316315Annexin A13PRO_0000067514Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi2 – 21N-myristoyl glycine1 Publication

    Keywords - PTMi

    Lipoprotein, Myristate

    Proteomic databases

    MaxQBiP27216.
    PaxDbiP27216.
    PRIDEiP27216.

    PTM databases

    PhosphoSiteiP27216.

    Expressioni

    Tissue specificityi

    Gut specific.

    Gene expression databases

    ArrayExpressiP27216.
    BgeeiP27216.
    CleanExiHS_ANXA13.
    GenevestigatoriP27216.

    Organism-specific databases

    HPAiCAB025135.
    HPA018535.
    HPA019569.
    HPA019650.

    Interactioni

    Protein-protein interaction databases

    BioGridi106809. 2 interactions.
    MINTiMINT-137701.
    STRINGi9606.ENSP00000262219.

    Structurei

    3D structure databases

    ProteinModelPortaliP27216.
    SMRiP27216. Positions 10-315.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati23 – 8361Annexin 1Add
    BLAST
    Repeati95 – 15561Annexin 2Add
    BLAST
    Repeati179 – 23961Annexin 3Add
    BLAST
    Repeati254 – 31461Annexin 4Add
    BLAST

    Domaini

    A pair of annexin repeats may form one binding site for calcium and phospholipid.

    Sequence similaritiesi

    Belongs to the annexin family.Curated
    Contains 4 annexin repeats.Curated

    Keywords - Domaini

    Annexin, Repeat

    Phylogenomic databases

    eggNOGiNOG267770.
    HOGENOMiHOG000158803.
    HOVERGENiHBG061815.
    KOiK17099.
    OMAiCGKDIEE.
    OrthoDBiEOG74XS72.
    PhylomeDBiP27216.
    TreeFamiTF105452.

    Family and domain databases

    Gene3Di1.10.220.10. 4 hits.
    InterProiIPR001464. Annexin.
    IPR018502. Annexin_repeat.
    IPR018252. Annexin_repeat_CS.
    IPR009166. AnnexinXIII.
    [Graphical view]
    PfamiPF00191. Annexin. 4 hits.
    [Graphical view]
    PRINTSiPR00196. ANNEXIN.
    PR01811. ANNEXINXIII.
    SMARTiSM00335. ANX. 4 hits.
    [Graphical view]
    PROSITEiPS00223. ANNEXIN. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: P27216-1) [UniParc]FASTAAdd to Basket

    Also known as: Anx13A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNRHAKASS PQGFDVDRDA KKLNKACKGM GTNEAAIIEI LSGRTSDERQ    50
    QIKQKYKATY GKELEEVLKS ELSGNFEKTA LALLDRPSEY AARQLQKAMK 100
    GLGTDESVLI EVLCTRTNKE IIAIKEAYQR LFDRSLESDV KGDTSGNLKK 150
    ILVSLLQANR NEGDDVDKDL AGQDAKDLYD AGEGRWGTDE LAFNEVLAKR 200
    SYKQLRATFQ AYQILIGKDI EEAIEEETSG DLQKAYLTLV RCAQDCEDYF 250
    AERLYKSMKG AGTDEETLIR IVVTRAEVDL QGIKAKFQEK YQKSLSDMVR 300
    SDTSGDFRKL LVALLH 316
    Length:316
    Mass (Da):35,415
    Last modified:December 15, 2009 - v3
    Checksum:i3F61A1AECE5A067D
    GO
    Isoform B (identifier: P27216-2) [UniParc]FASTAAdd to Basket

    Also known as: Anx13B

    The sequence of this isoform differs from the canonical sequence as follows:
         5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP

    Show »
    Length:357
    Mass (Da):39,744
    Checksum:iDAA5B275F248DDC0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti112 – 1121V → F in CAA77578. (PubMed:1530946)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti86 – 861R → H.
    Corresponds to variant rs2294013 [ dbSNP | Ensembl ].
    VAR_055501
    Natural varianti108 – 1081V → I.
    Corresponds to variant rs6995099 [ dbSNP | Ensembl ].
    VAR_055502
    Natural varianti272 – 2721V → I.
    Corresponds to variant rs2294015 [ dbSNP | Ensembl ].
    VAR_055503

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei5 – 51H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B. 1 PublicationVSP_000291

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z11502 mRNA. Translation: CAA77578.1.
    AJ306450 mRNA. Translation: CAC34622.1.
    AC135166 Genomic DNA. No translation available.
    CCDSiCCDS34939.1. [P27216-2]
    CCDS47917.1. [P27216-1]
    PIRiA41733. LUHUIS.
    RefSeqiNP_001003954.1. NM_001003954.1. [P27216-2]
    NP_004297.2. NM_004306.2. [P27216-1]
    UniGeneiHs.181107.

    Genome annotation databases

    EnsembliENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
    ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
    GeneIDi312.
    KEGGihsa:312.
    UCSCiuc003yqt.3. human. [P27216-2]
    uc003yqu.3. human. [P27216-1]

    Polymorphism databases

    DMDMi281185504.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z11502 mRNA. Translation: CAA77578.1 .
    AJ306450 mRNA. Translation: CAC34622.1 .
    AC135166 Genomic DNA. No translation available.
    CCDSi CCDS34939.1. [P27216-2 ]
    CCDS47917.1. [P27216-1 ]
    PIRi A41733. LUHUIS.
    RefSeqi NP_001003954.1. NM_001003954.1. [P27216-2 ]
    NP_004297.2. NM_004306.2. [P27216-1 ]
    UniGenei Hs.181107.

    3D structure databases

    ProteinModelPortali P27216.
    SMRi P27216. Positions 10-315.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106809. 2 interactions.
    MINTi MINT-137701.
    STRINGi 9606.ENSP00000262219.

    PTM databases

    PhosphoSitei P27216.

    Polymorphism databases

    DMDMi 281185504.

    Proteomic databases

    MaxQBi P27216.
    PaxDbi P27216.
    PRIDEi P27216.

    Protocols and materials databases

    DNASUi 312.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262219 ; ENSP00000262219 ; ENSG00000104537 . [P27216-2 ]
    ENST00000419625 ; ENSP00000390809 ; ENSG00000104537 . [P27216-1 ]
    GeneIDi 312.
    KEGGi hsa:312.
    UCSCi uc003yqt.3. human. [P27216-2 ]
    uc003yqu.3. human. [P27216-1 ]

    Organism-specific databases

    CTDi 312.
    GeneCardsi GC08M124762.
    HGNCi HGNC:536. ANXA13.
    HPAi CAB025135.
    HPA018535.
    HPA019569.
    HPA019650.
    MIMi 602573. gene.
    neXtProti NX_P27216.
    PharmGKBi PA24826.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG267770.
    HOGENOMi HOG000158803.
    HOVERGENi HBG061815.
    KOi K17099.
    OMAi CGKDIEE.
    OrthoDBi EOG74XS72.
    PhylomeDBi P27216.
    TreeFami TF105452.

    Miscellaneous databases

    GeneWikii ANXA13.
    GenomeRNAii 312.
    NextBioi 1267.
    PROi P27216.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P27216.
    Bgeei P27216.
    CleanExi HS_ANXA13.
    Genevestigatori P27216.

    Family and domain databases

    Gene3Di 1.10.220.10. 4 hits.
    InterProi IPR001464. Annexin.
    IPR018502. Annexin_repeat.
    IPR018252. Annexin_repeat_CS.
    IPR009166. AnnexinXIII.
    [Graphical view ]
    Pfami PF00191. Annexin. 4 hits.
    [Graphical view ]
    PRINTSi PR00196. ANNEXIN.
    PR01811. ANNEXINXIII.
    SMARTi SM00335. ANX. 4 hits.
    [Graphical view ]
    PROSITEi PS00223. ANNEXIN. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin."
      Wice B.M., Gordon J.I.
      J. Cell Biol. 116:405-422(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), MYRISTOYLATION AT GLY-2.
    2. "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins."
      Iglesias J.M., Morgan R.O., Jenkins N.A., Copeland N.G., Gilbert D.J., Fernandez M.-P.
      Mol. Biol. Evol. 19:608-618(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Tissue: Colon adenocarcinoma.
    3. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiANX13_HUMAN
    AccessioniPrimary (citable) accession number: P27216
    Secondary accession number(s): Q9BQR5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1992
    Last sequence update: December 15, 2009
    Last modified: October 1, 2014
    This is version 132 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3