Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Threonine--tRNA ligase, cytoplasmic

Gene

TARS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr).

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein homodimerization activity Source: UniProtKB
  • RNA binding Source: GO_Central
  • threonine-tRNA ligase activity Source: UniProtKB

GO - Biological processi

  • threonyl-tRNA aminoacylation Source: UniProtKB
  • translation Source: UniProtKB
  • tRNA aminoacylation for protein translation Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Aminoacyl-tRNA synthetase, Ligase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS03680-MONOMER.
BRENDAi6.1.1.3. 2681.
ReactomeiR-HSA-379716. Cytosolic tRNA aminoacylation.

Names & Taxonomyi

Protein namesi
Recommended name:
Threonine--tRNA ligase, cytoplasmic (EC:6.1.1.3)
Alternative name(s):
Threonyl-tRNA synthetase
Short name:
ThrRS
Gene namesi
Name:TARS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:11572. TARS.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: HPA
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi6897.
OpenTargetsiENSG00000113407.
PharmGKBiPA36337.

Chemistry databases

ChEMBLiCHEMBL3391.
DrugBankiDB00156. L-Threonine.

Polymorphism and mutation databases

BioMutaiTARS.
DMDMi60267755.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001011191 – 723Threonine--tRNA ligase, cytoplasmicAdd BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei39PhosphoserineCombined sources1
Modified residuei243N6-acetyllysineCombined sources1
Modified residuei246PhosphothreonineCombined sources1
Modified residuei298PhosphotyrosineCombined sources1
Modified residuei453PhosphothreonineCombined sources1
Modified residuei702PhosphoserineCombined sources1

Post-translational modificationi

ISGylated.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP26639.
MaxQBiP26639.
PaxDbiP26639.
PeptideAtlasiP26639.
PRIDEiP26639.

PTM databases

iPTMnetiP26639.
PhosphoSitePlusiP26639.
SwissPalmiP26639.

Expressioni

Gene expression databases

BgeeiENSG00000113407.
CleanExiHS_TARS.
ExpressionAtlasiP26639. baseline and differential.
GenevisibleiP26639. HS.

Organism-specific databases

HPAiHPA037425.

Interactioni

Subunit structurei

Homodimer.

Binary interactionsi

WithEntry#Exp.IntActNotes
C7orf25Q9BPX73EBI-1042683,EBI-718586
TARSL2A2RTX55EBI-1042683,EBI-1056629

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi112760. 80 interactors.
IntActiP26639. 20 interactors.
MINTiMINT-3010570.
STRINGi9606.ENSP00000265112.

Chemistry databases

BindingDBiP26639.

Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi82 – 86Combined sources5
Beta strandi92 – 96Combined sources5
Turni97 – 99Combined sources3
Helixi102 – 108Combined sources7
Turni111 – 113Combined sources3
Helixi114 – 116Combined sources3
Beta strandi120 – 127Combined sources8
Beta strandi129 – 131Combined sources3
Beta strandi135 – 141Combined sources7
Helixi323 – 329Combined sources7
Beta strandi332 – 334Combined sources3
Helixi347 – 366Combined sources20
Beta strandi376 – 379Combined sources4
Helixi380 – 385Combined sources6
Helixi388 – 391Combined sources4
Helixi393 – 395Combined sources3
Beta strandi398 – 401Combined sources4
Beta strandi404 – 408Combined sources5
Helixi413 – 421Combined sources9
Helixi427 – 429Combined sources3
Beta strandi431 – 436Combined sources6
Beta strandi439 – 441Combined sources3
Helixi446 – 448Combined sources3
Turni451 – 453Combined sources3
Beta strandi456 – 459Combined sources4
Beta strandi462 – 467Combined sources6
Helixi469 – 471Combined sources3
Helixi472 – 490Combined sources19
Beta strandi493 – 499Combined sources7
Helixi509 – 525Combined sources17
Beta strandi530 – 533Combined sources4
Beta strandi543 – 549Combined sources7
Beta strandi555 – 565Combined sources11
Helixi566 – 570Combined sources5
Beta strandi587 – 595Combined sources9
Helixi597 – 607Combined sources11
Turni608 – 610Combined sources3
Helixi614 – 616Combined sources3
Beta strandi621 – 627Combined sources7
Helixi628 – 630Combined sources3
Helixi631 – 642Combined sources12
Turni643 – 645Combined sources3
Beta strandi648 – 650Combined sources3
Helixi658 – 667Combined sources10
Beta strandi671 – 676Combined sources6
Helixi678 – 683Combined sources6
Beta strandi685 – 690Combined sources6
Beta strandi695 – 700Combined sources6
Helixi701 – 713Combined sources13
Helixi719 – 722Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WWTNMR-A79-153[»]
4HWTX-ray2.30A/B321-723[»]
4P3NX-ray2.60A/B/C/D322-723[»]
4TTVX-ray2.80A/B/C/D322-723[»]
ProteinModelPortaliP26639.
SMRiP26639.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP26639.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1637. Eukaryota.
COG0441. LUCA.
GeneTreeiENSGT00390000002149.
HOGENOMiHOG000003878.
HOVERGENiHBG059513.
InParanoidiP26639.
KOiK01868.
OMAiPYEVARG.
OrthoDBiEOG091G01UL.
PhylomeDBiP26639.
TreeFamiTF300858.

Family and domain databases

CDDicd00771. ThrRS_core. 1 hit.
Gene3Di3.10.20.30. 1 hit.
3.40.50.800. 1 hit.
HAMAPiMF_00184. Thr_tRNA_synth. 1 hit.
InterProiIPR002314. aa-tRNA-synt_IIb.
IPR006195. aa-tRNA-synth_II.
IPR004154. Anticodon-bd.
IPR012675. Beta-grasp_dom.
IPR004095. TGS.
IPR012676. TGS-like.
IPR002320. Thr-tRNA-ligase_IIa.
IPR018163. Thr/Ala-tRNA-synth_IIc_edit.
IPR033728. ThrRS_core.
IPR012947. tRNA_SAD.
[Graphical view]
PfamiPF03129. HGTP_anticodon. 1 hit.
PF02824. TGS. 1 hit.
PF00587. tRNA-synt_2b. 1 hit.
PF07973. tRNA_SAD. 1 hit.
[Graphical view]
PRINTSiPR01047. TRNASYNTHTHR.
SMARTiSM00863. tRNA_SAD. 1 hit.
[Graphical view]
SUPFAMiSSF52954. SSF52954. 1 hit.
SSF55186. SSF55186. 1 hit.
SSF81271. SSF81271. 1 hit.
TIGRFAMsiTIGR00418. thrS. 1 hit.
PROSITEiPS50862. AA_TRNA_LIGASE_II. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P26639-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFEEKASSPS GKMGGEEKPI GAGEEKQKEG GKKKNKEGSG DGGRAELNPW
60 70 80 90 100
PEYIYTRLEM YNILKAEHDS ILAEKAEKDS KPIKVTLPDG KQVDAESWKT
110 120 130 140 150
TPYQIACGIS QGLADNTVIA KVNNVVWDLD RPLEEDCTLE LLKFEDEEAQ
160 170 180 190 200
AVYWHSSAHI MGEAMERVYG GCLCYGPPIE NGFYYDMYLE EGGVSSNDFS
210 220 230 240 250
SLEALCKKII KEKQAFERLE VKKETLLAMF KYNKFKCRIL NEKVNTPTTT
260 270 280 290 300
VYRCGPLIDL CRGPHVRHTG KIKALKIHKN SSTYWEGKAD METLQRIYGI
310 320 330 340 350
SFPDPKMLKE WEKFQEEAKN RDHRKIGRDQ ELYFFHELSP GSCFFLPKGA
360 370 380 390 400
YIYNALIEFI RSEYRKRGFQ EVVTPNIFNS RLWMTSGHWQ HYSENMFSFE
410 420 430 440 450
VEKELFALKP MNCPGHCLMF DHRPRSWREL PLRLADFGVL HRNELSGALT
460 470 480 490 500
GLTRVRRFQQ DDAHIFCAME QIEDEIKGCL DFLRTVYSVF GFSFKLNLST
510 520 530 540 550
RPEKFLGDIE VWDQAEKQLE NSLNEFGEKW ELNSGDGAFY GPKIDIQIKD
560 570 580 590 600
AIGRYHQCAT IQLDFQLPIR FNLTYVSHDG DDKKRPVIVH RAILGSVERM
610 620 630 640 650
IAILTENYGG KWPFWLSPRQ VMVVPVGPTC DEYAQKVRQQ FHDAKFMADI
660 670 680 690 700
DLDPGCTLNK KIRNAQLAQY NFILVVGEKE KISGTVNIRT RDNKVHGERT
710 720
ISETIERLQQ LKEFRSKQAE EEF
Length:723
Mass (Da):83,435
Last modified:February 15, 2005 - v3
Checksum:i885745118972C5A9
GO
Isoform 2 (identifier: P26639-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-110: S → SHTASCKNLSSLASLLASVAIPSSGMPWPPLFFL

Show »
Length:756
Mass (Da):86,861
Checksum:iE3516F3A14CBC746
GO

Sequence cautioni

The sequence AAB04939 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti164A → G in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti350A → V in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti417C → S in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti439V → G in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti453T → I in AAH10578 (PubMed:15489334).Curated1
Sequence conflicti581D → E in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti612W → LA in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti636K → N in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti683S → T in AAB04939 (PubMed:2033077).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03453321G → D.Corresponds to variant rs34334786dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045114110S → SHTASCKNLSSLASLLASVA IPSSGMPWPPLFFL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63180 mRNA. Translation: AAB04939.1. Different initiation.
AK292346 mRNA. Translation: BAF85035.1.
AK293620 mRNA. Translation: BAG57079.1.
AC025441 Genomic DNA. No translation available.
AC034231 Genomic DNA. No translation available.
CH471118 Genomic DNA. Translation: EAX10804.1.
BC000517 mRNA. Translation: AAH00517.2.
BC010578 mRNA. Translation: AAH10578.2.
CCDSiCCDS3899.1. [P26639-1]
CCDS58943.1. [P26639-2]
PIRiA38867. YSHUT.
RefSeqiNP_001245366.1. NM_001258437.1. [P26639-1]
NP_001245367.1. NM_001258438.1. [P26639-2]
NP_689508.3. NM_152295.4. [P26639-1]
UniGeneiHs.481860.

Genome annotation databases

EnsembliENST00000265112; ENSP00000265112; ENSG00000113407. [P26639-1]
ENST00000455217; ENSP00000387710; ENSG00000113407. [P26639-2]
ENST00000502553; ENSP00000424387; ENSG00000113407. [P26639-1]
GeneIDi6897.
KEGGihsa:6897.
UCSCiuc003jhy.5. human. [P26639-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63180 mRNA. Translation: AAB04939.1. Different initiation.
AK292346 mRNA. Translation: BAF85035.1.
AK293620 mRNA. Translation: BAG57079.1.
AC025441 Genomic DNA. No translation available.
AC034231 Genomic DNA. No translation available.
CH471118 Genomic DNA. Translation: EAX10804.1.
BC000517 mRNA. Translation: AAH00517.2.
BC010578 mRNA. Translation: AAH10578.2.
CCDSiCCDS3899.1. [P26639-1]
CCDS58943.1. [P26639-2]
PIRiA38867. YSHUT.
RefSeqiNP_001245366.1. NM_001258437.1. [P26639-1]
NP_001245367.1. NM_001258438.1. [P26639-2]
NP_689508.3. NM_152295.4. [P26639-1]
UniGeneiHs.481860.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WWTNMR-A79-153[»]
4HWTX-ray2.30A/B321-723[»]
4P3NX-ray2.60A/B/C/D322-723[»]
4TTVX-ray2.80A/B/C/D322-723[»]
ProteinModelPortaliP26639.
SMRiP26639.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112760. 80 interactors.
IntActiP26639. 20 interactors.
MINTiMINT-3010570.
STRINGi9606.ENSP00000265112.

Chemistry databases

BindingDBiP26639.
ChEMBLiCHEMBL3391.
DrugBankiDB00156. L-Threonine.

PTM databases

iPTMnetiP26639.
PhosphoSitePlusiP26639.
SwissPalmiP26639.

Polymorphism and mutation databases

BioMutaiTARS.
DMDMi60267755.

Proteomic databases

EPDiP26639.
MaxQBiP26639.
PaxDbiP26639.
PeptideAtlasiP26639.
PRIDEiP26639.

Protocols and materials databases

DNASUi6897.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265112; ENSP00000265112; ENSG00000113407. [P26639-1]
ENST00000455217; ENSP00000387710; ENSG00000113407. [P26639-2]
ENST00000502553; ENSP00000424387; ENSG00000113407. [P26639-1]
GeneIDi6897.
KEGGihsa:6897.
UCSCiuc003jhy.5. human. [P26639-1]

Organism-specific databases

CTDi6897.
DisGeNETi6897.
GeneCardsiTARS.
H-InvDBHIX0004790.
HGNCiHGNC:11572. TARS.
HPAiHPA037425.
MIMi187790. gene.
neXtProtiNX_P26639.
OpenTargetsiENSG00000113407.
PharmGKBiPA36337.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1637. Eukaryota.
COG0441. LUCA.
GeneTreeiENSGT00390000002149.
HOGENOMiHOG000003878.
HOVERGENiHBG059513.
InParanoidiP26639.
KOiK01868.
OMAiPYEVARG.
OrthoDBiEOG091G01UL.
PhylomeDBiP26639.
TreeFamiTF300858.

Enzyme and pathway databases

BioCyciZFISH:HS03680-MONOMER.
BRENDAi6.1.1.3. 2681.
ReactomeiR-HSA-379716. Cytosolic tRNA aminoacylation.

Miscellaneous databases

ChiTaRSiTARS. human.
EvolutionaryTraceiP26639.
GeneWikiiTARS_(gene).
GenomeRNAii6897.
PROiP26639.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000113407.
CleanExiHS_TARS.
ExpressionAtlasiP26639. baseline and differential.
GenevisibleiP26639. HS.

Family and domain databases

CDDicd00771. ThrRS_core. 1 hit.
Gene3Di3.10.20.30. 1 hit.
3.40.50.800. 1 hit.
HAMAPiMF_00184. Thr_tRNA_synth. 1 hit.
InterProiIPR002314. aa-tRNA-synt_IIb.
IPR006195. aa-tRNA-synth_II.
IPR004154. Anticodon-bd.
IPR012675. Beta-grasp_dom.
IPR004095. TGS.
IPR012676. TGS-like.
IPR002320. Thr-tRNA-ligase_IIa.
IPR018163. Thr/Ala-tRNA-synth_IIc_edit.
IPR033728. ThrRS_core.
IPR012947. tRNA_SAD.
[Graphical view]
PfamiPF03129. HGTP_anticodon. 1 hit.
PF02824. TGS. 1 hit.
PF00587. tRNA-synt_2b. 1 hit.
PF07973. tRNA_SAD. 1 hit.
[Graphical view]
PRINTSiPR01047. TRNASYNTHTHR.
SMARTiSM00863. tRNA_SAD. 1 hit.
[Graphical view]
SUPFAMiSSF52954. SSF52954. 1 hit.
SSF55186. SSF55186. 1 hit.
SSF81271. SSF81271. 1 hit.
TIGRFAMsiTIGR00418. thrS. 1 hit.
PROSITEiPS50862. AA_TRNA_LIGASE_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSYTC_HUMAN
AccessioniPrimary (citable) accession number: P26639
Secondary accession number(s): A8K8I1
, B4DEG8, Q96FP5, Q9BWA6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 15, 2005
Last modified: November 30, 2016
This is version 185 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.