Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P26232 (CTNA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Catenin alpha-2
Alternative name(s):
Alpha N-catenin
Alpha-catenin-related protein
Gene names
Name:CTNNA2
Synonyms:CAPR
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length953 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation By similarity.

Subunit structure

Interacts with ZNF639. Ref.8

Subcellular location

Cytoplasm. Cytoplasmcytoskeleton By similarity. Cell junctionadherens junction By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cell projectionaxon By similarity. Note: Recruited to the nucleus upon ZNF639 overexpression. Ref.8

Sequence similarities

Belongs to the vinculin/alpha-catenin family.

Ontologies

Keywords
   Biological processCell adhesion
Differentiation
   Cellular componentCell junction
Cell membrane
Cell projection
Cytoplasm
Cytoskeleton
Membrane
   Coding sequence diversityAlternative splicing
   Molecular functionDevelopmental protein
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processaxonogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

brain morphogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

dendrite morphogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

muscle cell differentiation

Traceable author statement. Source: Reactome

positive regulation of muscle cell differentiation

Traceable author statement. Source: Reactome

prepulse inhibition

Inferred from sequence or structural similarity. Source: UniProtKB

radial glia guided migration of Purkinje cell

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of synapse structural plasticity

Inferred from sequence or structural similarity. Source: UniProtKB

single organismal cell-cell adhesion

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentactin cytoskeleton

Inferred from electronic annotation. Source: InterPro

adherens junction

Inferred from sequence or structural similarity. Source: UniProtKB

axon

Inferred from sequence or structural similarity. Source: UniProtKB

basolateral plasma membrane

Inferred from electronic annotation. Source: Ensembl

cell-cell adherens junction

Inferred from electronic annotation. Source: Ensembl

cytoplasm

Inferred from direct assay Ref.8. Source: UniProtKB

cytosol

Traceable author statement. Source: Reactome

lamellipodium

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionprotein binding

Inferred from physical interaction Ref.8. Source: UniProtKB

structural constituent of cytoskeleton

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P26232-1)

Also known as: AlphaN-catenin II;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P26232-2)

Also known as: AlphaN-catenin I;

The sequence of this isoform differs from the canonical sequence as follows:
     811-858: Missing.
Isoform 3 (identifier: P26232-3)

The sequence of this isoform differs from the canonical sequence as follows:
     766-858: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: P26232-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-368: Missing.
     811-858: Missing.
Isoform 5 (identifier: P26232-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
     811-858: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: P26232-6)

Also known as: AlphaN-catenin III;

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
     811-858: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 953953Catenin alpha-2
PRO_0000064263

Amino acid modifications

Modified residue6401Phosphoserine Ref.10
Modified residue9011Phosphoserine By similarity

Natural variations

Alternative sequence1 – 368368Missing in isoform 4.
VSP_038008
Alternative sequence1 – 351351Missing in isoform 6.
VSP_038005
Alternative sequence11M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5.
VSP_038007
Alternative sequence3521N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6.
VSP_038006
Alternative sequence766 – 85893Missing in isoform 3.
VSP_038009
Alternative sequence811 – 85848Missing in isoform 2, isoform 4, isoform 5 and isoform 6.
VSP_020337

Experimental info

Sequence conflict1221T → A in BAH12003. Ref.3
Sequence conflict1821E → K in AAA58407. Ref.1
Sequence conflict3091S → SS in AAY15008. Ref.5
Sequence conflict651 – 6522SR → RG in AAA58407. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (AlphaN-catenin II) [UniParc].

Last modified January 23, 2007. Version 5.
Checksum: 5FC88907B37E8A6C

FASTA953105,313
        10         20         30         40         50         60 
MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK KGRSKKAHVL 

        70         80         90        100        110        120 
AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG ETMRIASSEF ADDPCSSVKR 

       130        140        150        160        170        180 
GTMVRAARAL LSAVTRLLIL ADMADVMRLL SHLKIVEEAL EAVKNATNEQ DLANRFKEFG 

       190        200        210        220        230        240 
KEMVKLNYVA ARRQQELKDP HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR 

       250        260        270        280        290        300 
DYVFKQVQEA IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR 

       310        320        330        340        350        360 
PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM NNTGRKEKGD 

       370        380        390        400        410        420 
PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL VLIEAAKSGN EKEVKEYAQV 

       430        440        450        460        470        480 
FREHANKLVE VANLACSISN NEEGVKLVRM AATQIDSLCP QVINAALTLA ARPQSKVAQD 

       490        500        510        520        530        540 
NMDVFKDQWE KQVRVLTEAV DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA 

       550        560        570        580        590        600 
GAIRGRAARV IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV 

       610        620        630        640        650        660 
PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR SRTSVQTEDD 

       670        680        690        700        710        720 
QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE VAKWDDSGND IIVLAKQMCM 

       730        740        750        760        770        780 
IMMEMTDFTR GKGPLKNTSD VINAAKKIAE AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ 

       790        800        810        820        830        840 
RIALYCHQLN ICSKVKAEVQ NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL 

       850        860        870        880        890        900 
PTCAEGAPIG SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN 

       910        920        930        940        950 
SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM DSF 

« Hide

Isoform 2 (AlphaN-catenin I) [UniParc].

Checksum: ECDB5DA119B443CF
Show »

FASTA905100,447
Isoform 3 [UniParc].

Checksum: 33963B324E2787FE
Show »

FASTA86095,558
Isoform 4 [UniParc].

Checksum: 71B24F41F0B4D6FB
Show »

FASTA53759,868
Isoform 5 [UniParc].

Checksum: 4B4AF75F8A539C5B
Show »

FASTA939104,273
Isoform 6 (AlphaN-catenin III) [UniParc].

Checksum: A3A1391C89740337
Show »

FASTA58465,111

References

« Hide 'large scale' references
[1]"Characterization and chromosomal assignment of a human cDNA encoding a protein related to the murine 102-kDa cadherin-associated protein (alpha-catenin)."
Claverie J.-M., Hardelin J.-P., Legouis R., Levilliers J., Bougueleret L., Mattei M.-G., Petit C.
Genomics 15:13-20(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]Hardelin J.-P.
Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION TO C-TERMINUS.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
Tissue: Brain, Hippocampus and Testis.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Hippocampus.
[5]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: PNS.
[8]"Nuclear translocation of alphaN-catenin by the novel zinc finger transcriptional repressor ZASC1."
Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F.
Exp. Cell Res. 311:1-13(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ZNF639, SUBCELLULAR LOCATION.
[9]"Regulation of a novel alphaN-catenin splice variant in schizophrenic smokers."
Mexal S., Berger R., Pearce L., Barton A., Logel J., Adams C.E., Ross R.G., Freedman R., Leonard S.
Am. J. Med. Genet. B Neuropsychiatr. Genet. 147:759-768(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORM 6).
[10]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-640, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M94151 mRNA. Translation: AAA58407.2.
AK127226 mRNA. Translation: BAG54457.1.
AK295181 mRNA. Translation: BAH12003.1.
AK295493 mRNA. Translation: BAH12088.1.
AK303035 mRNA. Translation: BAH13884.1.
BX537769 mRNA. Translation: CAD97832.1.
AC008067 Genomic DNA. Translation: AAY15073.1.
AC010975 Genomic DNA. No translation available.
AC011741 Genomic DNA. Translation: AAX93241.1.
AC011746 Genomic DNA. Translation: AAY15008.1.
AC016670 Genomic DNA. No translation available.
AC016716 Genomic DNA. No translation available.
AC093322 Genomic DNA. No translation available.
AC096573 Genomic DNA. Translation: AAY14758.1.
AC096753 Genomic DNA. Translation: AAY14763.1.
AC104780 Genomic DNA. Translation: AAX88946.1.
FJ695201 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99564.1.
CH471053 Genomic DNA. Translation: EAW99565.1.
BC052996 mRNA. Translation: AAH52996.1.
CCDSCCDS42703.2. [P26232-2]
CCDS54371.1. [P26232-3]
CCDS62944.1. [P26232-1]
CCDS62945.1. [P26232-6]
PIRA45011.
RefSeqNP_001158355.1. NM_001164883.1. [P26232-3]
NP_001269526.1. NM_001282597.1. [P26232-1]
NP_001269527.1. NM_001282598.1. [P26232-5]
NP_001269528.1. NM_001282599.1. [P26232-6]
NP_001269529.1. NM_001282600.1. [P26232-4]
NP_004380.2. NM_004389.3. [P26232-2]
UniGeneHs.167368.

3D structure databases

ProteinModelPortalP26232.
SMRP26232. Positions 14-924.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107877. 4 interactions.
IntActP26232. 3 interactions.

PTM databases

PhosphoSiteP26232.

Polymorphism databases

DMDM114152793.

Proteomic databases

MaxQBP26232.
PaxDbP26232.
PRIDEP26232.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000343114; ENSP00000341500; ENSG00000066032. [P26232-6]
ENST00000361291; ENSP00000355398; ENSG00000066032. [P26232-5]
ENST00000402739; ENSP00000384638; ENSG00000066032. [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032. [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032. [P26232-2]
ENST00000540488; ENSP00000441705; ENSG00000066032. [P26232-3]
ENST00000541047; ENSP00000444675; ENSG00000066032. [P26232-2]
GeneID1496.
KEGGhsa:1496.
UCSCuc010yse.2. human. [P26232-2]
uc010ysg.2. human. [P26232-3]
uc010ysh.2. human. [P26232-1]

Organism-specific databases

CTD1496.
GeneCardsGC02P079412.
HGNCHGNC:2510. CTNNA2.
HPACAB037175.
HPA019162.
MIM114025. gene.
neXtProtNX_P26232.
PharmGKBPA27013.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG240050.
HOVERGENHBG000069.
InParanoidP26232.
KOK05691.
OMAMVRAARN.
OrthoDBEOG7HQN7B.
PhylomeDBP26232.
TreeFamTF313686.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.

Gene expression databases

ArrayExpressP26232.
BgeeP26232.
CleanExHS_CTNNA2.
GenevestigatorP26232.

Family and domain databases

InterProIPR001033. Alpha_catenin.
IPR006077. Vinculin/catenin.
IPR000633. Vinculin_CS.
[Graphical view]
PANTHERPTHR18914. PTHR18914. 1 hit.
PfamPF01044. Vinculin. 2 hits.
[Graphical view]
PRINTSPR00805. ALPHACATENIN.
SUPFAMSSF47220. SSF47220. 5 hits.
PROSITEPS00663. VINCULIN_1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCTNNA2. human.
GenomeRNAi1496.
NextBio6149.
PROP26232.
SOURCESearch...

Entry information

Entry nameCTNA2_HUMAN
AccessionPrimary (citable) accession number: P26232
Secondary accession number(s): B3KXE5 expand/collapse secondary AC list , B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 23, 2007
Last modified: July 9, 2014
This is version 137 of the entry and version 5 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM