P26006 (ITA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Integrin alpha-3 Alternative name(s): CD49 antigen-like family member C FRP-2 Galactoprotein B3 Short name=GAPB3 VLA-3 subunit alpha CD_antigen=CD49c Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1051 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Ref.11 |
| Subunit structure | Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Ref.11 |
| Subcellular location | |
| Tissue specificity | Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is detected only on endothelial vein cells. Ref.9 |
| Post-translational modification | Isoform 1, but not isoform 2, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation. Ref.9 Ref.12 |
| Sequence similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P26006-2) Also known as: Alpha-3A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P26006-1) Also known as: Alpha-3B; The sequence of this isoform differs from the canonical sequence as follows: 1017-1051: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKRTRYYQ...TSWQTRDQYY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | Ref.7 Ref.8 | ||||||||
| Chain | 33 – 1051 | 1019 | Integrin alpha-3 | PRO_0000016238 | |||||||
| Chain | 33 – 872 | 840 | Integrin alpha-3 heavy chain Potential | PRO_0000016239 | |||||||
| Chain | 876 – 1051 | 176 | Integrin alpha-3 light chain Potential | PRO_0000016240 | |||||||
Regions | |||||||||||
| Topological domain | 33 – 991 | 959 | Extracellular Potential | ||||||||
| Transmembrane | 992 – 1014 | 23 | Helical; Potential | ||||||||
| Topological domain | 1015 – 1051 | 37 | Cytoplasmic Potential | ||||||||
| Repeat | 38 – 103 | 66 | FG-GAP 1 | ||||||||
| Repeat | 110 – 171 | 62 | FG-GAP 2 | ||||||||
| Repeat | 185 – 236 | 52 | FG-GAP 3 | ||||||||
| Repeat | 237 – 293 | 57 | FG-GAP 4 | ||||||||
| Repeat | 294 – 354 | 61 | FG-GAP 5 | ||||||||
| Repeat | 356 – 411 | 56 | FG-GAP 6 | ||||||||
| Repeat | 415 – 477 | 63 | FG-GAP 7 | ||||||||
| Calcium binding | 315 – 323 | 9 | Potential | ||||||||
| Calcium binding | 378 – 386 | 9 | Potential | ||||||||
| Calcium binding | 439 – 447 | 9 | Potential | ||||||||
| Region | 1015 – 1021 | 7 | Interaction with HPS5 | ||||||||
| Motif | 1017 – 1021 | 5 | GFFKR motif | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 1051 | 1 | Phosphotyrosine Ref.12 | ||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 107 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 265 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 500 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 511 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 573 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 605 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 656 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 697 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 841 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 857 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 926 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 935 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 969 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 94 ↔ 103 | Ref.10 | |||||||||
| Disulfide bond | 140 ↔ 162 | Ref.10 | |||||||||
| Disulfide bond | 185 ↔ 197 | Ref.10 | |||||||||
| Disulfide bond | 485 ↔ 490 | By similarity | |||||||||
| Disulfide bond | 496 ↔ 550 | By similarity | |||||||||
| Disulfide bond | 615 ↔ 621 | Ref.10 | |||||||||
| Disulfide bond | 694 ↔ 702 | Ref.10 | |||||||||
| Disulfide bond | 846 ↔ 904 | Interchain (between heavy and light chains) Ref.10 | |||||||||
| Disulfide bond | 911 ↔ 916 | Ref.10 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1017 – 1051 | 35 | GFFKR…LTDDY → DFFKRTRYYQIMPKYHAVRI REEERYPPPGSTLPTKKHWV TSWQTRDQYY in isoform 2. | VSP_002721 | |||||||
| Natural variant | 268 | 1 | I → F. Corresponds to variant rs2230390 [ dbSNP | Ensembl ]. | VAR_055967 | |||||||
| Natural variant | 719 | 1 | A → T. Corresponds to variant rs2230392 [ dbSNP | Ensembl ]. | VAR_055968 | |||||||
| Natural variant | 840 | 1 | G → S. Corresponds to variant rs2301626 [ dbSNP | Ensembl ]. | VAR_055969 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen." Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E. J. Cell Biol. 115:257-266(1991) [PubMed: 1655803] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [6] | "Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3." Tsuji T., Hakomori S., Osawa T. J. Biochem. 109:659-665(1991) [PubMed: 1714443] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1051 (ISOFORM 1). Tissue: Fibroblast. |
| [7] | "Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system." Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y. EMBO J. 13:2044-2055(1994) [PubMed: 8187758] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-49. |
| [8] | "The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis." Takada Y., Strominger J.L., Hemler M.E. Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed: 3033641] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-46. |
| [9] | "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A. Lab. Invest. 76:547-563(1997) [PubMed: 9111516] [Abstract] Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [10] | "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains." Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A. Biochemistry 42:12950-12959(2003) [PubMed: 14596610] [Abstract] Cited for: DISULFIDE BONDS. |
| [11] | "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin." Fukushi J., Makagiansar I.T., Stallcup W.B. Mol. Biol. Cell 15:3580-3590(2004) [PubMed: 15181153] [Abstract] Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION. |
| [12] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1051, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M59911 mRNA. Translation: AAA36120.1. AK289961 mRNA. Translation: BAF82650.1. AC002401 Genomic DNA. No translation available. CH471109 Genomic DNA. Translation: EAW94645.1. CH471109 Genomic DNA. Translation: EAW94646.1. CH471109 Genomic DNA. Translation: EAW94647.1. CH471109 Genomic DNA. Translation: EAW94648.1. BC136636 mRNA. Translation: AAI36637.1. BC144328 mRNA. Translation: AAI44329.1. BC150190 mRNA. Translation: AAI50191.1. D01038 mRNA. Translation: BAA00845.1. |
| IPI | IPI00215995. IPI00290043. |
| PIR | A40021. |
| RefSeq | NP_002195.1. NM_002204.2. NP_005492.1. NM_005501.2. |
| UniGene | Hs.265829. |
3D structure databases | |
| ProteinModelPortal | P26006. |
| SMR | P26006. Positions 48-464, 986-1026. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-140N. |
| IntAct | P26006. 1 interaction. |
| MINT | MINT-140288. |
| STRING | P26006. |
PTM databases | |
| PhosphoSite | P26006. |
Polymorphism databases | |
| DMDM | 262527581. |
Proteomic databases | |
| PRIDE | P26006. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000007722; ENSP00000007722; ENSG00000005884. ENST00000320031; ENSP00000315190; ENSG00000005884. |
| GeneID | 3675. |
| KEGG | hsa:3675. |
| UCSC | uc010dbl.1. human. uc010dbm.1. human. |
Organism-specific databases | |
| CTD | 3675. |
| GeneCards | GC17P048133. |
| HGNC | HGNC:6139. ITGA3. |
| MIM | 605025. gene. |
| neXtProt | NX_P26006. |
| PharmGKB | PA29939. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG06999. |
| GeneTree | ENSGT00560000076661. |
| HOGENOM | HBG403115. |
| HOVERGEN | HBG108011. |
| InParanoid | P26006. |
| OMA | FKRNQRM. |
| PhylomeDB | P26006. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | arf6_traffickingpathway. Arf6 trafficking events. il23pathway. IL23-mediated signaling events. reelinpathway. Reelin signaling pathway. |
| Reactome | REACT_111102. Signal Transduction. REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P26006. |
| Bgee | P26006. |
| CleanEx | HS_ITGA3. |
| Genevestigator | P26006. |
| GermOnline | ENSG00000005884. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013517. FG-GAP. IPR013519. Int_alpha_beta-p. IPR000413. Integrin_alpha. IPR013649. Integrin_alpha-2. IPR018184. Integrin_alpha_C_CS. [Graphical view] |
| KO | K06482. |
| Pfam | PF01839. FG-GAP. 2 hits. PF08441. Integrin_alpha2. 1 hit. [Graphical view] |
| PRINTS | PR01185. INTEGRINA. |
| SMART | SM00191. Int_alpha. 5 hits. [Graphical view] |
| PROSITE | PS51470. FG_GAP. 7 hits. PS00242. INTEGRIN_ALPHA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| PMAP-CutDB | P26006. |
| SOURCE | Search... |
Entry information
| Entry name | ITA3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P26006 Secondary accession number(s): A7E246 D3DTX5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with