Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P26006

- ITA3_HUMAN

UniProt

P26006 - ITA3_HUMAN

Protein

Integrin alpha-3

Gene

ITGA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 159 (01 Oct 2014)
      Sequence version 5 (21 Sep 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi315 – 3239Sequence Analysis
    Calcium bindingi378 – 3869Sequence Analysis
    Calcium bindingi439 – 4479Sequence Analysis

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. cell-matrix adhesion Source: ProtInc
    3. extracellular matrix organization Source: Reactome
    4. heart development Source: Ensembl
    5. integrin-mediated signaling pathway Source: UniProtKB-KW
    6. leukocyte migration Source: Reactome
    7. maternal process involved in female pregnancy Source: Ensembl
    8. memory Source: Ensembl
    9. negative regulation of cell projection organization Source: Ensembl
    10. neuron migration Source: Ensembl
    11. positive regulation of cell-substrate adhesion Source: Ensembl
    12. positive regulation of epithelial cell migration Source: Ensembl
    13. positive regulation of gene expression Source: Ensembl
    14. positive regulation of neuron projection development Source: Ensembl
    15. response to drug Source: Ensembl
    16. response to gonadotropin Source: Ensembl

    Keywords - Molecular functioni

    Integrin, Receptor

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_12560. Basigin interactions.
    REACT_13552. Integrin cell surface interactions.
    REACT_169262. Laminin interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Integrin alpha-3
    Alternative name(s):
    CD49 antigen-like family member C
    FRP-2
    Galactoprotein B3
    Short name:
    GAPB3
    VLA-3 subunit alpha
    CD_antigen: CD49c
    Cleaved into the following 2 chains:
    Gene namesi
    Name:ITGA3
    Synonyms:MSK18
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:6139. ITGA3.

    Subcellular locationi

    Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication. Cell membrane 1 Publication; Lipid-anchor 1 Publication

    GO - Cellular componenti

    1. basolateral plasma membrane Source: Ensembl
    2. cell surface Source: UniProtKB
    3. extracellular vesicular exosome Source: UniProt
    4. growth cone Source: Ensembl
    5. integrin alpha3-beta1 complex Source: Ensembl
    6. integrin complex Source: ProtInc
    7. perinuclear region of cytoplasm Source: Ensembl
    8. plasma membrane Source: BHF-UCL
    9. receptor complex Source: MGI
    10. synapse Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB) [MIM:614748]: A multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti628 – 6281R → P in ILNEB. 1 Publication
    VAR_068808

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1016 – 10161C → S: Abolishes palmitoylation. 1 Publication

    Keywords - Diseasei

    Epidermolysis bullosa

    Organism-specific databases

    MIMi614748. phenotype.
    Orphaneti306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
    PharmGKBiPA29939.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 32322 PublicationsAdd
    BLAST
    Chaini33 – 10511019Integrin alpha-3PRO_0000016238Add
    BLAST
    Chaini33 – 872840Integrin alpha-3 heavy chainSequence AnalysisPRO_0000016239Add
    BLAST
    Chaini876 – 1051176Integrin alpha-3 light chainSequence AnalysisPRO_0000016240Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi86 – 861N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi94 ↔ 1031 Publication
    Glycosylationi107 – 1071N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi140 ↔ 1621 Publication
    Disulfide bondi185 ↔ 1971 Publication
    Glycosylationi265 – 2651N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi485 ↔ 490By similarity
    Disulfide bondi496 ↔ 550By similarity
    Glycosylationi500 – 5001N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi511 – 5111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi573 – 5731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi605 – 6051N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi615 ↔ 6211 Publication
    Glycosylationi656 – 6561N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi694 ↔ 7021 Publication
    Glycosylationi697 – 6971N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi841 – 8411N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi846 ↔ 904Interchain (between heavy and light chains)1 Publication
    Glycosylationi857 – 8571N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi911 ↔ 9161 Publication
    Glycosylationi926 – 9261N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi935 – 9351N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi969 – 9691N-linked (GlcNAc...)Sequence Analysis
    Lipidationi1016 – 10161S-palmitoyl cysteine1 Publication

    Post-translational modificationi

    Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation.1 Publication

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    MaxQBiP26006.
    PaxDbiP26006.
    PRIDEiP26006.

    PTM databases

    PhosphoSiteiP26006.

    Miscellaneous databases

    PMAP-CutDBP26006.

    Expressioni

    Tissue specificityi

    Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells.1 Publication

    Gene expression databases

    ArrayExpressiP26006.
    BgeeiP26006.
    CleanExiHS_ITGA3.
    GenevestigatoriP26006.

    Organism-specific databases

    HPAiCAB018594.
    HPA008572.

    Interactioni

    Subunit structurei

    Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.1 Publication

    Protein-protein interaction databases

    BioGridi109882. 16 interactions.
    DIPiDIP-140N.
    IntActiP26006. 3 interactions.
    MINTiMINT-140288.
    STRINGi9606.ENSP00000007722.

    Structurei

    3D structure databases

    ProteinModelPortaliP26006.
    SMRiP26006. Positions 33-862, 990-1028.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini33 – 991959ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1015 – 105137CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei992 – 101423HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati38 – 10366FG-GAP 1Add
    BLAST
    Repeati110 – 17162FG-GAP 2Add
    BLAST
    Repeati185 – 23652FG-GAP 3Add
    BLAST
    Repeati237 – 29357FG-GAP 4Add
    BLAST
    Repeati294 – 35461FG-GAP 5Add
    BLAST
    Repeati356 – 41156FG-GAP 6Add
    BLAST
    Repeati415 – 47763FG-GAP 7Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1015 – 10217Interaction with HPS5

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi1017 – 10215GFFKR motif

    Sequence similaritiesi

    Belongs to the integrin alpha chain family.Curated
    Contains 7 FG-GAP repeats.Curated

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG26407.
    HOGENOMiHOG000015786.
    HOVERGENiHBG108011.
    InParanoidiP26006.
    KOiK06482.
    OMAiYNQSAGN.
    OrthoDBiEOG7K3TK7.
    TreeFamiTF105391.

    Family and domain databases

    InterProiIPR013519. Int_alpha_beta-p.
    IPR000413. Integrin_alpha.
    IPR013649. Integrin_alpha-2.
    IPR018184. Integrin_alpha_C_CS.
    [Graphical view]
    PfamiPF08441. Integrin_alpha2. 1 hit.
    [Graphical view]
    PRINTSiPR01185. INTEGRINA.
    SMARTiSM00191. Int_alpha. 5 hits.
    [Graphical view]
    PROSITEiPS51470. FG_GAP. 7 hits.
    PS00242. INTEGRIN_ALPHA. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P26006-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS     50
    LFGYSVALHR QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK 100
    DDCERMNITV KNDPGHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS 150
    GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY HNEMCNSNTD YLETGMCQLG 200
    TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK DPEDQGNLYI 250
    GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG 300
    SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG 350
    TSFPAHPSLL LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY 400
    IYHSSSKGLL RQPQQVIHGE KLGLPGLATF GYSLSGQMDV DENFYPDLLV 450
    GSLSDHIVLL RARPVINIVH KTLVPRPAVL DPALCTATSC VQVELCFAYN 500
    QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH GFFSMPEMRC 550
    QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA 600
    QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK 650
    LLLSINVTNT RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI 700
    FCELGNPFKR NQRMELLIAF EVIGVTLHTR DLQVQLQLST SSHQDNLWPM 750
    ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM GESGMKTVED VGSPLKYEFQ 800
    VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG NGSWPCRPPG 850
    DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET 900
    VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV 950
    NGWATLFLRT SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG 1000
    AGLLLLGLII LLLWKCGFFK RARTRALYEA KRQKAEMKSQ PSETERLTDD 1050
    Y 1051
    Length:1,051
    Mass (Da):116,612
    Last modified:September 21, 2011 - v5
    Checksum:iEEAFA7778EF17B21
    GO
    Isoform 2 (identifier: P26006-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3B

    The sequence of this isoform differs from the canonical sequence as follows:
         1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

    Show »
    Length:1,066
    Mass (Da):118,756
    Checksum:i18F243887966B8CE
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti268 – 2681I → F.
    Corresponds to variant rs2230390 [ dbSNP | Ensembl ].
    VAR_055967
    Natural varianti628 – 6281R → P in ILNEB. 1 Publication
    VAR_068808
    Natural varianti719 – 7191A → T.
    Corresponds to variant rs2230392 [ dbSNP | Ensembl ].
    VAR_055968
    Natural varianti840 – 8401G → S.
    Corresponds to variant rs2301626 [ dbSNP | Ensembl ].
    VAR_055969

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1017 – 105135GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2. 1 PublicationVSP_002721Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M59911 mRNA. Translation: AAA36120.1.
    AK289961 mRNA. Translation: BAF82650.1.
    AC002401 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94645.1.
    CH471109 Genomic DNA. Translation: EAW94646.1.
    CH471109 Genomic DNA. Translation: EAW94647.1.
    CH471109 Genomic DNA. Translation: EAW94648.1.
    BC136636 mRNA. Translation: AAI36637.1.
    BC144328 mRNA. Translation: AAI44329.1.
    BC150190 mRNA. Translation: AAI50191.1.
    D01038 mRNA. Translation: BAA00845.1.
    CCDSiCCDS11557.1. [P26006-1]
    CCDS11558.1. [P26006-2]
    PIRiA40021.
    RefSeqiNP_002195.1. NM_002204.2. [P26006-2]
    NP_005492.1. NM_005501.2. [P26006-1]
    UniGeneiHs.265829.

    Genome annotation databases

    EnsembliENST00000007722; ENSP00000007722; ENSG00000005884. [P26006-1]
    ENST00000320031; ENSP00000315190; ENSG00000005884. [P26006-2]
    GeneIDi3675.
    KEGGihsa:3675.
    UCSCiuc010dbl.3. human. [P26006-2]
    uc010dbm.3. human. [P26006-1]

    Polymorphism databases

    DMDMi347595830.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M59911 mRNA. Translation: AAA36120.1 .
    AK289961 mRNA. Translation: BAF82650.1 .
    AC002401 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94645.1 .
    CH471109 Genomic DNA. Translation: EAW94646.1 .
    CH471109 Genomic DNA. Translation: EAW94647.1 .
    CH471109 Genomic DNA. Translation: EAW94648.1 .
    BC136636 mRNA. Translation: AAI36637.1 .
    BC144328 mRNA. Translation: AAI44329.1 .
    BC150190 mRNA. Translation: AAI50191.1 .
    D01038 mRNA. Translation: BAA00845.1 .
    CCDSi CCDS11557.1. [P26006-1 ]
    CCDS11558.1. [P26006-2 ]
    PIRi A40021.
    RefSeqi NP_002195.1. NM_002204.2. [P26006-2 ]
    NP_005492.1. NM_005501.2. [P26006-1 ]
    UniGenei Hs.265829.

    3D structure databases

    ProteinModelPortali P26006.
    SMRi P26006. Positions 33-862, 990-1028.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109882. 16 interactions.
    DIPi DIP-140N.
    IntActi P26006. 3 interactions.
    MINTi MINT-140288.
    STRINGi 9606.ENSP00000007722.

    Chemistry

    BindingDBi P26006.
    ChEMBLi CHEMBL3525.

    PTM databases

    PhosphoSitei P26006.

    Polymorphism databases

    DMDMi 347595830.

    Proteomic databases

    MaxQBi P26006.
    PaxDbi P26006.
    PRIDEi P26006.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000007722 ; ENSP00000007722 ; ENSG00000005884 . [P26006-1 ]
    ENST00000320031 ; ENSP00000315190 ; ENSG00000005884 . [P26006-2 ]
    GeneIDi 3675.
    KEGGi hsa:3675.
    UCSCi uc010dbl.3. human. [P26006-2 ]
    uc010dbm.3. human. [P26006-1 ]

    Organism-specific databases

    CTDi 3675.
    GeneCardsi GC17P048133.
    HGNCi HGNC:6139. ITGA3.
    HPAi CAB018594.
    HPA008572.
    MIMi 605025. gene.
    614748. phenotype.
    neXtProti NX_P26006.
    Orphaneti 306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
    PharmGKBi PA29939.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG26407.
    HOGENOMi HOG000015786.
    HOVERGENi HBG108011.
    InParanoidi P26006.
    KOi K06482.
    OMAi YNQSAGN.
    OrthoDBi EOG7K3TK7.
    TreeFami TF105391.

    Enzyme and pathway databases

    Reactomei REACT_12560. Basigin interactions.
    REACT_13552. Integrin cell surface interactions.
    REACT_169262. Laminin interactions.

    Miscellaneous databases

    ChiTaRSi ITGA3. human.
    GeneWikii CD49c.
    GenomeRNAii 3675.
    NextBioi 14385.
    PMAP-CutDB P26006.
    PROi P26006.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P26006.
    Bgeei P26006.
    CleanExi HS_ITGA3.
    Genevestigatori P26006.

    Family and domain databases

    InterProi IPR013519. Int_alpha_beta-p.
    IPR000413. Integrin_alpha.
    IPR013649. Integrin_alpha-2.
    IPR018184. Integrin_alpha_C_CS.
    [Graphical view ]
    Pfami PF08441. Integrin_alpha2. 1 hit.
    [Graphical view ]
    PRINTSi PR01185. INTEGRINA.
    SMARTi SM00191. Int_alpha. 5 hits.
    [Graphical view ]
    PROSITEi PS51470. FG_GAP. 7 hits.
    PS00242. INTEGRIN_ALPHA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen."
      Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E.
      J. Cell Biol. 115:257-266(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hippocampus.
    3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    6. "Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3."
      Tsuji T., Hakomori S., Osawa T.
      J. Biochem. 109:659-665(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1051 (ISOFORM 1).
      Tissue: Fibroblast.
    7. "Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system."
      Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y.
      EMBO J. 13:2044-2055(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 33-49.
    8. "The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis."
      Takada Y., Strominger J.L., Hemler M.E.
      Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 33-46.
    9. "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization."
      de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A.
      Lab. Invest. 76:547-563(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY.
    10. "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains."
      Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A.
      Biochemistry 42:12950-12959(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISULFIDE BONDS.
    11. "Palmitoylation supports assembly and function of integrin-tetraspanin complexes."
      Yang X., Kovalenko O.V., Tang W., Claas C., Stipp C.S., Hemler M.E.
      J. Cell Biol. 167:1231-1240(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PALMITOYLATION AT CYS-1016, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-1016.
    12. "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
      Fukushi J., Makagiansar I.T., Stallcup W.B.
      Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: VARIANT ILNEB PRO-628.

    Entry informationi

    Entry nameiITA3_HUMAN
    AccessioniPrimary (citable) accession number: P26006
    Secondary accession number(s): A7E246
    , B7ZM80, B9EGQ1, D3DTX4, D3DTX5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 1992
    Last sequence update: September 21, 2011
    Last modified: October 1, 2014
    This is version 159 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3