P26686 (SRR55_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine-arginine protein 55 Short name=SRP55 Alternative name(s): 52 kDa bracketing protein B52 protein Protein enhancer of deformed | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 376 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential for development. May have a critical role in splicing or in controlling alternative splice site use of at least some pre-mRNA in vivo. Not required for all splicing. May play a general role in the condensation or decondensation of chromatin. Ref.1 Ref.8 Ref.9 |
| Subcellular location | Nucleus. Note: Associated with boundaries of transcriptionally active chromatin. Ref.1 Ref.2 Ref.8 |
| Developmental stage | Expressed throughout development. Ref.9 |
| Post-translational modification | Extensively phosphorylated on serine residues in the RS domain. Ref.1 Ref.10 |
| Sequence similarities | Belongs to the splicing factor SR family. Contains 2 RRM (RNA recognition motif) domains. |
| Sequence caution | The sequence AAN71237.1 differs from that shown. Reason: Frameshift at position 78. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P26686-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P26686-2) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 103-107: Missing. 319-339: Missing. | ||||||
| Isoform B (identifier: P26686-3) Also known as: I; The sequence of this isoform differs from the canonical sequence as follows: 323-376: SFKSSFYKFTTMPFFCSDRSASAENKSRSRSRSRSASPKNGNASPDRNNESMDD → VVQKLVL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform D (identifier: P26686-4) The sequence of this isoform differs from the canonical sequence as follows: 103-107: Missing. 135-140: DLKDYM → SLMCFD 141-376: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform E (identifier: P26686-5) The sequence of this isoform differs from the canonical sequence as follows: 319-339: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform F (identifier: P26686-6) Also known as: K; The sequence of this isoform differs from the canonical sequence as follows: 103-107: Missing. 135-152: DLKDYMRQAGEVTYADAH → VSEHGSMYRALGVVYTVA 153-376: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform G (identifier: P26686-7) Also known as: H; The sequence of this isoform differs from the canonical sequence as follows: 1-139: Missing. 319-339: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform J (identifier: P26686-8) The sequence of this isoform differs from the canonical sequence as follows: 78-261: Missing. 319-339: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform L (identifier: P26686-9) The sequence of this isoform differs from the canonical sequence as follows: 103-107: Missing. 132-154: SWQDLKDYMRQAGEVTYADAHKQ → RSQGLHAPGWRGHLCRCPQAASQ 155-376: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.1 | ||||||
| Chain | 2 – 376 | 375 | Serine-arginine protein 55 | PRO_0000081961 | |||||
Regions | |||||||||
| Domain | 4 – 74 | 71 | RRM 1 | ||||||
| Domain | 120 – 193 | 74 | RRM 2 | ||||||
| Compositional bias | 89 – 97 | 9 | Gly-rich (hinge region) | ||||||
| Compositional bias | 184 – 359 | 176 | Arg/Ser-rich (RS domain) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 165 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 139 | 139 | Missing in isoform G. | VSP_015924 | |||||
| Alternative sequence | 78 – 261 | 184 | Missing in isoform J. | VSP_015925 | |||||
| Alternative sequence | 103 – 107 | 5 | Missing in isoform A, isoform D, isoform F and isoform L. | VSP_015926 | |||||
| Alternative sequence | 132 – 154 | 23 | SWQDL…DAHKQ → RSQGLHAPGWRGHLCRCPQA ASQ in isoform L. | VSP_041738 | |||||
| Alternative sequence | 135 – 152 | 18 | DLKDY…YADAH → VSEHGSMYRALGVVYTVA in isoform F. | VSP_015928 | |||||
| Alternative sequence | 135 – 140 | 6 | DLKDYM → SLMCFD in isoform D. | VSP_015929 | |||||
| Alternative sequence | 141 – 376 | 236 | Missing in isoform D. | VSP_015930 | |||||
| Alternative sequence | 153 – 376 | 224 | Missing in isoform F. | VSP_015931 | |||||
| Alternative sequence | 155 – 376 | 222 | Missing in isoform L. | VSP_041739 | |||||
| Alternative sequence | 319 – 339 | 21 | Missing in isoform A, isoform E, isoform G and isoform J. | VSP_005878 | |||||
| Alternative sequence | 323 – 376 | 54 | SFKSS…ESMDD → VVQKLVL in isoform B. | VSP_015932 | |||||
Experimental info | |||||||||
| Sequence conflict | 7 | 1 | Y → F in AAB24629. Ref.7 | ||||||
| Sequence conflict | 17 – 18 | 2 | ER → AA in AAB24629. Ref.7 | ||||||
| Sequence conflict | 40 – 42 | 3 | GFV → AFM in AAB24629. Ref.7 | ||||||
| Sequence conflict | 75 | 1 | T → S in CAA41556. Ref.1 | ||||||
| Sequence conflict | 196 | 1 | R → A in CAA44483. Ref.2 | ||||||
| Sequence conflict | 229 | 1 | S → T in CAA44483. Ref.2 | ||||||
| Sequence conflict | 261 | 1 | R → A in CAA44483. Ref.2 | ||||||
| Sequence conflict | 280 – 282 | 3 | RSR → APV in CAA44483. Ref.2 | ||||||
| Sequence conflict | 294 | 1 | S → T in CAA41556. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A conserved family of nuclear phosphoproteins localized to sites of polymerase II transcription." Roth M.B., Zahler A.M., Stolk J.A. J. Cell Biol. 115:587-596(1991) [PubMed: 1717489] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), PROTEIN SEQUENCE OF 2-15; 126-132 AND 137-148, FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION. Strain: CL. Tissue: Embryo. |
| [2] | "Characterization of a Drosophila protein associated with boundaries of transcriptionally active chromatin." Champlin D.T., Frasch M., Saumweber H., Lis J.T. Genes Dev. 5:1611-1621(1991) [PubMed: 1885003] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), SUBCELLULAR LOCATION. Tissue: Embryo. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND G), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-376 (ISOFORM J). Strain: Berkeley. Tissue: Embryo, Head and Testis. |
| [6] | Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J.W., Booth B., Champe M., Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E., George R.A., Gonzalez M., Guarin H., Kronmiller B., Li P.W., Liao G. Celniker S.E.Submitted (NOV-2010) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A; E; G AND J). Strain: Berkeley. Tissue: Head and Ovary. |
| [7] | "Isolation of RRM-type RNA-binding protein genes and the analysis of their relatedness by using a numerical approach." Kim Y.-J., Baker B.S. Mol. Cell. Biol. 13:174-183(1993) [PubMed: 8417324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 7-42. |
| [8] | "Two members of a conserved family of nuclear phosphoproteins are involved in pre-mRNA splicing." Mayeda A., Zahler A.M., Krainer A.R., Roth M.B. Proc. Natl. Acad. Sci. U.S.A. 89:1301-1304(1992) [PubMed: 1741384] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [9] | "The SR protein B52/SRp55 is essential for Drosophila development." Ring H.Z., Lis J.T. Mol. Cell. Biol. 14:7499-7506(1994) [PubMed: 7935465] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE. |
| [10] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed: 18327897] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X58720 mRNA. Translation: CAA41556.1. X62599 mRNA. Translation: CAA44483.1. AE014297 Genomic DNA. Translation: AAF54968.1. AE014297 Genomic DNA. Translation: AAF54969.2. AE014297 Genomic DNA. Translation: AAN13575.1. AE014297 Genomic DNA. Translation: AAN13577.1. AE014297 Genomic DNA. Translation: AAN13578.1. AE014297 Genomic DNA. Translation: ACZ94900.1. AE014297 Genomic DNA. Translation: ACZ94901.1. AE014297 Genomic DNA. Translation: ACZ94902.1. AY069302 mRNA. Translation: AAL39447.1. AY113327 mRNA. Translation: AAM29332.1. BT001417 mRNA. Translation: AAN71172.1. BT001482 mRNA. Translation: AAN71237.1. Frameshift. BT001495 mRNA. Translation: AAN71250.1. BT001750 mRNA. Translation: AAN71505.1. BT003286 mRNA. Translation: AAO25044.1. BT004500 mRNA. Translation: AAO42664.1. BT125783 mRNA. Translation: ADQ89797.1. S51722 mRNA. Translation: AAB24629.1. |
| PIR | A37282. A40459. H48110. |
| RefSeq | NP_001163603.1. NM_001170132.1. NP_001163604.1. NM_001170133.1. NP_001163605.1. NM_001170134.1. NP_788665.1. NM_176488.2. NP_788666.1. NM_176489.2. NP_788668.1. NM_176491.2. NP_788669.1. NM_176492.3. NP_788670.1. NM_176493.3. |
| UniGene | Dm.2188. |
3D structure databases | |
| ProteinModelPortal | P26686. |
| SMR | P26686. Positions 4-192. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P26686. 3 interactions. |
| MINT | MINT-934286. |
| STRING | P26686. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 41670. |
| KEGG | dme:Dmel_CG10851. |
Organism-specific databases | |
| CTD | 41670. |
| FlyBase | FBgn0004587. B52. |
Phylogenomic databases | |
| eggNOG | inNOG06535. |
| GeneTree | EMGT00050000000447. |
| InParanoid | P26686. |
| OMA | DRNNESM. |
| OrthoDB | EOG4NK9C3. |
| PhylomeDB | P26686. |
Gene expression databases | |
| Bgee | P26686. |
| GermOnline | CG10851. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] |
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 2 hits. |
| KO | K12893. |
| Pfam | PF00076. RRM_1. 2 hits. [Graphical view] |
| SMART | SM00360. RRM. 2 hits. [Graphical view] |
| PROSITE | PS50102. RRM. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 824942. |
Entry information
| Entry name | SRR55_DROME | ||||||||
| Accession | Primary (citable) accession number: P26686 Secondary accession number(s): A4V2U2 Q9VFT1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with