SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P26006

- ITA3_HUMAN

UniProt

P26006 - ITA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Integrin alpha-3
Gene
ITGA3, MSK18
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi315 – 3239 Reviewed prediction
Calcium bindingi378 – 3869 Reviewed prediction
Calcium bindingi439 – 4479 Reviewed prediction

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein binding Source: UniProtKB

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cell-matrix adhesion Source: ProtInc
  3. extracellular matrix organization Source: Reactome
  4. heart development Source: Ensembl
  5. integrin-mediated signaling pathway Source: UniProtKB-KW
  6. leukocyte migration Source: Reactome
  7. maternal process involved in female pregnancy Source: Ensembl
  8. memory Source: Ensembl
  9. negative regulation of cell projection organization Source: Ensembl
  10. neuron migration Source: Ensembl
  11. positive regulation of cell-substrate adhesion Source: Ensembl
  12. positive regulation of epithelial cell migration Source: Ensembl
  13. positive regulation of gene expression Source: Ensembl
  14. positive regulation of neuron projection development Source: Ensembl
  15. response to drug Source: Ensembl
  16. response to gonadotropin Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_12560. Basigin interactions.
REACT_13552. Integrin cell surface interactions.
REACT_169262. Laminin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
FRP-2
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
Gene namesi
Name:ITGA3
Synonyms:MSK18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:6139. ITGA3.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini33 – 991959Extracellular Reviewed prediction
Add
BLAST
Transmembranei992 – 101423Helical; Reviewed prediction
Add
BLAST
Topological domaini1015 – 105137Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. basolateral plasma membrane Source: Ensembl
  2. cell surface Source: BHF-UCL
  3. extracellular vesicular exosome Source: UniProt
  4. growth cone Source: Ensembl
  5. integrin alpha3-beta1 complex Source: Ensembl
  6. integrin complex Source: ProtInc
  7. perinuclear region of cytoplasm Source: Ensembl
  8. plasma membrane Source: BHF-UCL
  9. receptor complex Source: MGI
  10. synapse Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB) [MIM:614748]: A multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti628 – 6281R → P in ILNEB. 1 Publication
VAR_068808

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1016 – 10161C → S: Abolishes palmitoylation. 1 Publication

Keywords - Diseasei

Epidermolysis bullosa

Organism-specific databases

MIMi614748. phenotype.
Orphaneti306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
PharmGKBiPA29939.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 32322 Publications
Add
BLAST
Chaini33 – 10511019Integrin alpha-3
PRO_0000016238Add
BLAST
Chaini33 – 872840Integrin alpha-3 heavy chain Reviewed prediction
PRO_0000016239Add
BLAST
Chaini876 – 1051176Integrin alpha-3 light chain Reviewed prediction
PRO_0000016240Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi86 – 861N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi94 ↔ 1031 Publication
Glycosylationi107 – 1071N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi140 ↔ 1621 Publication
Disulfide bondi185 ↔ 1971 Publication
Glycosylationi265 – 2651N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi485 ↔ 490 By similarity
Disulfide bondi496 ↔ 550 By similarity
Glycosylationi500 – 5001N-linked (GlcNAc...) Reviewed prediction
Glycosylationi511 – 5111N-linked (GlcNAc...) Reviewed prediction
Glycosylationi573 – 5731N-linked (GlcNAc...) Reviewed prediction
Glycosylationi605 – 6051N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi615 ↔ 6211 Publication
Glycosylationi656 – 6561N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi694 ↔ 7021 Publication
Glycosylationi697 – 6971N-linked (GlcNAc...) Reviewed prediction
Glycosylationi841 – 8411N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi846 ↔ 904Interchain (between heavy and light chains)1 Publication
Glycosylationi857 – 8571N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi911 ↔ 9161 Publication
Glycosylationi926 – 9261N-linked (GlcNAc...) Reviewed prediction
Glycosylationi935 – 9351N-linked (GlcNAc...) Reviewed prediction
Glycosylationi969 – 9691N-linked (GlcNAc...) Reviewed prediction
Lipidationi1016 – 10161S-palmitoyl cysteine1 Publication

Post-translational modificationi

Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiP26006.
PaxDbiP26006.
PRIDEiP26006.

PTM databases

PhosphoSiteiP26006.

Miscellaneous databases

PMAP-CutDBP26006.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells.1 Publication

Gene expression databases

ArrayExpressiP26006.
BgeeiP26006.
CleanExiHS_ITGA3.
GenevestigatoriP26006.

Organism-specific databases

HPAiCAB018594.
HPA008572.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.1 Publication

Protein-protein interaction databases

BioGridi109882. 16 interactions.
DIPiDIP-140N.
IntActiP26006. 3 interactions.
MINTiMINT-140288.
STRINGi9606.ENSP00000007722.

Structurei

3D structure databases

ProteinModelPortaliP26006.
SMRiP26006. Positions 33-862, 990-1028.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati38 – 10366FG-GAP 1
Add
BLAST
Repeati110 – 17162FG-GAP 2
Add
BLAST
Repeati185 – 23652FG-GAP 3
Add
BLAST
Repeati237 – 29357FG-GAP 4
Add
BLAST
Repeati294 – 35461FG-GAP 5
Add
BLAST
Repeati356 – 41156FG-GAP 6
Add
BLAST
Repeati415 – 47763FG-GAP 7
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1015 – 10217Interaction with HPS5

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1017 – 10215GFFKR motif

Sequence similaritiesi

Contains 7 FG-GAP repeats.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG26407.
HOGENOMiHOG000015786.
HOVERGENiHBG108011.
InParanoidiP26006.
KOiK06482.
OMAiYNQSAGN.
OrthoDBiEOG7K3TK7.
TreeFamiTF105391.

Family and domain databases

InterProiIPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view]
PfamiPF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
[Graphical view]
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P26006-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS     50
LFGYSVALHR QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK 100
DDCERMNITV KNDPGHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS 150
GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY HNEMCNSNTD YLETGMCQLG 200
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK DPEDQGNLYI 250
GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG 300
SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG 350
TSFPAHPSLL LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY 400
IYHSSSKGLL RQPQQVIHGE KLGLPGLATF GYSLSGQMDV DENFYPDLLV 450
GSLSDHIVLL RARPVINIVH KTLVPRPAVL DPALCTATSC VQVELCFAYN 500
QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH GFFSMPEMRC 550
QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA 600
QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK 650
LLLSINVTNT RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI 700
FCELGNPFKR NQRMELLIAF EVIGVTLHTR DLQVQLQLST SSHQDNLWPM 750
ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM GESGMKTVED VGSPLKYEFQ 800
VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG NGSWPCRPPG 850
DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET 900
VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV 950
NGWATLFLRT SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG 1000
AGLLLLGLII LLLWKCGFFK RARTRALYEA KRQKAEMKSQ PSETERLTDD 1050
Y 1051
Length:1,051
Mass (Da):116,612
Last modified:September 21, 2011 - v5
Checksum:iEEAFA7778EF17B21
GO
Isoform 2 (identifier: P26006-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

Show »
Length:1,066
Mass (Da):118,756
Checksum:i18F243887966B8CE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti268 – 2681I → F.
Corresponds to variant rs2230390 [ dbSNP | Ensembl ].
VAR_055967
Natural varianti628 – 6281R → P in ILNEB. 1 Publication
VAR_068808
Natural varianti719 – 7191A → T.
Corresponds to variant rs2230392 [ dbSNP | Ensembl ].
VAR_055968
Natural varianti840 – 8401G → S.
Corresponds to variant rs2301626 [ dbSNP | Ensembl ].
VAR_055969

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1017 – 105135GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2.
VSP_002721Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M59911 mRNA. Translation: AAA36120.1.
AK289961 mRNA. Translation: BAF82650.1.
AC002401 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94645.1.
CH471109 Genomic DNA. Translation: EAW94646.1.
CH471109 Genomic DNA. Translation: EAW94647.1.
CH471109 Genomic DNA. Translation: EAW94648.1.
BC136636 mRNA. Translation: AAI36637.1.
BC144328 mRNA. Translation: AAI44329.1.
BC150190 mRNA. Translation: AAI50191.1.
D01038 mRNA. Translation: BAA00845.1.
CCDSiCCDS11557.1. [P26006-1]
CCDS11558.1. [P26006-2]
PIRiA40021.
RefSeqiNP_002195.1. NM_002204.2. [P26006-2]
NP_005492.1. NM_005501.2. [P26006-1]
UniGeneiHs.265829.

Genome annotation databases

EnsembliENST00000007722; ENSP00000007722; ENSG00000005884. [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884. [P26006-2]
GeneIDi3675.
KEGGihsa:3675.
UCSCiuc010dbl.3. human. [P26006-2]
uc010dbm.3. human. [P26006-1]

Polymorphism databases

DMDMi347595830.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M59911 mRNA. Translation: AAA36120.1 .
AK289961 mRNA. Translation: BAF82650.1 .
AC002401 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94645.1 .
CH471109 Genomic DNA. Translation: EAW94646.1 .
CH471109 Genomic DNA. Translation: EAW94647.1 .
CH471109 Genomic DNA. Translation: EAW94648.1 .
BC136636 mRNA. Translation: AAI36637.1 .
BC144328 mRNA. Translation: AAI44329.1 .
BC150190 mRNA. Translation: AAI50191.1 .
D01038 mRNA. Translation: BAA00845.1 .
CCDSi CCDS11557.1. [P26006-1 ]
CCDS11558.1. [P26006-2 ]
PIRi A40021.
RefSeqi NP_002195.1. NM_002204.2. [P26006-2 ]
NP_005492.1. NM_005501.2. [P26006-1 ]
UniGenei Hs.265829.

3D structure databases

ProteinModelPortali P26006.
SMRi P26006. Positions 33-862, 990-1028.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109882. 16 interactions.
DIPi DIP-140N.
IntActi P26006. 3 interactions.
MINTi MINT-140288.
STRINGi 9606.ENSP00000007722.

Chemistry

BindingDBi P26006.
ChEMBLi CHEMBL3525.

PTM databases

PhosphoSitei P26006.

Polymorphism databases

DMDMi 347595830.

Proteomic databases

MaxQBi P26006.
PaxDbi P26006.
PRIDEi P26006.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000007722 ; ENSP00000007722 ; ENSG00000005884 . [P26006-1 ]
ENST00000320031 ; ENSP00000315190 ; ENSG00000005884 . [P26006-2 ]
GeneIDi 3675.
KEGGi hsa:3675.
UCSCi uc010dbl.3. human. [P26006-2 ]
uc010dbm.3. human. [P26006-1 ]

Organism-specific databases

CTDi 3675.
GeneCardsi GC17P048133.
HGNCi HGNC:6139. ITGA3.
HPAi CAB018594.
HPA008572.
MIMi 605025. gene.
614748. phenotype.
neXtProti NX_P26006.
Orphaneti 306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
PharmGKBi PA29939.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG26407.
HOGENOMi HOG000015786.
HOVERGENi HBG108011.
InParanoidi P26006.
KOi K06482.
OMAi YNQSAGN.
OrthoDBi EOG7K3TK7.
TreeFami TF105391.

Enzyme and pathway databases

Reactomei REACT_12560. Basigin interactions.
REACT_13552. Integrin cell surface interactions.
REACT_169262. Laminin interactions.

Miscellaneous databases

ChiTaRSi ITGA3. human.
GeneWikii CD49c.
GenomeRNAii 3675.
NextBioi 14385.
PMAP-CutDB P26006.
PROi P26006.
SOURCEi Search...

Gene expression databases

ArrayExpressi P26006.
Bgeei P26006.
CleanExi HS_ITGA3.
Genevestigatori P26006.

Family and domain databases

InterProi IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view ]
Pfami PF08441. Integrin_alpha2. 1 hit.
[Graphical view ]
PRINTSi PR01185. INTEGRINA.
SMARTi SM00191. Int_alpha. 5 hits.
[Graphical view ]
PROSITEi PS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen."
    Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E.
    J. Cell Biol. 115:257-266(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3."
    Tsuji T., Hakomori S., Osawa T.
    J. Biochem. 109:659-665(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1051 (ISOFORM 1).
    Tissue: Fibroblast.
  7. "Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system."
    Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y.
    EMBO J. 13:2044-2055(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 33-49.
  8. "The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis."
    Takada Y., Strominger J.L., Hemler M.E.
    Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 33-46.
  9. "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization."
    de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A.
    Lab. Invest. 76:547-563(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY.
  10. "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains."
    Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A.
    Biochemistry 42:12950-12959(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BONDS.
  11. "Palmitoylation supports assembly and function of integrin-tetraspanin complexes."
    Yang X., Kovalenko O.V., Tang W., Claas C., Stipp C.S., Hemler M.E.
    J. Cell Biol. 167:1231-1240(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PALMITOYLATION AT CYS-1016, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-1016.
  12. "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
    Fukushi J., Makagiansar I.T., Stallcup W.B.
    Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: VARIANT ILNEB PRO-628.

Entry informationi

Entry nameiITA3_HUMAN
AccessioniPrimary (citable) accession number: P26006
Secondary accession number(s): A7E246
, B7ZM80, B9EGQ1, D3DTX4, D3DTX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: September 21, 2011
Last modified: September 3, 2014
This is version 158 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi