Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P26006

- ITA3_HUMAN

UniProt

P26006 - ITA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Integrin alpha-3

Gene

ITGA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi315 – 3239Sequence Analysis
Calcium bindingi378 – 3869Sequence Analysis
Calcium bindingi439 – 4479Sequence Analysis

GO - Molecular functioni

  1. glycoprotein binding Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
  3. protease binding Source: UniProtKB
  4. protein heterodimerization activity Source: UniProtKB

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cell-matrix adhesion Source: ProtInc
  3. extracellular matrix organization Source: Reactome
  4. heart development Source: Ensembl
  5. integrin-mediated signaling pathway Source: UniProtKB-KW
  6. leukocyte migration Source: Reactome
  7. lung development Source: UniProtKB
  8. maternal process involved in female pregnancy Source: Ensembl
  9. memory Source: Ensembl
  10. mesodermal cell differentiation Source: UniProtKB
  11. negative regulation of cell projection organization Source: Ensembl
  12. nephron development Source: UniProtKB
  13. neuron migration Source: Ensembl
  14. positive regulation of cell-substrate adhesion Source: Ensembl
  15. positive regulation of epithelial cell migration Source: Ensembl
  16. positive regulation of establishment of protein localization to plasma membrane Source: UniProtKB
  17. positive regulation of gene expression Source: Ensembl
  18. positive regulation of neuron projection development Source: Ensembl
  19. regulation of BMP signaling pathway Source: UniProtKB
  20. regulation of transforming growth factor beta receptor signaling pathway Source: UniProtKB
  21. regulation of Wnt signaling pathway Source: UniProtKB
  22. renal filtration Source: UniProtKB
  23. response to drug Source: Ensembl
  24. response to gonadotropin Source: Ensembl
  25. skin development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_12560. Basigin interactions.
REACT_13552. Integrin cell surface interactions.
REACT_169262. Laminin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
FRP-2
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
Gene namesi
Name:ITGA3
Synonyms:MSK18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:6139. ITGA3.

Subcellular locationi

Cell membrane 1 Publication; Single-pass type I membrane protein Sequence Analysis. Cell membrane 1 Publication; Lipid-anchor 1 Publication. Cell projectioninvadopodium membrane 1 Publication; Single-pass type I membrane protein Sequence Analysis. Cell projectionfilopodium membrane 1 Publication; Single-pass type I membrane protein Sequence Analysis
Note: Enriched preferentially at invadopodia, cell membrane protrusions that correspond to sites of cell invasion, in a collagen-dependent manner.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini33 – 991959ExtracellularSequence AnalysisAdd
BLAST
Transmembranei992 – 101423HelicalSequence AnalysisAdd
BLAST
Topological domaini1015 – 105137CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. basolateral plasma membrane Source: Ensembl
  2. cell periphery Source: UniProtKB
  3. cell surface Source: UniProtKB
  4. external side of plasma membrane Source: Ensembl
  5. extracellular vesicular exosome Source: UniProt
  6. filopodium membrane Source: UniProtKB
  7. focal adhesion Source: UniProtKB
  8. growth cone Source: Ensembl
  9. integrin alpha3-beta1 complex Source: UniProtKB
  10. integrin complex Source: ProtInc
  11. invadopodium membrane Source: UniProtKB
  12. perinuclear region of cytoplasm Source: Ensembl
  13. plasma membrane Source: BHF-UCL
  14. receptor complex Source: MGI
  15. synapse Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Involvement in diseasei

Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB) [MIM:614748]: A multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti628 – 6281R → P in ILNEB. 1 Publication
VAR_068808

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1016 – 10161C → S: Abolishes palmitoylation. 1 Publication

Keywords - Diseasei

Epidermolysis bullosa

Organism-specific databases

MIMi614748. phenotype.
Orphaneti306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
PharmGKBiPA29939.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 32323 PublicationsAdd
BLAST
Chaini33 – 10511019Integrin alpha-3PRO_0000016238Add
BLAST
Chaini33 – 872840Integrin alpha-3 heavy chainSequence AnalysisPRO_0000016239Add
BLAST
Chaini876 – 1051176Integrin alpha-3 light chainSequence AnalysisPRO_0000016240Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi86 – 861N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi94 ↔ 1031 Publication
Glycosylationi107 – 1071N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi140 ↔ 1621 Publication
Disulfide bondi185 ↔ 1971 Publication
Glycosylationi265 – 2651N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi485 ↔ 490By similarity
Disulfide bondi496 ↔ 550By similarity
Glycosylationi500 – 5001N-linked (GlcNAc...)Sequence Analysis
Glycosylationi511 – 5111N-linked (GlcNAc...)Sequence Analysis
Glycosylationi573 – 5731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi605 – 6051N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi615 ↔ 6211 Publication
Glycosylationi656 – 6561N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi694 ↔ 7021 Publication
Glycosylationi697 – 6971N-linked (GlcNAc...)Sequence Analysis
Glycosylationi841 – 8411N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi846 ↔ 904Interchain (between heavy and light chains)1 Publication
Glycosylationi857 – 8571N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi911 ↔ 9161 Publication
Glycosylationi926 – 9261N-linked (GlcNAc...)Sequence Analysis
Glycosylationi935 – 9351N-linked (GlcNAc...)Sequence Analysis
Glycosylationi969 – 9691N-linked (GlcNAc...)Sequence Analysis
Lipidationi1016 – 10161S-palmitoyl cysteine1 Publication

Post-translational modificationi

Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiP26006.
PaxDbiP26006.
PRIDEiP26006.

PTM databases

PhosphoSiteiP26006.

Miscellaneous databases

PMAP-CutDBP26006.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells.1 Publication

Gene expression databases

BgeeiP26006.
CleanExiHS_ITGA3.
ExpressionAtlasiP26006. baseline and differential.
GenevestigatoriP26006.

Organism-specific databases

HPAiCAB018594.
HPA008572.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.2 Publications

Protein-protein interaction databases

BioGridi109882. 16 interactions.
DIPiDIP-140N.
IntActiP26006. 3 interactions.
MINTiMINT-140288.
STRINGi9606.ENSP00000007722.

Structurei

3D structure databases

ProteinModelPortaliP26006.
SMRiP26006. Positions 33-862.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati38 – 10366FG-GAP 1Add
BLAST
Repeati110 – 17162FG-GAP 2Add
BLAST
Repeati185 – 23652FG-GAP 3Add
BLAST
Repeati237 – 29357FG-GAP 4Add
BLAST
Repeati294 – 35461FG-GAP 5Add
BLAST
Repeati356 – 41156FG-GAP 6Add
BLAST
Repeati415 – 47763FG-GAP 7Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1015 – 10217Interaction with HPS5

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1017 – 10215GFFKR motif

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated
Contains 7 FG-GAP repeats.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG26407.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000015786.
HOVERGENiHBG108011.
InParanoidiP26006.
KOiK06482.
OMAiYNQSAGN.
OrthoDBiEOG7K3TK7.
TreeFamiTF105391.

Family and domain databases

InterProiIPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view]
PfamiPF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
[Graphical view]
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P26006-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMNITV KNDPGHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS
160 170 180 190 200
GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY HNEMCNSNTD YLETGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK DPEDQGNLYI
260 270 280 290 300
GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG
310 320 330 340 350
SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG
360 370 380 390 400
TSFPAHPSLL LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY
410 420 430 440 450
IYHSSSKGLL RQPQQVIHGE KLGLPGLATF GYSLSGQMDV DENFYPDLLV
460 470 480 490 500
GSLSDHIVLL RARPVINIVH KTLVPRPAVL DPALCTATSC VQVELCFAYN
510 520 530 540 550
QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH GFFSMPEMRC
560 570 580 590 600
QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA
610 620 630 640 650
QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK
660 670 680 690 700
LLLSINVTNT RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI
710 720 730 740 750
FCELGNPFKR NQRMELLIAF EVIGVTLHTR DLQVQLQLST SSHQDNLWPM
760 770 780 790 800
ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM GESGMKTVED VGSPLKYEFQ
810 820 830 840 850
VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG NGSWPCRPPG
860 870 880 890 900
DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET
910 920 930 940 950
VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV
960 970 980 990 1000
NGWATLFLRT SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG
1010 1020 1030 1040 1050
AGLLLLGLII LLLWKCGFFK RARTRALYEA KRQKAEMKSQ PSETERLTDD

Y
Length:1,051
Mass (Da):116,612
Last modified:September 21, 2011 - v5
Checksum:iEEAFA7778EF17B21
GO
Isoform 2 (identifier: P26006-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

Show »
Length:1,066
Mass (Da):118,756
Checksum:i18F243887966B8CE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti268 – 2681I → F.
Corresponds to variant rs2230390 [ dbSNP | Ensembl ].
VAR_055967
Natural varianti628 – 6281R → P in ILNEB. 1 Publication
VAR_068808
Natural varianti719 – 7191A → T.
Corresponds to variant rs2230392 [ dbSNP | Ensembl ].
VAR_055968
Natural varianti840 – 8401G → S.
Corresponds to variant rs2301626 [ dbSNP | Ensembl ].
VAR_055969

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1017 – 105135GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2. 1 PublicationVSP_002721Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M59911 mRNA. Translation: AAA36120.1.
AK289961 mRNA. Translation: BAF82650.1.
AC002401 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94645.1.
CH471109 Genomic DNA. Translation: EAW94646.1.
CH471109 Genomic DNA. Translation: EAW94647.1.
CH471109 Genomic DNA. Translation: EAW94648.1.
BC136636 mRNA. Translation: AAI36637.1.
BC144328 mRNA. Translation: AAI44329.1.
BC150190 mRNA. Translation: AAI50191.1.
D01038 mRNA. Translation: BAA00845.1.
CCDSiCCDS11557.1. [P26006-1]
CCDS11558.1. [P26006-2]
PIRiA40021.
RefSeqiNP_002195.1. NM_002204.2. [P26006-2]
NP_005492.1. NM_005501.2. [P26006-1]
UniGeneiHs.265829.

Genome annotation databases

EnsembliENST00000007722; ENSP00000007722; ENSG00000005884. [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884. [P26006-2]
GeneIDi3675.
KEGGihsa:3675.
UCSCiuc010dbl.3. human. [P26006-2]
uc010dbm.3. human. [P26006-1]

Polymorphism databases

DMDMi347595830.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M59911 mRNA. Translation: AAA36120.1 .
AK289961 mRNA. Translation: BAF82650.1 .
AC002401 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94645.1 .
CH471109 Genomic DNA. Translation: EAW94646.1 .
CH471109 Genomic DNA. Translation: EAW94647.1 .
CH471109 Genomic DNA. Translation: EAW94648.1 .
BC136636 mRNA. Translation: AAI36637.1 .
BC144328 mRNA. Translation: AAI44329.1 .
BC150190 mRNA. Translation: AAI50191.1 .
D01038 mRNA. Translation: BAA00845.1 .
CCDSi CCDS11557.1. [P26006-1 ]
CCDS11558.1. [P26006-2 ]
PIRi A40021.
RefSeqi NP_002195.1. NM_002204.2. [P26006-2 ]
NP_005492.1. NM_005501.2. [P26006-1 ]
UniGenei Hs.265829.

3D structure databases

ProteinModelPortali P26006.
SMRi P26006. Positions 33-862.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109882. 16 interactions.
DIPi DIP-140N.
IntActi P26006. 3 interactions.
MINTi MINT-140288.
STRINGi 9606.ENSP00000007722.

Chemistry

ChEMBLi CHEMBL3525.

PTM databases

PhosphoSitei P26006.

Polymorphism databases

DMDMi 347595830.

Proteomic databases

MaxQBi P26006.
PaxDbi P26006.
PRIDEi P26006.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000007722 ; ENSP00000007722 ; ENSG00000005884 . [P26006-1 ]
ENST00000320031 ; ENSP00000315190 ; ENSG00000005884 . [P26006-2 ]
GeneIDi 3675.
KEGGi hsa:3675.
UCSCi uc010dbl.3. human. [P26006-2 ]
uc010dbm.3. human. [P26006-1 ]

Organism-specific databases

CTDi 3675.
GeneCardsi GC17P048133.
HGNCi HGNC:6139. ITGA3.
HPAi CAB018594.
HPA008572.
MIMi 605025. gene.
614748. phenotype.
neXtProti NX_P26006.
Orphaneti 306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
PharmGKBi PA29939.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG26407.
GeneTreei ENSGT00760000118782.
HOGENOMi HOG000015786.
HOVERGENi HBG108011.
InParanoidi P26006.
KOi K06482.
OMAi YNQSAGN.
OrthoDBi EOG7K3TK7.
TreeFami TF105391.

Enzyme and pathway databases

Reactomei REACT_12560. Basigin interactions.
REACT_13552. Integrin cell surface interactions.
REACT_169262. Laminin interactions.

Miscellaneous databases

ChiTaRSi ITGA3. human.
GeneWikii CD49c.
GenomeRNAii 3675.
NextBioi 14385.
PMAP-CutDB P26006.
PROi P26006.
SOURCEi Search...

Gene expression databases

Bgeei P26006.
CleanExi HS_ITGA3.
ExpressionAtlasi P26006. baseline and differential.
Genevestigatori P26006.

Family and domain databases

InterProi IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view ]
Pfami PF08441. Integrin_alpha2. 1 hit.
[Graphical view ]
PRINTSi PR01185. INTEGRINA.
SMARTi SM00191. Int_alpha. 5 hits.
[Graphical view ]
PROSITEi PS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen."
    Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E.
    J. Cell Biol. 115:257-266(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3."
    Tsuji T., Hakomori S., Osawa T.
    J. Biochem. 109:659-665(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1051 (ISOFORM 1).
    Tissue: Fibroblast.
  7. "Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system."
    Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y.
    EMBO J. 13:2044-2055(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 33-49.
  8. "The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis."
    Takada Y., Strominger J.L., Hemler M.E.
    Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 33-46.
  9. Cited for: PROTEIN SEQUENCE OF 33-40, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, INTERACTION WITH FAP.
  10. "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization."
    de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A.
    Lab. Invest. 76:547-563(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY.
  11. "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains."
    Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A.
    Biochemistry 42:12950-12959(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BONDS.
  12. "Palmitoylation supports assembly and function of integrin-tetraspanin complexes."
    Yang X., Kovalenko O.V., Tang W., Claas C., Stipp C.S., Hemler M.E.
    J. Cell Biol. 167:1231-1240(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PALMITOYLATION AT CYS-1016, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-1016.
  13. "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
    Fukushi J., Makagiansar I.T., Stallcup W.B.
    Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: VARIANT ILNEB PRO-628.

Entry informationi

Entry nameiITA3_HUMAN
AccessioniPrimary (citable) accession number: P26006
Secondary accession number(s): A7E246
, B7ZM80, B9EGQ1, D3DTX4, D3DTX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: September 21, 2011
Last modified: November 26, 2014
This is version 161 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3