Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Elongation factor 1-gamma

Gene

EEF1G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probably plays a role in anchoring the complex to other cellular components.

GO - Molecular functioni

GO - Biological processi

  • glutathione metabolic process Source: GO_Central
  • response to virus Source: UniProtKB
  • translational elongation Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Elongation factor

Keywords - Biological processi

Protein biosynthesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175601-MONOMER.
ReactomeiR-HSA-156842. Eukaryotic Translation Elongation.

Names & Taxonomyi

Protein namesi
Recommended name:
Elongation factor 1-gamma
Short name:
EF-1-gamma
Alternative name(s):
eEF-1B gamma
Gene namesi
Name:EEF1G
Synonyms:EF1G
ORF Names:PRO1608
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:3213. EEF1G.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi1937.
OpenTargetsiENSG00000254772.
PharmGKBiPA27649.

Polymorphism and mutation databases

BioMutaiEEF1G.
DMDMi119165.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources2 Publications
ChainiPRO_00002088132 – 437Elongation factor 1-gammaAdd BLAST436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei147N6-acetyllysineCombined sources1
Modified residuei212N6-acetyllysineBy similarity1
Cross-linki253Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei401N6-acetyllysineBy similarity1
Modified residuei434N6-acetyllysine; alternateCombined sources1
Modified residuei434N6-malonyllysine; alternate1 Publication1

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiP26641.
PaxDbiP26641.
PeptideAtlasiP26641.
PRIDEiP26641.
TopDownProteomicsiP26641-1. [P26641-1]

2D gel databases

OGPiP26641.

PTM databases

iPTMnetiP26641.
PhosphoSitePlusiP26641.
SwissPalmiP26641.

Expressioni

Tissue specificityi

Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.

Inductioni

Down-regulated in response to enterovirus 71 (EV71) infection.1 Publication

Gene expression databases

BgeeiENSG00000254772.
CleanExiHS_EEF1G.
ExpressionAtlasiP26641. baseline and differential.
GenevisibleiP26641. HS.

Organism-specific databases

HPAiHPA040688.

Interactioni

Subunit structurei

EF-1 is composed of four subunits: alpha, beta, delta, and gamma.

Binary interactionsi

WithEntry#Exp.IntActNotes
F4ZW623EBI-10177695,EBI-10177680
EEF1B2P245345EBI-351467,EBI-354334
EEF1DP296923EBI-10177695,EBI-358607
EEF1DP29692-23EBI-10177695,EBI-5280572
EEF1DP3Q658K84EBI-10177695,EBI-10248874
KLHL18O948893EBI-10177695,EBI-2510096
PLGRKTQ9HBL73EBI-10177695,EBI-714824
RBM6P783323EBI-10177695,EBI-2692323
TRIM63Q969Q12EBI-351467,EBI-5661333

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi108257. 160 interactors.
DIPiDIP-32516N.
IntActiP26641. 138 interactors.
MINTiMINT-1191315.
STRINGi9606.ENSP00000331901.

Structurei

Secondary structure

1437
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi279 – 281Combined sources3
Helixi290 – 299Combined sources10
Helixi302 – 304Combined sources3
Helixi306 – 311Combined sources6
Turni316 – 318Combined sources3
Beta strandi320 – 324Combined sources5
Helixi329 – 331Combined sources3
Helixi338 – 348Combined sources11
Helixi349 – 351Combined sources3
Helixi353 – 355Combined sources3
Beta strandi356 – 358Combined sources3
Beta strandi361 – 364Combined sources4
Beta strandi370 – 381Combined sources12
Helixi384 – 386Combined sources3
Helixi388 – 390Combined sources3
Helixi394 – 396Combined sources3
Helixi408 – 418Combined sources11
Turni424 – 426Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PBUNMR-A276-437[»]
5DQSX-ray2.10A2-218[»]
ProteinModelPortaliP26641.
SMRiP26641.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP26641.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 87GST N-terminalAdd BLAST86
Domaini88 – 216GST C-terminalAdd BLAST129
Domaini276 – 437EF-1-gamma C-terminalPROSITE-ProRule annotationAdd BLAST162

Sequence similaritiesi

Contains 1 EF-1-gamma C-terminal domain.PROSITE-ProRule annotation
Contains 1 GST C-terminal domain.Curated
Contains 1 GST N-terminal domain.Curated

Phylogenomic databases

eggNOGiKOG0867. Eukaryota.
KOG1627. Eukaryota.
COG0625. LUCA.
GeneTreeiENSGT00390000007552.
HOGENOMiHOG000235245.
HOVERGENiHBG051444.
InParanoidiP26641.
KOiK03233.
OMAiDGWSLWF.
OrthoDBiEOG091G06QR.
PhylomeDBiP26641.
TreeFamiTF314343.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.30.70.1010. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR004046. GST_C.
IPR012336. Thioredoxin-like_fold.
IPR001662. Transl_elong_EF1_G_con.
[Graphical view]
PfamiPF00647. EF1G. 1 hit.
PF00043. GST_C. 1 hit.
PF02798. GST_N. 1 hit.
[Graphical view]
SMARTiSM01183. EF1G. 1 hit.
[Graphical view]
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
SSF89942. SSF89942. 1 hit.
PROSITEiPS50040. EF1G_C. 1 hit.
PS50405. GST_CTER. 1 hit.
PS50404. GST_NTER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P26641-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAGTLYTYP ENWRAFKALI AAQYSGAQVR VLSAPPHFHF GQTNRTPEFL
60 70 80 90 100
RKFPAGKVPA FEGDDGFCVF ESNAIAYYVS NEELRGSTPE AAAQVVQWVS
110 120 130 140 150
FADSDIVPPA STWVFPTLGI MHHNKQATEN AKEEVRRILG LLDAYLKTRT
160 170 180 190 200
FLVGERVTLA DITVVCTLLW LYKQVLEPSF RQAFPNTNRW FLTCINQPQF
210 220 230 240 250
RAVLGEVKLC EKMAQFDAKK FAETQPKKDT PRKEKGSREE KQKPQAERKE
260 270 280 290 300
EKKAAAPAPE EEMDECEQAL AAEPKAKDPF AHLPKSTFVL DEFKRKYSNE
310 320 330 340 350
DTLSVALPYF WEHFDKDGWS LWYSEYRFPE ELTQTFMSCN LITGMFQRLD
360 370 380 390 400
KLRKNAFASV ILFGTNNSSS ISGVWVFRGQ ELAFPLSPDW QVDYESYTWR
410 420 430
KLDPGSEETQ TLVREYFSWE GAFQHVGKAF NQGKIFK
Length:437
Mass (Da):50,119
Last modified:January 23, 2007 - v3
Checksum:iA6110663110CF3FC
GO
Isoform 2 (identifier: P26641-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MAAG → MAERWVAPAVLRRARFASTFFLSPQIYAHKDGDLRSAFFILSFKRGEFIPFLNW

Note: No experimental confirmation available.
Show »
Length:487
Mass (Da):56,150
Checksum:i3FF3FDCBDAFE1A4C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102A → V in AAH13918 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0562041 – 4MAAG → MAERWVAPAVLRRARFASTF FLSPQIYAHKDGDLRSAFFI LSFKRGEFIPFLNW in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63526 mRNA. Translation: CAA45089.1.
Z11531 mRNA. Translation: CAA77630.1.
AK300203 mRNA. Translation: BAG61974.1.
AP001363 Genomic DNA. No translation available.
AP002990 Genomic DNA. No translation available.
BC000384 mRNA. Translation: AAH00384.1.
BC006509 mRNA. Translation: AAH06509.1.
BC006520 mRNA. Translation: AAH06520.1.
BC007949 mRNA. Translation: AAH07949.2.
BC009865 mRNA. Translation: AAH09865.1.
BC013918 mRNA. Translation: AAH13918.1.
BC015813 mRNA. Translation: AAH15813.1.
BC021974 mRNA. Translation: AAH21974.2.
BC028179 mRNA. Translation: AAH28179.1.
BC031012 mRNA. Translation: AAH31012.1.
BC067738 mRNA. Translation: AAH67738.1.
M55409 mRNA. Translation: AAC18414.1.
AF119850 mRNA. Translation: AAF69604.1.
CCDSiCCDS44626.1. [P26641-1]
PIRiS22655.
RefSeqiNP_001395.1. NM_001404.4. [P26641-1]
UniGeneiHs.144835.
Hs.444467.

Genome annotation databases

EnsembliENST00000329251; ENSP00000331901; ENSG00000254772. [P26641-1]
GeneIDi1937.
KEGGihsa:1937.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63526 mRNA. Translation: CAA45089.1.
Z11531 mRNA. Translation: CAA77630.1.
AK300203 mRNA. Translation: BAG61974.1.
AP001363 Genomic DNA. No translation available.
AP002990 Genomic DNA. No translation available.
BC000384 mRNA. Translation: AAH00384.1.
BC006509 mRNA. Translation: AAH06509.1.
BC006520 mRNA. Translation: AAH06520.1.
BC007949 mRNA. Translation: AAH07949.2.
BC009865 mRNA. Translation: AAH09865.1.
BC013918 mRNA. Translation: AAH13918.1.
BC015813 mRNA. Translation: AAH15813.1.
BC021974 mRNA. Translation: AAH21974.2.
BC028179 mRNA. Translation: AAH28179.1.
BC031012 mRNA. Translation: AAH31012.1.
BC067738 mRNA. Translation: AAH67738.1.
M55409 mRNA. Translation: AAC18414.1.
AF119850 mRNA. Translation: AAF69604.1.
CCDSiCCDS44626.1. [P26641-1]
PIRiS22655.
RefSeqiNP_001395.1. NM_001404.4. [P26641-1]
UniGeneiHs.144835.
Hs.444467.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PBUNMR-A276-437[»]
5DQSX-ray2.10A2-218[»]
ProteinModelPortaliP26641.
SMRiP26641.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108257. 160 interactors.
DIPiDIP-32516N.
IntActiP26641. 138 interactors.
MINTiMINT-1191315.
STRINGi9606.ENSP00000331901.

PTM databases

iPTMnetiP26641.
PhosphoSitePlusiP26641.
SwissPalmiP26641.

Polymorphism and mutation databases

BioMutaiEEF1G.
DMDMi119165.

2D gel databases

OGPiP26641.

Proteomic databases

EPDiP26641.
PaxDbiP26641.
PeptideAtlasiP26641.
PRIDEiP26641.
TopDownProteomicsiP26641-1. [P26641-1]

Protocols and materials databases

DNASUi1937.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329251; ENSP00000331901; ENSG00000254772. [P26641-1]
GeneIDi1937.
KEGGihsa:1937.

Organism-specific databases

CTDi1937.
DisGeNETi1937.
GeneCardsiEEF1G.
HGNCiHGNC:3213. EEF1G.
HPAiHPA040688.
MIMi130593. gene.
neXtProtiNX_P26641.
OpenTargetsiENSG00000254772.
PharmGKBiPA27649.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0867. Eukaryota.
KOG1627. Eukaryota.
COG0625. LUCA.
GeneTreeiENSGT00390000007552.
HOGENOMiHOG000235245.
HOVERGENiHBG051444.
InParanoidiP26641.
KOiK03233.
OMAiDGWSLWF.
OrthoDBiEOG091G06QR.
PhylomeDBiP26641.
TreeFamiTF314343.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175601-MONOMER.
ReactomeiR-HSA-156842. Eukaryotic Translation Elongation.

Miscellaneous databases

ChiTaRSiEEF1G. human.
EvolutionaryTraceiP26641.
GeneWikiiEEF1G.
GenomeRNAii1937.
PROiP26641.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000254772.
CleanExiHS_EEF1G.
ExpressionAtlasiP26641. baseline and differential.
GenevisibleiP26641. HS.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.30.70.1010. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR004046. GST_C.
IPR012336. Thioredoxin-like_fold.
IPR001662. Transl_elong_EF1_G_con.
[Graphical view]
PfamiPF00647. EF1G. 1 hit.
PF00043. GST_C. 1 hit.
PF02798. GST_N. 1 hit.
[Graphical view]
SMARTiSM01183. EF1G. 1 hit.
[Graphical view]
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
SSF89942. SSF89942. 1 hit.
PROSITEiPS50040. EF1G_C. 1 hit.
PS50405. GST_CTER. 1 hit.
PS50404. GST_NTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEF1G_HUMAN
AccessioniPrimary (citable) accession number: P26641
Secondary accession number(s): B4DTG2
, Q6PJ62, Q6PK31, Q96CU2, Q9P196
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 189 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.