Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P26006 (ITA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 154. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
FRP-2
Galactoprotein B3
Short name=GAPB3
VLA-3 subunit alpha
CD_antigen=CD49c
Gene names
Name:ITGA3
Synonyms:MSK18
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1051 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Ref.11

Subunit structure

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Ref.11

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells. Ref.9

Post-translational modification

Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation. Ref.9

Involvement in disease

Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB) [MIM:614748]: A multiorgan disorder characterized by congenital nephrotic syndrome, interstitial lung disease, and epidermolysis bullosa. The respiratory and renal features predominate, and lung involvement accounts for the lethal course of the disease.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.13

Sequence similarities

Belongs to the integrin alpha chain family.

Contains 7 FG-GAP repeats.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DiseaseEpidermolysis bullosa
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   LigandCalcium
Metal-binding
   Molecular functionIntegrin
Receptor
   PTMCleavage on pair of basic residues
Disulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processblood coagulation

Traceable author statement. Source: Reactome

cell-matrix adhesion

Traceable author statement Ref.1. Source: ProtInc

extracellular matrix organization

Traceable author statement. Source: Reactome

heart development

Inferred from electronic annotation. Source: Ensembl

integrin-mediated signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

leukocyte migration

Traceable author statement. Source: Reactome

maternal process involved in female pregnancy

Inferred from electronic annotation. Source: Ensembl

memory

Inferred from electronic annotation. Source: Ensembl

negative regulation of cell projection organization

Inferred from electronic annotation. Source: Ensembl

neuron migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell-substrate adhesion

Inferred from electronic annotation. Source: Ensembl

positive regulation of epithelial cell migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of gene expression

Inferred from electronic annotation. Source: Ensembl

positive regulation of neuron projection development

Inferred from electronic annotation. Source: Ensembl

response to drug

Inferred from electronic annotation. Source: Ensembl

response to gonadotropin

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentalpha3-beta1 integrin complex

Inferred from electronic annotation. Source: Ensembl

basolateral plasma membrane

Inferred from electronic annotation. Source: Ensembl

cell surface

Inferred from direct assay PubMed 21310825. Source: BHF-UCL

extracellular vesicular exosome

Inferred from direct assay PubMed 19056867. Source: UniProt

growth cone

Inferred from electronic annotation. Source: Ensembl

integrin complex

Traceable author statement Ref.1. Source: ProtInc

perinuclear region of cytoplasm

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Inferred from direct assay PubMed 21310825. Source: BHF-UCL

receptor complex

Inferred from direct assay PubMed 23382219. Source: MGI

synapse

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P26006-2)

Also known as: Alpha-3A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P26006-1)

Also known as: Alpha-3B;

The sequence of this isoform differs from the canonical sequence as follows:
     1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3232 Ref.7 Ref.8
Chain33 – 10511019Integrin alpha-3
PRO_0000016238
Chain33 – 872840Integrin alpha-3 heavy chain Potential
PRO_0000016239
Chain876 – 1051176Integrin alpha-3 light chain Potential
PRO_0000016240

Regions

Topological domain33 – 991959Extracellular Potential
Transmembrane992 – 101423Helical; Potential
Topological domain1015 – 105137Cytoplasmic Potential
Repeat38 – 10366FG-GAP 1
Repeat110 – 17162FG-GAP 2
Repeat185 – 23652FG-GAP 3
Repeat237 – 29357FG-GAP 4
Repeat294 – 35461FG-GAP 5
Repeat356 – 41156FG-GAP 6
Repeat415 – 47763FG-GAP 7
Calcium binding315 – 3239 Potential
Calcium binding378 – 3869 Potential
Calcium binding439 – 4479 Potential
Region1015 – 10217Interaction with HPS5
Motif1017 – 10215GFFKR motif

Amino acid modifications

Glycosylation861N-linked (GlcNAc...) Potential
Glycosylation1071N-linked (GlcNAc...) Potential
Glycosylation2651N-linked (GlcNAc...) Potential
Glycosylation5001N-linked (GlcNAc...) Potential
Glycosylation5111N-linked (GlcNAc...) Potential
Glycosylation5731N-linked (GlcNAc...) Potential
Glycosylation6051N-linked (GlcNAc...) Potential
Glycosylation6561N-linked (GlcNAc...) Potential
Glycosylation6971N-linked (GlcNAc...) Potential
Glycosylation8411N-linked (GlcNAc...) Potential
Glycosylation8571N-linked (GlcNAc...) Potential
Glycosylation9261N-linked (GlcNAc...) Potential
Glycosylation9351N-linked (GlcNAc...) Potential
Glycosylation9691N-linked (GlcNAc...) Potential
Disulfide bond94 ↔ 103 Ref.10
Disulfide bond140 ↔ 162 Ref.10
Disulfide bond185 ↔ 197 Ref.10
Disulfide bond485 ↔ 490 By similarity
Disulfide bond496 ↔ 550 By similarity
Disulfide bond615 ↔ 621 Ref.10
Disulfide bond694 ↔ 702 Ref.10
Disulfide bond846 ↔ 904Interchain (between heavy and light chains) Ref.10
Disulfide bond911 ↔ 916 Ref.10

Natural variations

Alternative sequence1017 – 105135GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2.
VSP_002721
Natural variant2681I → F.
Corresponds to variant rs2230390 [ dbSNP | Ensembl ].
VAR_055967
Natural variant6281R → P in ILNEB. Ref.13
VAR_068808
Natural variant7191A → T.
Corresponds to variant rs2230392 [ dbSNP | Ensembl ].
VAR_055968
Natural variant8401G → S.
Corresponds to variant rs2301626 [ dbSNP | Ensembl ].
VAR_055969

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Alpha-3A) [UniParc].

Last modified September 21, 2011. Version 5.
Checksum: EEAFA7778EF17B21

FASTA1,051116,612
        10         20         30         40         50         60 
MGPGPSRAPR APRLMLCALA LMVAAGGCVV SAFNLDTRFL VVKEAGNPGS LFGYSVALHR 

        70         80         90        100        110        120 
QTERQQRYLL LAGAPRELAV PDGYTNRTGA VYLCPLTAHK DDCERMNITV KNDPGHHIIE 

       130        140        150        160        170        180 
DMWLGVTVAS QGPAGRVLVC AHRYTQVLWS GSEDQRRMVG KCYVRGNDLE LDSSDDWQTY 

       190        200        210        220        230        240 
HNEMCNSNTD YLETGMCQLG TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK EWDLSEYSYK 

       250        260        270        280        290        300 
DPEDQGNLYI GYTMQVGSFI LHPKNITIVT GAPRHRHMGA VFLLSQEAGG DLRRRQVLEG 

       310        320        330        340        350        360 
SQVGAYFGSA IALADLNNDG WQDLLVGAPY YFERKEEVGG AIYVFMNQAG TSFPAHPSLL 

       370        380        390        400        410        420 
LHGPSGSAFG LSVASIGDIN QDGFQDIAVG APFEGLGKVY IYHSSSKGLL RQPQQVIHGE 

       430        440        450        460        470        480 
KLGLPGLATF GYSLSGQMDV DENFYPDLLV GSLSDHIVLL RARPVINIVH KTLVPRPAVL 

       490        500        510        520        530        540 
DPALCTATSC VQVELCFAYN QSAGNPNYRR NITLAYTLEA DRDRRPPRLR FAGSESAVFH 

       550        560        570        580        590        600 
GFFSMPEMRC QKLELLLMDN LRDKLRPIII SMNYSLPLRM PDRPRLGLRS LDAYPILNQA 

       610        620        630        640        650        660 
QALENHTEVQ FQKECGPDNK CESNLQMRAA FVSEQQQKLS RLQYSRDVRK LLLSINVTNT 

       670        680        690        700        710        720 
RTSERSGEDA HEALLTLVVP PALLLSSVRP PGACQANETI FCELGNPFKR NQRMELLIAF 

       730        740        750        760        770        780 
EVIGVTLHTR DLQVQLQLST SSHQDNLWPM ILTLLVDYTL QTSLSMVNHR LQSFFGGTVM 

       790        800        810        820        830        840 
GESGMKTVED VGSPLKYEFQ VGPMGEGLVG LGTLVLGLEW PYEVSNGKWL LYPTEITVHG 

       850        860        870        880        890        900 
NGSWPCRPPG DLINPLNLTL SDPGDRPSSP QRRRRQLDPG GGQGPPPVTL AAAKKAKSET 

       910        920        930        940        950        960 
VLTCATGRAH CVWLECPIPD APVVTNVTVK ARVWNSTFIE DYRDFDRVRV NGWATLFLRT 

       970        980        990       1000       1010       1020 
SIPTINMENK TTWFSVDIDS ELVEELPAEI ELWLVLVAVG AGLLLLGLII LLLWKCGFFK 

      1030       1040       1050 
RARTRALYEA KRQKAEMKSQ PSETERLTDD Y 

« Hide

Isoform 2 (Alpha-3B) [UniParc].

Checksum: 18F243887966B8CE
Show »

FASTA1,066118,756

References

« Hide 'large scale' references
[1]"Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen."
Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E.
J. Cell Biol. 115:257-266(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hippocampus.
[3]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[6]"Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3."
Tsuji T., Hakomori S., Osawa T.
J. Biochem. 109:659-665(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1051 (ISOFORM 1).
Tissue: Fibroblast.
[7]"Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system."
Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y.
EMBO J. 13:2044-2055(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 33-49.
[8]"The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis."
Takada Y., Strominger J.L., Hemler M.E.
Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 33-46.
[9]"The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization."
de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A.
Lab. Invest. 76:547-563(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY.
[10]"Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains."
Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A.
Biochemistry 42:12950-12959(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: DISULFIDE BONDS.
[11]"NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
Fukushi J., Makagiansar I.T., Stallcup W.B.
Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"Integrin alpha3 mutations with kidney, lung, and skin disease."
Has C., Sparta G., Kiritsi D., Weibel L., Moeller A., Vega-Warner V., Waters A., He Y., Anikster Y., Esser P., Straub B.K., Hausser I., Bockenhauer D., Dekel B., Hildebrandt F., Bruckner-Tuderman L., Laube G.F.
N. Engl. J. Med. 366:1508-1514(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT ILNEB PRO-628.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M59911 mRNA. Translation: AAA36120.1.
AK289961 mRNA. Translation: BAF82650.1.
AC002401 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94645.1.
CH471109 Genomic DNA. Translation: EAW94646.1.
CH471109 Genomic DNA. Translation: EAW94647.1.
CH471109 Genomic DNA. Translation: EAW94648.1.
BC136636 mRNA. Translation: AAI36637.1.
BC144328 mRNA. Translation: AAI44329.1.
BC150190 mRNA. Translation: AAI50191.1.
D01038 mRNA. Translation: BAA00845.1.
PIRA40021.
RefSeqNP_002195.1. NM_002204.2.
NP_005492.1. NM_005501.2.
UniGeneHs.265829.

3D structure databases

ProteinModelPortalP26006.
SMRP26006. Positions 33-1024.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid109882. 15 interactions.
DIPDIP-140N.
IntActP26006. 3 interactions.
MINTMINT-140288.
STRING9606.ENSP00000007722.

Chemistry

BindingDBP26006.
ChEMBLCHEMBL3525.

PTM databases

PhosphoSiteP26006.

Polymorphism databases

DMDM347595830.

Proteomic databases

PaxDbP26006.
PRIDEP26006.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000007722; ENSP00000007722; ENSG00000005884. [P26006-1]
ENST00000320031; ENSP00000315190; ENSG00000005884. [P26006-2]
GeneID3675.
KEGGhsa:3675.
UCSCuc010dbl.3. human. [P26006-2]
uc010dbm.3. human. [P26006-1]

Organism-specific databases

CTD3675.
GeneCardsGC17P048133.
HGNCHGNC:6139. ITGA3.
HPACAB018594.
HPA008572.
MIM605025. gene.
614748. phenotype.
neXtProtNX_P26006.
Orphanet306504. Congenital nephrotic syndrome-interstitial lung disease-epidermolysis bullosa syndrome.
PharmGKBPA29939.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG26407.
HOGENOMHOG000015786.
HOVERGENHBG108011.
InParanoidP26006.
KOK06482.
OMAYNQSAGN.
OrthoDBEOG7K3TK7.
TreeFamTF105391.

Enzyme and pathway databases

ReactomeREACT_118779. Extracellular matrix organization.
REACT_604. Hemostasis.

Gene expression databases

ArrayExpressP26006.
BgeeP26006.
CleanExHS_ITGA3.
GenevestigatorP26006.

Family and domain databases

InterProIPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view]
PfamPF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSPR01185. INTEGRINA.
SMARTSM00191. Int_alpha. 5 hits.
[Graphical view]
PROSITEPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSITGA3. human.
GeneWikiCD49c.
GenomeRNAi3675.
NextBio14385.
PMAP-CutDBP26006.
PROP26006.
SOURCESearch...

Entry information

Entry nameITA3_HUMAN
AccessionPrimary (citable) accession number: P26006
Secondary accession number(s): A7E246 expand/collapse secondary AC list , B7ZM80, B9EGQ1, D3DTX4, D3DTX5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: September 21, 2011
Last modified: April 16, 2014
This is version 154 of the entry and version 5 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries