Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P26232

- CTNA2_HUMAN

UniProt

P26232 - CTNA2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Catenin alpha-2

Gene

CTNNA2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation (By similarity).By similarity

GO - Molecular functioni

  1. structural constituent of cytoskeleton Source: UniProtKB

GO - Biological processi

  1. axonogenesis Source: UniProtKB
  2. brain morphogenesis Source: UniProtKB
  3. dendrite morphogenesis Source: UniProtKB
  4. muscle cell differentiation Source: Reactome
  5. positive regulation of muscle cell differentiation Source: Reactome
  6. prepulse inhibition Source: UniProtKB
  7. radial glia guided migration of Purkinje cell Source: UniProtKB
  8. regulation of synapse structural plasticity Source: UniProtKB
  9. single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation

Enzyme and pathway databases

ReactomeiREACT_21402. CDO in myogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Catenin alpha-2
Alternative name(s):
Alpha N-catenin
Alpha-catenin-related protein
Gene namesi
Name:CTNNA2
Synonyms:CAPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:2510. CTNNA2.

Subcellular locationi

Cytoplasm 1 Publication. Cytoplasmcytoskeleton By similarity. Cell junctionadherens junction By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. Cell projectionaxon By similarity
Note: Recruited to the nucleus upon ZNF639 overexpression.

GO - Cellular componenti

  1. actin cytoskeleton Source: InterPro
  2. adherens junction Source: UniProtKB
  3. axon Source: UniProtKB
  4. basolateral plasma membrane Source: Ensembl
  5. cell-cell adherens junction Source: Ensembl
  6. cytoplasm Source: UniProtKB
  7. cytosol Source: Reactome
  8. lamellipodium Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27013.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 953953Catenin alpha-2PRO_0000064263Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei640 – 6401Phosphoserine1 Publication
Modified residuei901 – 9011PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP26232.
PaxDbiP26232.
PRIDEiP26232.

PTM databases

PhosphoSiteiP26232.

Expressioni

Gene expression databases

BgeeiP26232.
CleanExiHS_CTNNA2.
ExpressionAtlasiP26232. baseline.
GenevestigatoriP26232.

Organism-specific databases

HPAiCAB037175.
HPA019162.

Interactioni

Subunit structurei

Interacts with ZNF639.1 Publication

Protein-protein interaction databases

BioGridi107877. 8 interactions.
DIPiDIP-60979N.
IntActiP26232. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliP26232.
SMRiP26232. Positions 18-924.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the vinculin/alpha-catenin family.Curated

Phylogenomic databases

eggNOGiNOG240050.
GeneTreeiENSGT00550000074411.
HOVERGENiHBG000069.
InParanoidiP26232.
KOiK05691.
OMAiMVRAARN.
OrthoDBiEOG7HQN7B.
PhylomeDBiP26232.
TreeFamiTF313686.

Family and domain databases

InterProiIPR001033. Alpha_catenin.
IPR006077. Vinculin/catenin.
IPR000633. Vinculin_CS.
[Graphical view]
PANTHERiPTHR18914. PTHR18914. 1 hit.
PfamiPF01044. Vinculin. 2 hits.
[Graphical view]
PRINTSiPR00805. ALPHACATENIN.
SUPFAMiSSF47220. SSF47220. 5 hits.
PROSITEiPS00663. VINCULIN_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P26232-1) [UniParc]FASTAAdd to Basket

Also known as: AlphaN-catenin II

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK
60 70 80 90 100
KGRSKKAHVL AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG
110 120 130 140 150
ETMRIASSEF ADDPCSSVKR GTMVRAARAL LSAVTRLLIL ADMADVMRLL
160 170 180 190 200
SHLKIVEEAL EAVKNATNEQ DLANRFKEFG KEMVKLNYVA ARRQQELKDP
210 220 230 240 250
HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR DYVFKQVQEA
260 270 280 290 300
IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR
310 320 330 340 350
PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM
360 370 380 390 400
NNTGRKEKGD PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL
410 420 430 440 450
VLIEAAKSGN EKEVKEYAQV FREHANKLVE VANLACSISN NEEGVKLVRM
460 470 480 490 500
AATQIDSLCP QVINAALTLA ARPQSKVAQD NMDVFKDQWE KQVRVLTEAV
510 520 530 540 550
DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA GAIRGRAARV
560 570 580 590 600
IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV
610 620 630 640 650
PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR
660 670 680 690 700
SRTSVQTEDD QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE
710 720 730 740 750
VAKWDDSGND IIVLAKQMCM IMMEMTDFTR GKGPLKNTSD VINAAKKIAE
760 770 780 790 800
AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ RIALYCHQLN ICSKVKAEVQ
810 820 830 840 850
NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL PTCAEGAPIG
860 870 880 890 900
SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN
910 920 930 940 950
SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM

DSF
Length:953
Mass (Da):105,313
Last modified:January 23, 2007 - v5
Checksum:i5FC88907B37E8A6C
GO
Isoform 2 (identifier: P26232-2) [UniParc]FASTAAdd to Basket

Also known as: AlphaN-catenin I

The sequence of this isoform differs from the canonical sequence as follows:
     811-858: Missing.

Show »
Length:905
Mass (Da):100,447
Checksum:iECDB5DA119B443CF
GO
Isoform 3 (identifier: P26232-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     766-858: Missing.

Note: No experimental confirmation available.

Show »
Length:860
Mass (Da):95,558
Checksum:i33963B324E2787FE
GO
Isoform 4 (identifier: P26232-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-368: Missing.
     811-858: Missing.

Show »
Length:537
Mass (Da):59,868
Checksum:i71B24F41F0B4D6FB
GO
Isoform 5 (identifier: P26232-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
     811-858: Missing.

Note: No experimental confirmation available.

Show »
Length:939
Mass (Da):104,273
Checksum:i4B4AF75F8A539C5B
GO
Isoform 6 (identifier: P26232-6) [UniParc]FASTAAdd to Basket

Also known as: AlphaN-catenin III

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
     811-858: Missing.

Show »
Length:584
Mass (Da):65,111
Checksum:iA3A1391C89740337
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti122 – 1221T → A in BAH12003. (PubMed:14702039)Curated
Sequence conflicti182 – 1821E → K in AAA58407. (PubMed:8432524)Curated
Sequence conflicti309 – 3091S → SS in AAY15008. (PubMed:15815621)Curated
Sequence conflicti651 – 6522SR → RG in AAA58407. (PubMed:8432524)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 368368Missing in isoform 4. 1 PublicationVSP_038008Add
BLAST
Alternative sequencei1 – 351351Missing in isoform 6. 1 PublicationVSP_038005Add
BLAST
Alternative sequencei1 – 11M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. 1 PublicationVSP_038007
Alternative sequencei352 – 3521N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. 1 PublicationVSP_038006
Alternative sequencei766 – 85893Missing in isoform 3. 1 PublicationVSP_038009Add
BLAST
Alternative sequencei811 – 85848Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_020337Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA. Translation: AAA58407.2.
AK127226 mRNA. Translation: BAG54457.1.
AK295181 mRNA. Translation: BAH12003.1.
AK295493 mRNA. Translation: BAH12088.1.
AK303035 mRNA. Translation: BAH13884.1.
BX537769 mRNA. Translation: CAD97832.1.
AC008067 Genomic DNA. Translation: AAY15073.1.
AC010975 Genomic DNA. No translation available.
AC011741 Genomic DNA. Translation: AAX93241.1.
AC011746 Genomic DNA. Translation: AAY15008.1.
AC016670 Genomic DNA. No translation available.
AC016716 Genomic DNA. No translation available.
AC093322 Genomic DNA. No translation available.
AC096573 Genomic DNA. Translation: AAY14758.1.
AC096753 Genomic DNA. Translation: AAY14763.1.
AC104780 Genomic DNA. Translation: AAX88946.1.
FJ695201 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99564.1.
CH471053 Genomic DNA. Translation: EAW99565.1.
BC052996 mRNA. Translation: AAH52996.1.
CCDSiCCDS42703.2. [P26232-2]
CCDS62944.1. [P26232-1]
CCDS62945.1. [P26232-6]
CCDS74531.1. [P26232-4]
PIRiA45011.
RefSeqiNP_001158355.1. NM_001164883.1. [P26232-3]
NP_001269526.1. NM_001282597.2. [P26232-1]
NP_001269527.1. NM_001282598.1. [P26232-5]
NP_001269528.1. NM_001282599.1. [P26232-6]
NP_001269529.1. NM_001282600.1. [P26232-4]
NP_004380.2. NM_004389.3. [P26232-2]
UniGeneiHs.167368.

Genome annotation databases

EnsembliENST00000343114; ENSP00000341500; ENSG00000066032. [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032. [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032. [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032. [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032. [P26232-4]
GeneIDi1496.
KEGGihsa:1496.
UCSCiuc010yse.2. human. [P26232-2]
uc010ysg.2. human. [P26232-3]
uc010ysh.2. human. [P26232-1]

Polymorphism databases

DMDMi114152793.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA. Translation: AAA58407.2 .
AK127226 mRNA. Translation: BAG54457.1 .
AK295181 mRNA. Translation: BAH12003.1 .
AK295493 mRNA. Translation: BAH12088.1 .
AK303035 mRNA. Translation: BAH13884.1 .
BX537769 mRNA. Translation: CAD97832.1 .
AC008067 Genomic DNA. Translation: AAY15073.1 .
AC010975 Genomic DNA. No translation available.
AC011741 Genomic DNA. Translation: AAX93241.1 .
AC011746 Genomic DNA. Translation: AAY15008.1 .
AC016670 Genomic DNA. No translation available.
AC016716 Genomic DNA. No translation available.
AC093322 Genomic DNA. No translation available.
AC096573 Genomic DNA. Translation: AAY14758.1 .
AC096753 Genomic DNA. Translation: AAY14763.1 .
AC104780 Genomic DNA. Translation: AAX88946.1 .
FJ695201 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99564.1 .
CH471053 Genomic DNA. Translation: EAW99565.1 .
BC052996 mRNA. Translation: AAH52996.1 .
CCDSi CCDS42703.2. [P26232-2 ]
CCDS62944.1. [P26232-1 ]
CCDS62945.1. [P26232-6 ]
CCDS74531.1. [P26232-4 ]
PIRi A45011.
RefSeqi NP_001158355.1. NM_001164883.1. [P26232-3 ]
NP_001269526.1. NM_001282597.2. [P26232-1 ]
NP_001269527.1. NM_001282598.1. [P26232-5 ]
NP_001269528.1. NM_001282599.1. [P26232-6 ]
NP_001269529.1. NM_001282600.1. [P26232-4 ]
NP_004380.2. NM_004389.3. [P26232-2 ]
UniGenei Hs.167368.

3D structure databases

ProteinModelPortali P26232.
SMRi P26232. Positions 18-924.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107877. 8 interactions.
DIPi DIP-60979N.
IntActi P26232. 3 interactions.

PTM databases

PhosphoSitei P26232.

Polymorphism databases

DMDMi 114152793.

Proteomic databases

MaxQBi P26232.
PaxDbi P26232.
PRIDEi P26232.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343114 ; ENSP00000341500 ; ENSG00000066032 . [P26232-6 ]
ENST00000402739 ; ENSP00000384638 ; ENSG00000066032 . [P26232-1 ]
ENST00000466387 ; ENSP00000418191 ; ENSG00000066032 . [P26232-2 ]
ENST00000496558 ; ENSP00000419295 ; ENSG00000066032 . [P26232-2 ]
ENST00000541047 ; ENSP00000444675 ; ENSG00000066032 . [P26232-4 ]
GeneIDi 1496.
KEGGi hsa:1496.
UCSCi uc010yse.2. human. [P26232-2 ]
uc010ysg.2. human. [P26232-3 ]
uc010ysh.2. human. [P26232-1 ]

Organism-specific databases

CTDi 1496.
GeneCardsi GC02P079412.
HGNCi HGNC:2510. CTNNA2.
HPAi CAB037175.
HPA019162.
MIMi 114025. gene.
neXtProti NX_P26232.
PharmGKBi PA27013.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG240050.
GeneTreei ENSGT00550000074411.
HOVERGENi HBG000069.
InParanoidi P26232.
KOi K05691.
OMAi MVRAARN.
OrthoDBi EOG7HQN7B.
PhylomeDBi P26232.
TreeFami TF313686.

Enzyme and pathway databases

Reactomei REACT_21402. CDO in myogenesis.

Miscellaneous databases

ChiTaRSi CTNNA2. human.
GenomeRNAii 1496.
NextBioi 6149.
PROi P26232.
SOURCEi Search...

Gene expression databases

Bgeei P26232.
CleanExi HS_CTNNA2.
ExpressionAtlasi P26232. baseline.
Genevestigatori P26232.

Family and domain databases

InterProi IPR001033. Alpha_catenin.
IPR006077. Vinculin/catenin.
IPR000633. Vinculin_CS.
[Graphical view ]
PANTHERi PTHR18914. PTHR18914. 1 hit.
Pfami PF01044. Vinculin. 2 hits.
[Graphical view ]
PRINTSi PR00805. ALPHACATENIN.
SUPFAMi SSF47220. SSF47220. 5 hits.
PROSITEi PS00663. VINCULIN_1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization and chromosomal assignment of a human cDNA encoding a protein related to the murine 102-kDa cadherin-associated protein (alpha-catenin)."
    Claverie J.-M., Hardelin J.-P., Legouis R., Levilliers J., Bougueleret L., Mattei M.-G., Petit C.
    Genomics 15:13-20(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Hardelin J.-P.
    Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION TO C-TERMINUS.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Brain, Hippocampus and Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Hippocampus.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: PNS.
  8. "Nuclear translocation of alphaN-catenin by the novel zinc finger transcriptional repressor ZASC1."
    Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F.
    Exp. Cell Res. 311:1-13(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ZNF639, SUBCELLULAR LOCATION.
  9. Cited for: ALTERNATIVE SPLICING (ISOFORM 6).
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-640, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCTNA2_HUMAN
AccessioniPrimary (citable) accession number: P26232
Secondary accession number(s): B3KXE5
, B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 140 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3