Reviewed,
UniProtKB/Swiss-Prot P26232 (CTNA2_HUMAN)
Last modified
February 9, 2010.
Version 97.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Catenin alpha-2 Alternative name(s): Alpha N-catenin Alpha-catenin-related protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 953 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation By similarity. |
| Subunit structure | Interacts with ZNF639. Ref.8 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton By similarity. Cell junction › adherens junction By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cell projection › axon By similarity. Note: Recruited to the nucleus upon ZNF639 overexpression. Ref.8 |
| Sequence similarities | Belongs to the vinculin/alpha-catenin family. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P26232-1) Also known as: AlphaN-catenin II; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P26232-2) Also known as: AlphaN-catenin I; The sequence of this isoform differs from the canonical sequence as follows: 811-858: Missing. | ||||||
| Isoform 3 (identifier: P26232-3) The sequence of this isoform differs from the canonical sequence as follows: 766-858: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P26232-4) The sequence of this isoform differs from the canonical sequence as follows: 1-368: Missing. 811-858: Missing. | ||||||
| Isoform 5 (identifier: P26232-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM 811-858: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: P26232-6) Also known as: AlphaN-catenin III; The sequence of this isoform differs from the canonical sequence as follows: 1-351: Missing. 352-352: N → MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ 811-858: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 953 | 952 | Catenin alpha-2 | PRO_0000064263 | |||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylthreonine By similarity | ||||||
| Modified residue | 5 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 6 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 151 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 261 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 262 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 640 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 653 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 654 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 657 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 889 | 1 | N6-acetyllysine Ref.12 | ||||||
| Modified residue | 901 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 368 | 368 | Missing in isoform 4. | VSP_038008 | |||||
| Alternative sequence | 1 – 351 | 351 | Missing in isoform 6. | VSP_038005 | |||||
| Alternative sequence | 1 | 1 | M → MSGLICLQYGLWHGQKIDFG GPRRLLQRNRGEGSM in isoform 5. | VSP_038007 | |||||
| Alternative sequence | 352 | 1 | N → MDGWRRPLQSVGKVCEKNMK TSEMHTMSGAQ in isoform 6. | VSP_038006 | |||||
| Alternative sequence | 766 – 858 | 93 | Missing in isoform 3. | VSP_038009 | |||||
| Alternative sequence | 811 – 858 | 48 | Missing in isoform 2, isoform 4, isoform 5 and isoform 6. | VSP_020337 | |||||
Experimental info | |||||||||
| Sequence conflict | 122 | 1 | T → A in BAH12003. Ref.3 | ||||||
| Sequence conflict | 182 | 1 | E → K in AAA58407. Ref.1 | ||||||
| Sequence conflict | 309 | 1 | S → SS in AAY15008. Ref.5 | ||||||
| Sequence conflict | 651 – 652 | 2 | SR → RG in AAA58407. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization and chromosomal assignment of a human cDNA encoding a protein related to the murine 102-kDa cadherin-associated protein (alpha-catenin)." Claverie J.-M., Hardelin J.-P., Legouis R., Levilliers J., Bougueleret L., Mattei M.-G., Petit C. Genomics 15:13-20(1993) [PubMed: 8432524] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | Hardelin J.-P. Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO C-TERMINUS. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5). Tissue: Brain, Hippocampus and Testis. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Hippocampus. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: PNS. |
| [8] | "Nuclear translocation of alphaN-catenin by the novel zinc finger transcriptional repressor ZASC1." Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. Exp. Cell Res. 311:1-13(2005) [PubMed: 16182284] [Abstract] Cited for: INTERACTION WITH ZNF639, SUBCELLULAR LOCATION. |
| [9] | "Regulation of a novel alphaN-catenin splice variant in schizophrenic smokers." Mexal S., Berger R., Pearce L., Barton A., Logel J., Adams C.E., Ross R.G., Freedman R., Leonard S. Am. J. Med. Genet. B Neuropsychiatr. Genet. 147:759-768(2008) [PubMed: 18163523] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 6). |
| [10] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-151, MASS SPECTROMETRY. |
| [11] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-889, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M94151 mRNA. Translation: AAA58407.2. AK127226 mRNA. Translation: BAG54457.1. AK295181 mRNA. Translation: BAH12003.1. AK295493 mRNA. Translation: BAH12088.1. AK303035 mRNA. Translation: BAH13884.1. BX537769 mRNA. Translation: CAD97832.1. AC008067 Genomic DNA. Translation: AAY15073.1. AC010975 Genomic DNA. No translation available. AC011741 Genomic DNA. Translation: AAX93241.1. AC011746 Genomic DNA. Translation: AAY15008.1. AC016670 Genomic DNA. No translation available. AC016716 Genomic DNA. No translation available. AC093322 Genomic DNA. No translation available. AC096573 Genomic DNA. Translation: AAY14758.1. AC096753 Genomic DNA. Translation: AAY14763.1. AC104780 Genomic DNA. Translation: AAX88946.1. FJ695201 Genomic DNA. No translation available. CH471053 Genomic DNA. Translation: EAW99564.1. CH471053 Genomic DNA. Translation: EAW99565.1. BC052996 mRNA. Translation: AAH52996.1. |
| IPI | IPI00385055. IPI00514038. IPI00743859. IPI00916487. IPI00944536. IPI00944563. |
| PIR | A45011. |
| RefSeq | NP_001158355.1. NP_004380.2. |
| UniGene | Hs.167368 |
3D structure databases | |
| SMR | P26232. Positions 56-260, 375-629. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P26232. |
PTM databases | |
| PhosphoSite | P26232. |
Proteomic databases | |
| PRIDE | P26232. |
Genome annotation databases | |
| Ensembl | ENST00000361291; ENSP00000355398; ENSG00000066032; Homo sapiens. [Genome view] ENST00000402739; ENSP00000384638; ENSG00000066032; Homo sapiens. [Genome view] ENST00000466387; ENSP00000418191; ENSG00000066032; Homo sapiens. [Genome view] ENST00000496558; ENSP00000419295; ENSG00000066032; Homo sapiens. [Genome view] |
| GeneID | 1496. |
| KEGG | hsa:1496. |
| UCSC | uc002sog.1. human. uc002soi.1. human. |
Organism-specific databases | |
| CTD | 1496. |
| GeneCards | GC02P079265. |
| HGNC | HGNC:2510. CTNNA2. |
| HPA | HPA019162. |
| MIM | 114025. gene. |
| PharmGKB | PA27009. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10001. |
| HOVERGEN | P26232. |
| InParanoid | P26232. |
| OMA | XTGRKEK. |
| OrthoDB | EOG9FR3B1. |
| PhylomeDB | P26232. |
Gene expression databases | |
| ArrayExpress | P26232. |
| Bgee | P26232. |
| CleanEx | HS_CTNNA2. |
| Genevestigator | P26232. |
| GermOnline | ENSG00000066032. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001033. Alpha_catenin. IPR006077. Vinculin/catenin. IPR000633. Vinculin_CS. [Graphical view] |
| Pfam | PF01044. Vinculin. 2 hits. [Graphical view] |
| PRINTS | PR00805. ALPHACATENIN. |
| PROSITE | PS00663. VINCULIN_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 6149. |
| SOURCE | Search... |
Entry information
| Entry name | CTNA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P26232 Secondary accession number(s): B3KXE5 Q7Z3Y0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


