Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Catenin alpha-2

Gene

CTNNA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation

Enzyme and pathway databases

ReactomeiR-HSA-375170 CDO in myogenesis
SIGNORiP26232

Names & Taxonomyi

Protein namesi
Recommended name:
Catenin alpha-2
Alternative name(s):
Alpha N-catenin
Alpha-catenin-related protein
Gene namesi
Name:CTNNA2
Synonyms:CAPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000066032.18
HGNCiHGNC:2510 CTNNA2
MIMi114025 gene
neXtProtiNX_P26232

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1496
OpenTargetsiENSG00000066032
PharmGKBiPA27013

Polymorphism and mutation databases

BioMutaiCTNNA2
DMDMi114152793

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000642631 – 953Catenin alpha-2Add BLAST953

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei632PhosphothreonineBy similarity1
Modified residuei640PhosphoserineCombined sources1
Modified residuei651PhosphoserineBy similarity1
Modified residuei901PhosphoserineBy similarity1
Modified residuei939PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP26232
MaxQBiP26232
PeptideAtlasiP26232
PRIDEiP26232
ProteomicsDBi54314
54315 [P26232-2]
54316 [P26232-3]
54317 [P26232-4]
54318 [P26232-5]
54319 [P26232-6]
TopDownProteomicsiP26232-6 [P26232-6]

PTM databases

iPTMnetiP26232
PhosphoSitePlusiP26232
SwissPalmiP26232

Expressioni

Gene expression databases

BgeeiENSG00000066032
CleanExiHS_CTNNA2
ExpressionAtlasiP26232 baseline and differential
GenevisibleiP26232 HS

Organism-specific databases

HPAiCAB037175

Interactioni

Subunit structurei

Interacts with CDH1 and CDH2 (By similarity). Interacts with ZNF639; recruits CTNNA2 to the nucleus (PubMed:16182284).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ZNF639Q9UID67EBI-3953920,EBI-947476

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107877, 28 interactors
DIPiDIP-60979N
IntActiP26232, 8 interactors

Structurei

3D structure databases

ProteinModelPortaliP26232
SMRiP26232
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the vinculin/alpha-catenin family.Curated

Phylogenomic databases

GeneTreeiENSGT00550000074411
HOVERGENiHBG000069
InParanoidiP26232
KOiK05691
OMAiWENQVRI
OrthoDBiEOG091G01KR
PhylomeDBiP26232
TreeFamiTF313686

Family and domain databases

InterProiView protein in InterPro
IPR036723 Alpha-catenin/vinculin-like_sf
IPR001033 Alpha_catenin
IPR030046 CTNNA2
IPR006077 Vinculin/catenin
IPR000633 Vinculin_CS
PANTHERiPTHR18914 PTHR18914, 1 hit
PTHR18914:SF23 PTHR18914:SF23, 1 hit
PfamiView protein in Pfam
PF01044 Vinculin, 2 hits
PRINTSiPR00805 ALPHACATENIN
SUPFAMiSSF47220 SSF47220, 5 hits
PROSITEiView protein in PROSITE
PS00663 VINCULIN_1, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P26232-1) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin II

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK
60 70 80 90 100
KGRSKKAHVL AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG
110 120 130 140 150
ETMRIASSEF ADDPCSSVKR GTMVRAARAL LSAVTRLLIL ADMADVMRLL
160 170 180 190 200
SHLKIVEEAL EAVKNATNEQ DLANRFKEFG KEMVKLNYVA ARRQQELKDP
210 220 230 240 250
HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR DYVFKQVQEA
260 270 280 290 300
IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR
310 320 330 340 350
PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM
360 370 380 390 400
NNTGRKEKGD PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL
410 420 430 440 450
VLIEAAKSGN EKEVKEYAQV FREHANKLVE VANLACSISN NEEGVKLVRM
460 470 480 490 500
AATQIDSLCP QVINAALTLA ARPQSKVAQD NMDVFKDQWE KQVRVLTEAV
510 520 530 540 550
DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA GAIRGRAARV
560 570 580 590 600
IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV
610 620 630 640 650
PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR
660 670 680 690 700
SRTSVQTEDD QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE
710 720 730 740 750
VAKWDDSGND IIVLAKQMCM IMMEMTDFTR GKGPLKNTSD VINAAKKIAE
760 770 780 790 800
AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ RIALYCHQLN ICSKVKAEVQ
810 820 830 840 850
NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL PTCAEGAPIG
860 870 880 890 900
SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN
910 920 930 940 950
SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM

DSF
Length:953
Mass (Da):105,313
Last modified:January 23, 2007 - v5
Checksum:i5FC88907B37E8A6C
GO
Isoform 2 (identifier: P26232-2) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin I

The sequence of this isoform differs from the canonical sequence as follows:
     811-858: Missing.

Show »
Length:905
Mass (Da):100,447
Checksum:iECDB5DA119B443CF
GO
Isoform 3 (identifier: P26232-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     766-858: Missing.

Note: No experimental confirmation available.
Show »
Length:860
Mass (Da):95,558
Checksum:i33963B324E2787FE
GO
Isoform 4 (identifier: P26232-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-368: Missing.
     811-858: Missing.

Show »
Length:537
Mass (Da):59,868
Checksum:i71B24F41F0B4D6FB
GO
Isoform 5 (identifier: P26232-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
     811-858: Missing.

Note: No experimental confirmation available.
Show »
Length:939
Mass (Da):104,273
Checksum:i4B4AF75F8A539C5B
GO
Isoform 6 (identifier: P26232-6) [UniParc]FASTAAdd to basket
Also known as: AlphaN-catenin III

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
     811-858: Missing.

Show »
Length:584
Mass (Da):65,111
Checksum:iA3A1391C89740337
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122T → A in BAH12003 (PubMed:14702039).Curated1
Sequence conflicti182E → K in AAA58407 (PubMed:8432524).Curated1
Sequence conflicti309S → SS in AAY15008 (PubMed:15815621).Curated1
Sequence conflicti651 – 652SR → RG in AAA58407 (PubMed:8432524).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0380081 – 368Missing in isoform 4. 1 PublicationAdd BLAST368
Alternative sequenceiVSP_0380051 – 351Missing in isoform 6. 1 PublicationAdd BLAST351
Alternative sequenceiVSP_0380071M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. 1 Publication1
Alternative sequenceiVSP_038006352N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_038009766 – 858Missing in isoform 3. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_020337811 – 858Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M94151 mRNA Translation: AAA58407.2
AK127226 mRNA Translation: BAG54457.1
AK295181 mRNA Translation: BAH12003.1
AK295493 mRNA Translation: BAH12088.1
AK303035 mRNA Translation: BAH13884.1
BX537769 mRNA Translation: CAD97832.1
AC008067 Genomic DNA Translation: AAY15073.1
AC010975 Genomic DNA No translation available.
AC011741 Genomic DNA Translation: AAX93241.1
AC011746 Genomic DNA Translation: AAY15008.1
AC016670 Genomic DNA No translation available.
AC016716 Genomic DNA No translation available.
AC093322 Genomic DNA No translation available.
AC096573 Genomic DNA Translation: AAY14758.1
AC096753 Genomic DNA Translation: AAY14763.1
AC104780 Genomic DNA Translation: AAX88946.1
FJ695201 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99564.1
CH471053 Genomic DNA Translation: EAW99565.1
BC052996 mRNA Translation: AAH52996.1
CCDSiCCDS42703.2 [P26232-2]
CCDS54371.1 [P26232-3]
CCDS62944.1 [P26232-1]
CCDS62945.1 [P26232-6]
CCDS74531.1 [P26232-4]
PIRiA45011
RefSeqiNP_001158355.1, NM_001164883.1 [P26232-3]
NP_001269526.1, NM_001282597.2 [P26232-1]
NP_001269527.1, NM_001282598.1 [P26232-5]
NP_001269528.1, NM_001282599.1 [P26232-6]
NP_001269529.1, NM_001282600.1 [P26232-4]
NP_001307739.1, NM_001320810.1
NP_004380.2, NM_004389.3 [P26232-2]
XP_011530857.1, XM_011532555.2 [P26232-1]
XP_011530858.1, XM_011532556.2 [P26232-1]
XP_016858892.1, XM_017003403.1 [P26232-2]
UniGeneiHs.167368

Genome annotation databases

EnsembliENST00000343114; ENSP00000341500; ENSG00000066032 [P26232-6]
ENST00000402739; ENSP00000384638; ENSG00000066032 [P26232-1]
ENST00000466387; ENSP00000418191; ENSG00000066032 [P26232-2]
ENST00000496558; ENSP00000419295; ENSG00000066032 [P26232-2]
ENST00000541047; ENSP00000444675; ENSG00000066032 [P26232-4]
ENST00000629316; ENSP00000486160; ENSG00000066032 [P26232-3]
GeneIDi1496
KEGGihsa:1496
UCSCiuc010yse.3 human [P26232-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCTNA2_HUMAN
AccessioniPrimary (citable) accession number: P26232
Secondary accession number(s): B3KXE5
, B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 23, 2007
Last modified: June 20, 2018
This is version 172 of the entry and version 5 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health