Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A13

Gene

ANXA13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium-dependent phospholipid binding Source: UniProtKB-KW
  2. calcium ion binding Source: InterPro
  3. phosphatidylglycerol binding Source: UniProtKB
  4. phosphatidylserine binding Source: UniProtKB

GO - Biological processi

  1. cell differentiation Source: UniProtKB
  2. negative regulation of Golgi to plasma membrane protein transport Source: UniProtKB
  3. positive regulation of Golgi to plasma membrane protein transport Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A13
Alternative name(s):
Annexin XIII
Annexin-13
Intestine-specific annexin
Short name:
ISA
Gene namesi
Name:ANXA13
Synonyms:ANX13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:536. ANXA13.

Subcellular locationi

Cell membrane
Note: Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.

GO - Cellular componenti

  1. apical plasma membrane Source: UniProtKB
  2. basolateral plasma membrane Source: UniProtKB
  3. exocytic vesicle Source: UniProtKB
  4. extracellular space Source: UniProtKB
  5. extracellular vesicular exosome Source: UniProtKB
  6. membrane raft Source: UniProtKB
  7. nucleoplasm Source: HPA
  8. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24826.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed
Chaini2 – 316315Annexin A13PRO_0000067514Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycine1 Publication

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

MaxQBiP27216.
PaxDbiP27216.
PRIDEiP27216.

PTM databases

PhosphoSiteiP27216.

Expressioni

Tissue specificityi

Gut specific.

Gene expression databases

BgeeiP27216.
CleanExiHS_ANXA13.
ExpressionAtlasiP27216. baseline and differential.
GenevestigatoriP27216.

Organism-specific databases

HPAiCAB025135.
HPA018535.
HPA019569.
HPA019650.

Interactioni

Protein-protein interaction databases

BioGridi106809. 7 interactions.
MINTiMINT-137701.
STRINGi9606.ENSP00000262219.

Structurei

3D structure databases

ProteinModelPortaliP27216.
SMRiP27216. Positions 10-315.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 8361Annexin 1Add
BLAST
Repeati95 – 15561Annexin 2Add
BLAST
Repeati179 – 23961Annexin 3Add
BLAST
Repeati254 – 31461Annexin 4Add
BLAST

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.

Sequence similaritiesi

Belongs to the annexin family.Curated
Contains 4 annexin repeats.Curated

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiNOG267770.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiP27216.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG74XS72.
PhylomeDBiP27216.
TreeFamiTF105452.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform A (identifier: P27216-1) [UniParc]FASTAAdd to Basket

Also known as: Anx13A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNRHAKASS PQGFDVDRDA KKLNKACKGM GTNEAAIIEI LSGRTSDERQ
60 70 80 90 100
QIKQKYKATY GKELEEVLKS ELSGNFEKTA LALLDRPSEY AARQLQKAMK
110 120 130 140 150
GLGTDESVLI EVLCTRTNKE IIAIKEAYQR LFDRSLESDV KGDTSGNLKK
160 170 180 190 200
ILVSLLQANR NEGDDVDKDL AGQDAKDLYD AGEGRWGTDE LAFNEVLAKR
210 220 230 240 250
SYKQLRATFQ AYQILIGKDI EEAIEEETSG DLQKAYLTLV RCAQDCEDYF
260 270 280 290 300
AERLYKSMKG AGTDEETLIR IVVTRAEVDL QGIKAKFQEK YQKSLSDMVR
310
SDTSGDFRKL LVALLH
Length:316
Mass (Da):35,415
Last modified:December 15, 2009 - v3
Checksum:i3F61A1AECE5A067D
GO
Isoform B (identifier: P27216-2) [UniParc]FASTAAdd to Basket

Also known as: Anx13B

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP

Show »
Length:357
Mass (Da):39,744
Checksum:iDAA5B275F248DDC0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti112 – 1121V → F in CAA77578. (PubMed:1530946)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti86 – 861R → H.
Corresponds to variant rs2294013 [ dbSNP | Ensembl ].
VAR_055501
Natural varianti108 – 1081V → I.
Corresponds to variant rs6995099 [ dbSNP | Ensembl ].
VAR_055502
Natural varianti272 – 2721V → I.
Corresponds to variant rs2294015 [ dbSNP | Ensembl ].
VAR_055503

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei5 – 51H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B. 1 PublicationVSP_000291

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z11502 mRNA. Translation: CAA77578.1.
AJ306450 mRNA. Translation: CAC34622.1.
AC135166 Genomic DNA. No translation available.
CCDSiCCDS34939.1. [P27216-2]
CCDS47917.1. [P27216-1]
PIRiA41733. LUHUIS.
RefSeqiNP_001003954.1. NM_001003954.1. [P27216-2]
NP_004297.2. NM_004306.2. [P27216-1]
UniGeneiHs.181107.

Genome annotation databases

EnsembliENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
GeneIDi312.
KEGGihsa:312.
UCSCiuc003yqt.3. human. [P27216-2]
uc003yqu.3. human. [P27216-1]

Polymorphism databases

DMDMi281185504.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z11502 mRNA. Translation: CAA77578.1.
AJ306450 mRNA. Translation: CAC34622.1.
AC135166 Genomic DNA. No translation available.
CCDSiCCDS34939.1. [P27216-2]
CCDS47917.1. [P27216-1]
PIRiA41733. LUHUIS.
RefSeqiNP_001003954.1. NM_001003954.1. [P27216-2]
NP_004297.2. NM_004306.2. [P27216-1]
UniGeneiHs.181107.

3D structure databases

ProteinModelPortaliP27216.
SMRiP27216. Positions 10-315.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106809. 7 interactions.
MINTiMINT-137701.
STRINGi9606.ENSP00000262219.

PTM databases

PhosphoSiteiP27216.

Polymorphism databases

DMDMi281185504.

Proteomic databases

MaxQBiP27216.
PaxDbiP27216.
PRIDEiP27216.

Protocols and materials databases

DNASUi312.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262219; ENSP00000262219; ENSG00000104537. [P27216-2]
ENST00000419625; ENSP00000390809; ENSG00000104537. [P27216-1]
GeneIDi312.
KEGGihsa:312.
UCSCiuc003yqt.3. human. [P27216-2]
uc003yqu.3. human. [P27216-1]

Organism-specific databases

CTDi312.
GeneCardsiGC08M124693.
HGNCiHGNC:536. ANXA13.
HPAiCAB025135.
HPA018535.
HPA019569.
HPA019650.
MIMi602573. gene.
neXtProtiNX_P27216.
PharmGKBiPA24826.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG267770.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiP27216.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG74XS72.
PhylomeDBiP27216.
TreeFamiTF105452.

Miscellaneous databases

GeneWikiiANXA13.
GenomeRNAii312.
NextBioi1267.
PROiP27216.
SOURCEiSearch...

Gene expression databases

BgeeiP27216.
CleanExiHS_ANXA13.
ExpressionAtlasiP27216. baseline and differential.
GenevestigatoriP27216.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin."
    Wice B.M., Gordon J.I.
    J. Cell Biol. 116:405-422(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), MYRISTOYLATION AT GLY-2.
  2. "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins."
    Iglesias J.M., Morgan R.O., Jenkins N.A., Copeland N.G., Gilbert D.J., Fernandez M.-P.
    Mol. Biol. Evol. 19:608-618(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Tissue: Colon adenocarcinoma.
  3. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiANX13_HUMAN
AccessioniPrimary (citable) accession number: P27216
Secondary accession number(s): Q9BQR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: December 15, 2009
Last modified: February 4, 2015
This is version 135 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.