Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P26232

- CTNA2_HUMAN

UniProt

P26232 - CTNA2_HUMAN

Protein

Catenin alpha-2

Gene

CTNNA2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 5 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. structural constituent of cytoskeleton Source: UniProtKB

    GO - Biological processi

    1. axonogenesis Source: UniProtKB
    2. brain morphogenesis Source: UniProtKB
    3. dendrite morphogenesis Source: UniProtKB
    4. muscle cell differentiation Source: Reactome
    5. positive regulation of muscle cell differentiation Source: Reactome
    6. prepulse inhibition Source: UniProtKB
    7. radial glia guided migration of Purkinje cell Source: UniProtKB
    8. regulation of synapse structural plasticity Source: UniProtKB
    9. single organismal cell-cell adhesion Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Cell adhesion, Differentiation

    Enzyme and pathway databases

    ReactomeiREACT_21402. CDO in myogenesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Catenin alpha-2
    Alternative name(s):
    Alpha N-catenin
    Alpha-catenin-related protein
    Gene namesi
    Name:CTNNA2
    Synonyms:CAPR
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:2510. CTNNA2.

    Subcellular locationi

    Cytoplasm 1 Publication. Cytoplasmcytoskeleton By similarity. Cell junctionadherens junction By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. Cell projectionaxon By similarity
    Note: Recruited to the nucleus upon ZNF639 overexpression.

    GO - Cellular componenti

    1. actin cytoskeleton Source: InterPro
    2. adherens junction Source: UniProtKB
    3. axon Source: UniProtKB
    4. basolateral plasma membrane Source: Ensembl
    5. cell-cell adherens junction Source: Ensembl
    6. cytoplasm Source: UniProtKB
    7. cytosol Source: Reactome
    8. lamellipodium Source: Ensembl

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27013.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 953953Catenin alpha-2PRO_0000064263Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei640 – 6401Phosphoserine1 Publication
    Modified residuei901 – 9011PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP26232.
    PaxDbiP26232.
    PRIDEiP26232.

    PTM databases

    PhosphoSiteiP26232.

    Expressioni

    Gene expression databases

    ArrayExpressiP26232.
    BgeeiP26232.
    CleanExiHS_CTNNA2.
    GenevestigatoriP26232.

    Organism-specific databases

    HPAiCAB037175.
    HPA019162.

    Interactioni

    Subunit structurei

    Interacts with ZNF639.1 Publication

    Protein-protein interaction databases

    BioGridi107877. 4 interactions.
    DIPiDIP-60979N.
    IntActiP26232. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliP26232.
    SMRiP26232. Positions 14-924.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the vinculin/alpha-catenin family.Curated

    Phylogenomic databases

    eggNOGiNOG240050.
    HOVERGENiHBG000069.
    InParanoidiP26232.
    KOiK05691.
    OMAiMVRAARN.
    OrthoDBiEOG7HQN7B.
    PhylomeDBiP26232.
    TreeFamiTF313686.

    Family and domain databases

    InterProiIPR001033. Alpha_catenin.
    IPR006077. Vinculin/catenin.
    IPR000633. Vinculin_CS.
    [Graphical view]
    PANTHERiPTHR18914. PTHR18914. 1 hit.
    PfamiPF01044. Vinculin. 2 hits.
    [Graphical view]
    PRINTSiPR00805. ALPHACATENIN.
    SUPFAMiSSF47220. SSF47220. 5 hits.
    PROSITEiPS00663. VINCULIN_1. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P26232-1) [UniParc]FASTAAdd to Basket

    Also known as: AlphaN-catenin II

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSATSPIIL KWDPKSLEIR TLTVERLLEP LVTQVTTLVN TSNKGPSGKK    50
    KGRSKKAHVL AASVEQATQN FLEKGEQIAK ESQDLKEELV AAVEDVRKQG 100
    ETMRIASSEF ADDPCSSVKR GTMVRAARAL LSAVTRLLIL ADMADVMRLL 150
    SHLKIVEEAL EAVKNATNEQ DLANRFKEFG KEMVKLNYVA ARRQQELKDP 200
    HCRDEMAAAR GALKKNATML YTASQAFLRH PDVAATRANR DYVFKQVQEA 250
    IAGISNAAQA TSPTDEAKGH TGIGELAAAL NEFDNKIILD PMTFSEARFR 300
    PSLEERLESI ISGAALMADS SCTRDDRRER IVAECNAVRQ ALQDLLSEYM 350
    NNTGRKEKGD PLNIAIDKMT KKTRDLRRQL RKAVMDHISD SFLETNVPLL 400
    VLIEAAKSGN EKEVKEYAQV FREHANKLVE VANLACSISN NEEGVKLVRM 450
    AATQIDSLCP QVINAALTLA ARPQSKVAQD NMDVFKDQWE KQVRVLTEAV 500
    DDITSVDDFL SVSENHILED VNKCVIALQE GDVDTLDRTA GAIRGRAARV 550
    IHIINAEMEN YEAGVYTEKV LEATKLLSET VMPRFAEQVE VAIEALSANV 600
    PQPFEENEFI DASRLVYDGV RDIRKAVLMI RTPEELEDDS DFEQEDYDVR 650
    SRTSVQTEDD QLIAGQSARA IMAQLPQEEK AKIAEQVEIF HQEKSKLDAE 700
    VAKWDDSGND IIVLAKQMCM IMMEMTDFTR GKGPLKNTSD VINAAKKIAE 750
    AGSRMDKLAR AVADQCPDSA CKQDLLAYLQ RIALYCHQLN ICSKVKAEVQ 800
    NLGGELIVSG TGVQSTFTTF YEVDCDVIDG GRASQLSTHL PTCAEGAPIG 850
    SGSSDSSMLD SATSLIQAAK NLMNAVVLTV KASYVASTKY QKVYGTAAVN 900
    SPVVSWKMKA PEKKPLVKRE KPEEFQTRVR RGSQKKHISP VQALSEFKAM 950
    DSF 953
    Length:953
    Mass (Da):105,313
    Last modified:January 23, 2007 - v5
    Checksum:i5FC88907B37E8A6C
    GO
    Isoform 2 (identifier: P26232-2) [UniParc]FASTAAdd to Basket

    Also known as: AlphaN-catenin I

    The sequence of this isoform differs from the canonical sequence as follows:
         811-858: Missing.

    Show »
    Length:905
    Mass (Da):100,447
    Checksum:iECDB5DA119B443CF
    GO
    Isoform 3 (identifier: P26232-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         766-858: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:860
    Mass (Da):95,558
    Checksum:i33963B324E2787FE
    GO
    Isoform 4 (identifier: P26232-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-368: Missing.
         811-858: Missing.

    Show »
    Length:537
    Mass (Da):59,868
    Checksum:i71B24F41F0B4D6FB
    GO
    Isoform 5 (identifier: P26232-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM
         811-858: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:939
    Mass (Da):104,273
    Checksum:i4B4AF75F8A539C5B
    GO
    Isoform 6 (identifier: P26232-6) [UniParc]FASTAAdd to Basket

    Also known as: AlphaN-catenin III

    The sequence of this isoform differs from the canonical sequence as follows:
         1-351: Missing.
         352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ
         811-858: Missing.

    Show »
    Length:584
    Mass (Da):65,111
    Checksum:iA3A1391C89740337
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti122 – 1221T → A in BAH12003. (PubMed:14702039)Curated
    Sequence conflicti182 – 1821E → K in AAA58407. (PubMed:8432524)Curated
    Sequence conflicti309 – 3091S → SS in AAY15008. (PubMed:15815621)Curated
    Sequence conflicti651 – 6522SR → RG in AAA58407. (PubMed:8432524)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 368368Missing in isoform 4. 1 PublicationVSP_038008Add
    BLAST
    Alternative sequencei1 – 351351Missing in isoform 6. 1 PublicationVSP_038005Add
    BLAST
    Alternative sequencei1 – 11M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. 1 PublicationVSP_038007
    Alternative sequencei352 – 3521N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. 1 PublicationVSP_038006
    Alternative sequencei766 – 85893Missing in isoform 3. 1 PublicationVSP_038009Add
    BLAST
    Alternative sequencei811 – 85848Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_020337Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M94151 mRNA. Translation: AAA58407.2.
    AK127226 mRNA. Translation: BAG54457.1.
    AK295181 mRNA. Translation: BAH12003.1.
    AK295493 mRNA. Translation: BAH12088.1.
    AK303035 mRNA. Translation: BAH13884.1.
    BX537769 mRNA. Translation: CAD97832.1.
    AC008067 Genomic DNA. Translation: AAY15073.1.
    AC010975 Genomic DNA. No translation available.
    AC011741 Genomic DNA. Translation: AAX93241.1.
    AC011746 Genomic DNA. Translation: AAY15008.1.
    AC016670 Genomic DNA. No translation available.
    AC016716 Genomic DNA. No translation available.
    AC093322 Genomic DNA. No translation available.
    AC096573 Genomic DNA. Translation: AAY14758.1.
    AC096753 Genomic DNA. Translation: AAY14763.1.
    AC104780 Genomic DNA. Translation: AAX88946.1.
    FJ695201 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99564.1.
    CH471053 Genomic DNA. Translation: EAW99565.1.
    BC052996 mRNA. Translation: AAH52996.1.
    CCDSiCCDS42703.2. [P26232-2]
    CCDS54371.1. [P26232-3]
    CCDS62944.1. [P26232-1]
    CCDS62945.1. [P26232-6]
    PIRiA45011.
    RefSeqiNP_001158355.1. NM_001164883.1. [P26232-3]
    NP_001269526.1. NM_001282597.1. [P26232-1]
    NP_001269527.1. NM_001282598.1. [P26232-5]
    NP_001269528.1. NM_001282599.1. [P26232-6]
    NP_001269529.1. NM_001282600.1. [P26232-4]
    NP_004380.2. NM_004389.3. [P26232-2]
    UniGeneiHs.167368.

    Genome annotation databases

    EnsembliENST00000343114; ENSP00000341500; ENSG00000066032. [P26232-6]
    ENST00000361291; ENSP00000355398; ENSG00000066032. [P26232-5]
    ENST00000402739; ENSP00000384638; ENSG00000066032. [P26232-1]
    ENST00000466387; ENSP00000418191; ENSG00000066032. [P26232-2]
    ENST00000496558; ENSP00000419295; ENSG00000066032. [P26232-2]
    ENST00000540488; ENSP00000441705; ENSG00000066032. [P26232-3]
    ENST00000541047; ENSP00000444675; ENSG00000066032. [P26232-2]
    GeneIDi1496.
    KEGGihsa:1496.
    UCSCiuc010yse.2. human. [P26232-2]
    uc010ysg.2. human. [P26232-3]
    uc010ysh.2. human. [P26232-1]

    Polymorphism databases

    DMDMi114152793.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M94151 mRNA. Translation: AAA58407.2 .
    AK127226 mRNA. Translation: BAG54457.1 .
    AK295181 mRNA. Translation: BAH12003.1 .
    AK295493 mRNA. Translation: BAH12088.1 .
    AK303035 mRNA. Translation: BAH13884.1 .
    BX537769 mRNA. Translation: CAD97832.1 .
    AC008067 Genomic DNA. Translation: AAY15073.1 .
    AC010975 Genomic DNA. No translation available.
    AC011741 Genomic DNA. Translation: AAX93241.1 .
    AC011746 Genomic DNA. Translation: AAY15008.1 .
    AC016670 Genomic DNA. No translation available.
    AC016716 Genomic DNA. No translation available.
    AC093322 Genomic DNA. No translation available.
    AC096573 Genomic DNA. Translation: AAY14758.1 .
    AC096753 Genomic DNA. Translation: AAY14763.1 .
    AC104780 Genomic DNA. Translation: AAX88946.1 .
    FJ695201 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99564.1 .
    CH471053 Genomic DNA. Translation: EAW99565.1 .
    BC052996 mRNA. Translation: AAH52996.1 .
    CCDSi CCDS42703.2. [P26232-2 ]
    CCDS54371.1. [P26232-3 ]
    CCDS62944.1. [P26232-1 ]
    CCDS62945.1. [P26232-6 ]
    PIRi A45011.
    RefSeqi NP_001158355.1. NM_001164883.1. [P26232-3 ]
    NP_001269526.1. NM_001282597.1. [P26232-1 ]
    NP_001269527.1. NM_001282598.1. [P26232-5 ]
    NP_001269528.1. NM_001282599.1. [P26232-6 ]
    NP_001269529.1. NM_001282600.1. [P26232-4 ]
    NP_004380.2. NM_004389.3. [P26232-2 ]
    UniGenei Hs.167368.

    3D structure databases

    ProteinModelPortali P26232.
    SMRi P26232. Positions 14-924.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107877. 4 interactions.
    DIPi DIP-60979N.
    IntActi P26232. 3 interactions.

    PTM databases

    PhosphoSitei P26232.

    Polymorphism databases

    DMDMi 114152793.

    Proteomic databases

    MaxQBi P26232.
    PaxDbi P26232.
    PRIDEi P26232.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000343114 ; ENSP00000341500 ; ENSG00000066032 . [P26232-6 ]
    ENST00000361291 ; ENSP00000355398 ; ENSG00000066032 . [P26232-5 ]
    ENST00000402739 ; ENSP00000384638 ; ENSG00000066032 . [P26232-1 ]
    ENST00000466387 ; ENSP00000418191 ; ENSG00000066032 . [P26232-2 ]
    ENST00000496558 ; ENSP00000419295 ; ENSG00000066032 . [P26232-2 ]
    ENST00000540488 ; ENSP00000441705 ; ENSG00000066032 . [P26232-3 ]
    ENST00000541047 ; ENSP00000444675 ; ENSG00000066032 . [P26232-2 ]
    GeneIDi 1496.
    KEGGi hsa:1496.
    UCSCi uc010yse.2. human. [P26232-2 ]
    uc010ysg.2. human. [P26232-3 ]
    uc010ysh.2. human. [P26232-1 ]

    Organism-specific databases

    CTDi 1496.
    GeneCardsi GC02P079412.
    HGNCi HGNC:2510. CTNNA2.
    HPAi CAB037175.
    HPA019162.
    MIMi 114025. gene.
    neXtProti NX_P26232.
    PharmGKBi PA27013.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG240050.
    HOVERGENi HBG000069.
    InParanoidi P26232.
    KOi K05691.
    OMAi MVRAARN.
    OrthoDBi EOG7HQN7B.
    PhylomeDBi P26232.
    TreeFami TF313686.

    Enzyme and pathway databases

    Reactomei REACT_21402. CDO in myogenesis.

    Miscellaneous databases

    ChiTaRSi CTNNA2. human.
    GenomeRNAii 1496.
    NextBioi 6149.
    PROi P26232.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P26232.
    Bgeei P26232.
    CleanExi HS_CTNNA2.
    Genevestigatori P26232.

    Family and domain databases

    InterProi IPR001033. Alpha_catenin.
    IPR006077. Vinculin/catenin.
    IPR000633. Vinculin_CS.
    [Graphical view ]
    PANTHERi PTHR18914. PTHR18914. 1 hit.
    Pfami PF01044. Vinculin. 2 hits.
    [Graphical view ]
    PRINTSi PR00805. ALPHACATENIN.
    SUPFAMi SSF47220. SSF47220. 5 hits.
    PROSITEi PS00663. VINCULIN_1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization and chromosomal assignment of a human cDNA encoding a protein related to the murine 102-kDa cadherin-associated protein (alpha-catenin)."
      Claverie J.-M., Hardelin J.-P., Legouis R., Levilliers J., Bougueleret L., Mattei M.-G., Petit C.
      Genomics 15:13-20(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Hardelin J.-P.
      Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION TO C-TERMINUS.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Tissue: Brain, Hippocampus and Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Hippocampus.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: PNS.
    8. "Nuclear translocation of alphaN-catenin by the novel zinc finger transcriptional repressor ZASC1."
      Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F.
      Exp. Cell Res. 311:1-13(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ZNF639, SUBCELLULAR LOCATION.
    9. Cited for: ALTERNATIVE SPLICING (ISOFORM 6).
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-640, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCTNA2_HUMAN
    AccessioniPrimary (citable) accession number: P26232
    Secondary accession number(s): B3KXE5
    , B7Z2W7, B7Z352, B7Z898, Q4ZFW1, Q53R26, Q53R33, Q53T67, Q53T71, Q53TM8, Q7Z3L1, Q7Z3Y0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 1992
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 139 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3