Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Catenin alpha-2

Gene

CTNNA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation.By similarity

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • structural constituent of cytoskeleton Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000044115-MONOMER.
ReactomeiR-HSA-375170. CDO in myogenesis.
SIGNORiP26232.

Names & Taxonomyi

Protein namesi
Recommended name:
Catenin alpha-2
Alternative name(s):
Alpha N-catenin
Alpha-catenin-related protein
Gene namesi
Name:CTNNA2
Synonyms:CAPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:2510. CTNNA2.

Subcellular locationi

  • Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
  • Cytoplasm 1 Publication
  • Cytoplasmcytoskeleton By similarity
  • Cell junctionadherens junction By similarity
  • Cell projectionaxon By similarity
  • Nucleus 1 Publication

GO - Cellular componenti

  • actin cytoskeleton Source: InterPro
  • adherens junction Source: UniProtKB
  • axon Source: UniProtKB
  • basolateral plasma membrane Source: Ensembl
  • cell-cell adherens junction Source: BHF-UCL
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • lamellipodium Source: Ensembl
  • nucleus Source: UniProtKB-SubCell
  • postsynaptic density Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1496.
OpenTargetsiENSG00000066032.
PharmGKBiPA27013.

Polymorphism and mutation databases

BioMutaiCTNNA2.
DMDMi114152793.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000642631 – 953Catenin alpha-2Add BLAST953

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei632PhosphothreonineBy similarity1
Modified residuei640PhosphoserineCombined sources1
Modified residuei651PhosphoserineBy similarity1
Modified residuei901PhosphoserineBy similarity1
Modified residuei939PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP26232.
MaxQBiP26232.
PeptideAtlasiP26232.
PRIDEiP26232.
TopDownProteomicsiP26232-6. [P26232-6]

PTM databases

iPTMnetiP26232.
PhosphoSitePlusiP26232.
SwissPalmiP26232.

Expressioni

Gene expression databases

BgeeiENSG00000066032.
CleanExiHS_CTNNA2.
ExpressionAtlasiP26232. baseline and differential.
GenevisibleiP26232. HS.

Organism-specific databases

HPAiCAB037175.
HPA019162.

Interactioni

Subunit structurei

Interacts with CDH1 and CDH2 (By similarity). Interacts with ZNF639; recruits CTNNA2 to the nucleus (PubMed:16182284).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ZNF639Q9UID67EBI-3953920,EBI-947476

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi107877. 20 interactors.
DIPiDIP-60979N.
IntActiP26232. 7 interactors.

Structurei

3D structure databases

ProteinModelPortaliP26232.
SMRiP26232.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the vinculin/alpha-catenin family.Curated

Phylogenomic databases

GeneTreeiENSGT00550000074411.
HOVERGENiHBG000069.
InParanoidiP26232.
KOiK05691.
OMAiVCEAVNT.
OrthoDBiEOG091G01KR.
PhylomeDBiP26232.
TreeFamiTF313686.

Family and domain databases

InterProiIPR001033. Alpha_catenin.
IPR030046. CTNNA2.
IPR006077. Vinculin/catenin.
IPR000633. Vinculin_CS.
[Graphical view]
PANTHERiPTHR18914. PTHR18914. 2 hits.
PTHR18914:SF23. PTHR18914:SF23. 2 hits.
PfamiPF01044. Vinculin. 2 hits.
[Graphical view]
PRINTSiPR00805. ALPHACATENIN.
SUPFAMiSSF47220. SSF47220. 5 hits.
PROSITEiPS00663. VINCULIN_1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P26232-1) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin II

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK
60 70 80 90 100
KGRSKKAHVL AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG
110 120 130 140 150
ETMRIASSEF ADDPCSSVKR GTMVRAARAL LSAVTRLLIL ADMADVMRLL
160 170 180 190 200
SHLKIVEEAL EAVKNATNEQ DLANRFKEFG KEMVKLNYVA ARRQQELKDP
210 220 230 240 250
HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR DYVFKQVQEA
260 270 280 290 300
IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR
310 320 330 340 350
PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM
360 370 380 390 400
NNTGRKEKGD PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL
410 420 430 440 450
VLIEAAKSGN EKEVKEYAQV FREHANKLVE VANLACSISN NEEGVKLVRM
460 470 480 490 500
AATQIDSLCP QVINAALTLA ARPQSKVAQD NMDVFKDQWE KQVRVLTEAV
510 520 530 540 550
DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA GAIRGRAARV
560 570 580 590 600
IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV
610 620 630 640 650
PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR
660 670 680 690 700
SRTSVQTEDD QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE
710 720 730 740 750
VAKWDDSGND IIVLAKQMCM IMMEMTDFTR GKGPLKNTSD VINAAKKIAE
760 770 780 790 800
AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ RIALYCHQLN ICSKVKAEVQ
810 820 830 840 850
NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL PTCAEGAPIG
860 870 880 890 900
SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN
910 920 930 940 950
SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM

DSF
Length:953
Mass (Da):105,313
Last modified:January 23, 2007 - v5
Checksum:i5FC88907B37E8A6C
GO
Isoform 2 (identifier: P26232-2) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin I

The sequence of this isoform differs from the canonical sequence as follows:
     811-858: Missing.

Show »
Length:905
Mass (Da):100,447
Checksum:iECDB5DA119B443CF
GO
Isoform 3 (identifier: P26232-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     766-858: Missing.

Note: No experimental confirmation available.
Show »
Length:860
Mass (Da):95,558
Checksum:i33963B324E2787FE
GO
Isoform 4 (identifier: P26232-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-368: Missing.
     811-858: Missing.

Show »
Length:537
Mass (Da):59,868
Checksum:i71B24F41F0B4D6FB
GO
Isoform 5 (identifier: P26232-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
     811-858: Missing.

Note: No experimental confirmation available.
Show »
Length:939
Mass (Da):104,273
Checksum:i4B4AF75F8A539C5B
GO
Isoform 6 (identifier: P26232-6) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin III

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
     811-858: Missing.

Show »
Length:584
Mass (Da):65,111
Checksum:iA3A1391C89740337
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122T → A in BAH12003 (PubMed:14702039).Curated1
Sequence conflicti182E → K in AAA58407 (PubMed:8432524).Curated1
Sequence conflicti309S → SS in AAY15008 (PubMed:15815621).Curated1
Sequence conflicti651 – 652SR → RG in AAA58407 (PubMed:8432524).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0380081 – 368Missing in isoform 4. 1 PublicationAdd BLAST368
Alternative sequenceiVSP_0380051 – 351Missing in isoform 6. 1 PublicationAdd BLAST351
Alternative sequenceiVSP_0380071M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. 1 Publication1
Alternative sequenceiVSP_038006352N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_038009766 – 858Missing in isoform 3. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_020337811 – 858Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA. Translation: AAA58407.2.
AK127226 mRNA. Translation: BAG54457.1.
AK295181 mRNA. Translation: BAH12003.1.
AK295493 mRNA. Translation: BAH12088.1.
AK303035 mRNA. Translation: BAH13884.1.
BX537769 mRNA. Translation: CAD97832.1.
AC008067 Genomic DNA. Translation: AAY15073.1.
AC010975 Genomic DNA. No translation available.
AC011741 Genomic DNA. Translation: AAX93241.1.
AC011746 Genomic DNA. Translation: AAY15008.1.
AC016670 Genomic DNA. No translation available.
AC016716 Genomic DNA. No translation available.
AC093322 Genomic DNA. No translation available.
AC096573 Genomic DNA. Translation: AAY14758.1.
AC096753 Genomic DNA. Translation: AAY14763.1.
AC104780 Genomic DNA. Translation: AAX88946.1.
FJ695201 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99564.1.
CH471053 Genomic DNA. Translation: EAW99565.1.
BC052996 mRNA. Translation: AAH52996.1.
CCDSiCCDS42703.2. [P26232-2]
CCDS54371.1. [P26232-3]
CCDS62944.1. [P26232-1]
CCDS62945.1. [P26232-6]
CCDS74531.1. [P26232-4]
PIRiA45011.
RefSeqiNP_001158355.1. NM_001164883.1. [P26232-3]
NP_001269526.1. NM_001282597.2. [P26232-1]
NP_001269527.1. NM_001282598.1. [P26232-5]
NP_001269528.1. NM_001282599.1. [P26232-6]
NP_001269529.1. NM_001282600.1. [P26232-4]
NP_001307739.1. NM_001320810.1.
NP_004380.2. NM_004389.3. [P26232-2]
XP_011530857.1. XM_011532555.2. [P26232-1]
XP_011530858.1. XM_011532556.2. [P26232-1]
XP_016858892.1. XM_017003403.1. [P26232-2]
UniGeneiHs.167368.

Genome annotation databases

EnsembliENST00000343114; ENSP00000341500; ENSG00000066032. [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032. [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032. [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032. [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032. [P26232-4]
ENST00000629316; ENSP00000486160; ENSG00000066032. [P26232-3]
GeneIDi1496.
KEGGihsa:1496.
UCSCiuc010yse.3. human. [P26232-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA. Translation: AAA58407.2.
AK127226 mRNA. Translation: BAG54457.1.
AK295181 mRNA. Translation: BAH12003.1.
AK295493 mRNA. Translation: BAH12088.1.
AK303035 mRNA. Translation: BAH13884.1.
BX537769 mRNA. Translation: CAD97832.1.
AC008067 Genomic DNA. Translation: AAY15073.1.
AC010975 Genomic DNA. No translation available.
AC011741 Genomic DNA. Translation: AAX93241.1.
AC011746 Genomic DNA. Translation: AAY15008.1.
AC016670 Genomic DNA. No translation available.
AC016716 Genomic DNA. No translation available.
AC093322 Genomic DNA. No translation available.
AC096573 Genomic DNA. Translation: AAY14758.1.
AC096753 Genomic DNA. Translation: AAY14763.1.
AC104780 Genomic DNA. Translation: AAX88946.1.
FJ695201 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99564.1.
CH471053 Genomic DNA. Translation: EAW99565.1.
BC052996 mRNA. Translation: AAH52996.1.
CCDSiCCDS42703.2. [P26232-2]
CCDS54371.1. [P26232-3]
CCDS62944.1. [P26232-1]
CCDS62945.1. [P26232-6]
CCDS74531.1. [P26232-4]
PIRiA45011.
RefSeqiNP_001158355.1. NM_001164883.1. [P26232-3]
NP_001269526.1. NM_001282597.2. [P26232-1]
NP_001269527.1. NM_001282598.1. [P26232-5]
NP_001269528.1. NM_001282599.1. [P26232-6]
NP_001269529.1. NM_001282600.1. [P26232-4]
NP_001307739.1. NM_001320810.1.
NP_004380.2. NM_004389.3. [P26232-2]
XP_011530857.1. XM_011532555.2. [P26232-1]
XP_011530858.1. XM_011532556.2. [P26232-1]
XP_016858892.1. XM_017003403.1. [P26232-2]
UniGeneiHs.167368.

3D structure databases

ProteinModelPortaliP26232.
SMRiP26232.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107877. 20 interactors.
DIPiDIP-60979N.
IntActiP26232. 7 interactors.

PTM databases

iPTMnetiP26232.
PhosphoSitePlusiP26232.
SwissPalmiP26232.

Polymorphism and mutation databases

BioMutaiCTNNA2.
DMDMi114152793.

Proteomic databases

EPDiP26232.
MaxQBiP26232.
PeptideAtlasiP26232.
PRIDEiP26232.
TopDownProteomicsiP26232-6. [P26232-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343114; ENSP00000341500; ENSG00000066032. [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032. [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032. [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032. [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032. [P26232-4]
ENST00000629316; ENSP00000486160; ENSG00000066032. [P26232-3]
GeneIDi1496.
KEGGihsa:1496.
UCSCiuc010yse.3. human. [P26232-1]

Organism-specific databases

CTDi1496.
DisGeNETi1496.
GeneCardsiCTNNA2.
HGNCiHGNC:2510. CTNNA2.
HPAiCAB037175.
HPA019162.
MIMi114025. gene.
neXtProtiNX_P26232.
OpenTargetsiENSG00000066032.
PharmGKBiPA27013.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00550000074411.
HOVERGENiHBG000069.
InParanoidiP26232.
KOiK05691.
OMAiVCEAVNT.
OrthoDBiEOG091G01KR.
PhylomeDBiP26232.
TreeFamiTF313686.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000044115-MONOMER.
ReactomeiR-HSA-375170. CDO in myogenesis.
SIGNORiP26232.

Miscellaneous databases

ChiTaRSiCTNNA2. human.
GenomeRNAii1496.
PROiP26232.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000066032.
CleanExiHS_CTNNA2.
ExpressionAtlasiP26232. baseline and differential.
GenevisibleiP26232. HS.

Family and domain databases

InterProiIPR001033. Alpha_catenin.
IPR030046. CTNNA2.
IPR006077. Vinculin/catenin.
IPR000633. Vinculin_CS.
[Graphical view]
PANTHERiPTHR18914. PTHR18914. 2 hits.
PTHR18914:SF23. PTHR18914:SF23. 2 hits.
PfamiPF01044. Vinculin. 2 hits.
[Graphical view]
PRINTSiPR00805. ALPHACATENIN.
SUPFAMiSSF47220. SSF47220. 5 hits.
PROSITEiPS00663. VINCULIN_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTNA2_HUMAN
AccessioniPrimary (citable) accession number: P26232
Secondary accession number(s): B3KXE5
, B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 160 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.