Reviewed,
UniProtKB/Swiss-Prot P25799 (NFKB1_MOUSE)
Last modified
November 24, 2009.
Version 117.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Nuclear factor NF-kappa-B p105 subunit Alternative name(s): DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Cleaved into the following chain: 1- Recommended name: Nuclear factor NF-kappa-B p50 subunit | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 971 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. Plays a role in the regulation of apoptosis. Isoform 5, isoform 6 and isoform 7 act as inhibitors of transactivation of p50 NF-kappa-B subunit, probably by sequestering it in the cytoplasm. Isoform 3 (p98) (but not p84 or p105) acts as a transactivator of NF-kappa-B-regulated gene expression. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105. |
| Subunit structure | Component of the NF-kappa-B p65-p50 complex. Component of the NF-kappa-B p65-p50 complex. Homodimer; component of the NF-kappa-B p50-p50 complex. Component of the NF-kappa-B p105-p50 complex. Component of the NF-kappa-B p50-c-Rel complex. Component of a complex consisting of the NF-kappa-B p50-p50 homodimer and BCL3. Also interacts with MAP3K8. NF-kappa-B p50 subunit interacts with NCOA3 coactivator, which may coactivate NF-kappa-B dependent expression via its histone acetyltransferase activity. Interacts with DSIPI; this interaction prevents nuclear translocation and DNA-binding. Interacts with SPAG9 and UNC5CL. NFKB1/p105 interacts with CFLAR; the interaction inhibits p105 processing into p50. NFKB1/p105 forms a ternary complex with MAP3K8 and TNIP2. Interacts with GSK3B; the interaction prevents processing of p105 to p50. NFKB1/p50 interacts with NFKBIE By similarity. NFKB1/p50 interacts with NFKBIZ. Nuclear factor NF-kappa-B p50 subunit interacts with NFKBID. |
| Subcellular location | Nucleus. Cytoplasm. Note: Nuclear, but also found in the cytoplasm in an inactive form complexed to an inhibitor (I-kappa-B). Ref.2 Ref.10 Isoform 5: Cytoplasm. Isoform 6: Nucleus. Cytoplasm. Isoform 7: Nucleus. |
| Induction | By phorbol ester and TNF-alpha. |
| Domain | The C-terminus of p105 might be involved in cytoplasmic retention, inhibition of DNA-binding, and transcription activation. Glycine-rich region (GRR) appears to be a critical element in the generation of p50. |
| Post-translational modification | While translation occurs, the particular unfolded structure after the GRR repeat promotes the generation of p50 making it an acceptable substrate for the proteasome. This process is known as cotranslational processing. The processed form is active and the unprocessed form acts as an inhibitor (I kappa B-like), being able to form cytosolic complexes with NF-kappa B, trapping it in the cytoplasm. Complete folding of the region downstream of the GRR repeat precludes processing. Phosphorylation at 'Ser-930' and 'Ser-935' are required for BTRC/BTRCP-mediated proteolysis By similarity. Polyubiquitination seems to allow p105 processing. S-nitrosylation of Cys-59 affects DNA binding By similarity. |
| Sequence similarities | Contains 7 ANK repeats. Contains 1 death domain. Contains 1 RHD (Rel-like) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Hdac1 | O09106 | 1 | EBI-643958,EBI-301912 | |
| NCOA1 | Q15788 | 1 | EBI-643958,EBI-455189 | From a different organism. |
| RIPK1 | Q13546 | 1 | EBI-643958,EBI-358507 | From a different organism. |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P25799-1) Also known as: p105; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P25799-2) Also known as: p84; The sequence of this isoform differs from the canonical sequence as follows: 780-971: VFDILNGKPY...GQEGPIEGKI → GT | ||||||
| Isoform 3 (identifier: P25799-3) Also known as: p98; The sequence of this isoform differs from the canonical sequence as follows: 860-971: VSGGTIKELM...GQEGPIEGKI → MNSGIVTASVTVVWRHPSANSALQSLLLETAHCYL | ||||||
| Isoform 4 (identifier: P25799-4) The sequence of this isoform differs from the canonical sequence as follows: 353-356: DKEE → GTWV 357-971: Missing. | ||||||
| Isoform 5 (identifier: P25799-5) Also known as: P70; I-kappa-B gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-364: Missing. | ||||||
| Isoform 6 (identifier: P25799-6) Also known as: p63; I-kappa-B gamma-1; The sequence of this isoform differs from the canonical sequence as follows: 1-364: Missing. 860-971: VSGGTIKELM...GQEGPIEGKI → MNSGIVTASVTVVWRHPSANSALQSLLLETAHCYL | ||||||
| Isoform 7 (identifier: P25799-7) Also known as: p55; I-kappa-B gamma-2; The sequence of this isoform differs from the canonical sequence as follows: 1-364: Missing. 780-971: VFDILNGKPY...GQEGPIEGKI → GT | ||||||
| Note: Inhibits the activity of the p50 NF-kappa-B subunit. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 971 | 971 | Nuclear factor NF-kappa-B p105 subunit | PRO_0000030312 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 1 – 431 | 431 | Nuclear factor NF-kappa-B p50 subunit By similarity | PRO_0000030313 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 40 – 365 | 326 | RHD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 538 – 567 | 30 | ANK 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 577 – 606 | 30 | ANK 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 610 – 639 | 30 | ANK 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 646 – 675 | 30 | ANK 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 680 – 710 | 31 | ANK 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 714 – 743 | 30 | ANK 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 767 – 797 | 31 | ANK 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 801 – 888 | 88 | Death | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 370 – 392 | 23 | GRR | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 433 – 971 | 539 | Interaction with CFLAR By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 358 – 363 | 6 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 373 – 431 | 59 | Gly-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 431 – 432 | 2 | Cleavage (when cotranslationally processed) By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 59 | 1 | S-nitrosocysteine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 335 | 1 | Phosphoserine; by PKA Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 438 | 1 | N6-acetyllysine; by EP300 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 447 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 897 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 910 | 1 | Phosphoserine; by GSK3-beta; in vitro By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 930 | 1 | Phosphoserine; by IKKB By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 935 | 1 | Phosphoserine; by IKKB By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 940 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 364 | 364 | Missing in isoform 5, isoform 6 and isoform 7. | VSP_017236 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 353 – 356 | 4 | DKEE → GTWV in isoform 4. | VSP_017237 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 357 – 971 | 615 | Missing in isoform 4. | VSP_017238 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 780 – 971 | 192 | VFDIL…IEGKI → GT in isoform 2 and isoform 7. | VSP_005583 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 860 – 971 | 112 | VSGGT…IEGKI → MNSGIVTASVTVVWRHPSAN SALQSLLLETAHCYL in isoform 3 and isoform 6. | VSP_005584 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 111 | 1 | L → P in AAR00341. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 265 | 1 | E → G in BAC35117. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 530 | 1 | H → D in BAE34261. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 546 | 1 | A → G in BAE34261. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 684 | 1 | P → A in BAC84979. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 684 | 1 | P → A in AAS00547. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 684 | 1 | P → A in AAS00548. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 684 | 1 | P → A in BAE34261. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 684 | 1 | P → A in BAE43399. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 732 | 1 | A → T in BAE34261. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 950 | 1 | P → A in BAE43399. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 46 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 52 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 58 – 60 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 85 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 98 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 103 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 108 – 113 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 120 – 124 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 131 – 133 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 138 – 140 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 160 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 165 – 169 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 179 – 182 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 188 – 203 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 219 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 221 – 223 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 228 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 254 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 256 – 259 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 265 – 272 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 285 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 289 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 291 – 295 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 300 – 302 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 307 – 312 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 332 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 334 – 336 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 343 – 348 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 351 – 354 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the p50 DNA binding subunit of NF-kappa B: homology to rel and dorsal." Ghosh S., Gifford A.M., Riviere L.R., Tempst P., Nolan G.P., Baltimore D. Cell 62:1019-1029(1990) [PubMed: 2203532] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung and Spleen. |
| [2] | "I kappa B gamma, a 70 kd protein identical to the C-terminal half of p110 NF-kappa B: a new member of the I kappa B family." Inoue J., Kerr L.D., Kakizuka A., Verma I.M. Cell 68:1109-1120(1992) [PubMed: 1339305] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION. |
| [3] | "The activity of a 70 kilodalton I kappa B molecule identical to the carboxyl terminus of the p105 NF-kappa B precursor is modulated by protein kinase A." Gerondakis S., Morrice N., Richardson I.B., Wettenhall R., Fecondo J., Grumont R.J. Cell Growth Differ. 4:617-627(1993) [PubMed: 8398903] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), PARTIAL PROTEIN SEQUENCE. |
| [4] | "Alternate RNA splicing of murine nfkb1 generates a nuclear isoform of the p50 precursor NF-kappa B1 that can function as a transactivator of NF-kappa B-regulated transcription." Grumont R.J., Fecondo J., Gerondakis S. Mol. Cell. Biol. 14:8460-8470(1994) [PubMed: 7969179] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). |
| [5] | "Mus musculus transcription factor NF-kappa-B DNA binding subunit(p105) mRNA, complete cds." Ohara O., Kitamura H., Nakagawa T. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C57BL/6CrSlc. Tissue: Spleen. |
| [6] | Bleich A., Hedrich H.J., Schlegelberger B., Maehler M. Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C3H/HeJBir and C57BL/6J. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Embryo. |
| [8] | Gerhauser I., Ulrich R., Baumgartner W. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 54-129. Strain: C57BL/6. Tissue: Lung carcinoma. |
| [9] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 65-971 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 376-971 (ISOFORM 1). Strain: C57BL/6J and NOD. Tissue: Inner ear, Kidney and Spleen. |
| [10] | "Alternative splicing of RNA transcripts encoded by the murine p105 NF-kappa B gene generates I kappa B gamma isoforms with different inhibitory activities." Grumont R.J., Gerondakis S. Proc. Natl. Acad. Sci. U.S.A. 91:4367-4371(1994) [PubMed: 8183915] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 6 AND 7), SUBCELLULAR LOCATION. |
| [11] | "Cotranslational biogenesis of NF-kappaB p50 by the 26S proteasome." Lin L., DeMartino G.N., Greene W.C. Cell 92:819-828(1998) [PubMed: 9529257] [Abstract] Cited for: COTRANSLATIONAL FOLDING OF P105. |
| [12] | "A novel IkappaB protein, IkappaB-zeta, induced by proinflammatory stimuli, negatively regulates nuclear factor-kappaB in the nuclei." Yamazaki S., Muta T., Takeshige K. J. Biol. Chem. 276:27657-27662(2001) [PubMed: 11356851] [Abstract] Cited for: INTERACTION WITH NFKBIZ. |
| [13] | "Peptide-induced negative selection of thymocytes activates transcription of an NF-kappa B inhibitor." Fiorini E., Schmitz I., Marissen W.E., Osborn S.L., Touma M., Sasada T., Reche P.A., Tibaldi E.V., Hussey R.E., Kruisbeek A.M., Reinherz E.L., Clayton L.K. Mol. Cell 9:637-648(2002) [PubMed: 11931770] [Abstract] Cited for: INTERACTION WITH NFKBID. |
| [14] | "A defect in nucleosome remodeling prevents IL-12(p35) gene transcription in neonatal dendritic cells." Goriely S., Van Lint C., Dadkhah R., Libin M., De Wit D., Demonte D., Willems F., Goldman M. J. Exp. Med. 199:1011-1016(2004) [PubMed: 15051764] [Abstract] Cited for: IDENTIFICATION IN THE NF-KAPPA-B P65-P50 COMPLEX. |
| [15] | "Regulation of Toll/IL-1-receptor-mediated gene expression by the inducible nuclear protein IkappaBzeta." Yamamoto M., Yamazaki S., Uematsu S., Sato S., Hemmi H., Hoshino K., Kaisho T., Kuwata H., Takeuchi O., Takeshige K., Saitoh T., Yamaoka S., Yamamoto N., Yamamoto S., Muta T., Takeda K., Akira S. Nature 430:218-222(2004) [PubMed: 15241416] [Abstract] Cited for: INTERACTION WITH NFKBIZ. |
| [16] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed: 18973353] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-447, MASS SPECTROMETRY. |
| [17] | "Structure of NF-kappa B p50 homodimer bound to a kappa B site." Ghosh G., van Duyne G., Ghosh S., Sigler P.B. Nature 373:303-310(1995) [PubMed: 7530332] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 39-364. |
| [18] | "The role of DNA in the mechanism of NFkappaB dimer formation: crystal structures of the dimerization domains of the p50 and p65 subunits." Huang D.B., Huxford T., Chen Y.Q., Ghosh G. Structure 5:1427-1436(1997) [PubMed: 9384558] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 245-350. |
| [19] | "The crystal structure of the IkappaBalpha/NF-kappaB complex reveals mechanisms of NF-kappaB inactivation." Huxford T., Huang D.B., Malek S., Ghosh G. Cell 95:759-770(1998) [PubMed: 9865694] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 245-363. |
| [20] | "Crystal structure of p50/p65 heterodimer of transcription factor NF-kappaB bound to DNA." Chen F.E., Huang D.B., Chen Y.Q., Ghosh G. Nature 391:410-413(1998) [PubMed: 9450761] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 39-350. |
| [21] | "The X-ray crystal structure of the NF-kappa B p50.p65 heterodimer bound to the interferon beta -kappa B site." Berkowitz B., Huang D.B., Chen-Park F.E., Sigler P.B., Ghosh G. J. Biol. Chem. 277:24694-24700(2002) [PubMed: 11970948] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.75 ANGSTROMS) OF 39-350. |
| [22] | "The kappa B DNA sequence from the HIV long terminal repeat functions as an allosteric regulator of HIV transcription." Chen-Park F.E., Huang D.B., Noro B., Thanos D., Ghosh G. J. Biol. Chem. 277:24701-24708(2002) [PubMed: 11970949] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 39-350. |
| [23] | "Crystal structure of NF-kappaB (p50)2 complexed to a high-affinity RNA aptamer." Huang D.B., Vu D., Cassiday L.A., Zimmerman J.M., Maher L.J. III, Ghosh G. Proc. Natl. Acad. Sci. U.S.A. 100:9268-9273(2003) [PubMed: 12886018] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 38-351 HOMODIMER COMPLEXED WITH RNA APTAMER. |
| [24] | "X-ray structure of a NF-kappaB p50/RelB/DNA complex reveals assembly of multiple dimers on tandem kappaB sites." Moorthy A.K., Huang D.B., Wang V.Y., Vu D., Ghosh G. J. Mol. Biol. 373:723-734(2007) [PubMed: 17869269] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.05 ANGSTROMS) OF 91-378 IN COMPLEX WITH RELB. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M57999 mRNA. Translation: AAA40415.1. S89033 mRNA. Translation: AAB21851.1. S66656 mRNA. Translation: AAB28573.1. AB119195 mRNA. Translation: BAC84979.1. AY521462 mRNA. Translation: AAS00547.1. AY521463 mRNA. Translation: AAS00548.1. BC050841 mRNA. Translation: AAH50841.1. AY423849 mRNA. Translation: AAR00341.1. AK052726 mRNA. Translation: BAC35117.1. Different initiation. AK089660 mRNA. Translation: BAE43399.1. AK157915 mRNA. Translation: BAE34261.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00113873. IPI00221649. IPI00221651. IPI00719865. IPI00719890. IPI00742428. IPI00742440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A35697. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_032715.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Mm.256765 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P25799. Positions 802-885. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP:85N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P25799. 8 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSMUST00000029812; ENSMUSP00000029812; ENSMUSG00000028163; Mus musculus. [Genome view] ENSMUST00000106275; ENSMUSP00000101882; ENSMUSG00000028163; Mus musculus. [Genome view] ENSMUST00000106276; ENSMUSP00000101883; ENSMUSG00000028163; Mus musculus. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 18033. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | mmu:18033. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc008rlw.1. mouse. uc008rlx.1. mouse. uc008rly.1. mouse. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 18033. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MGI | MGI:97312. Nfkb1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P25799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000488. Death. IPR011029. DEATH-like. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR000451. NF_Rel_dor. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. G3DSA:1.10.533.10. DEATH_like. 1 hit. G3DSA:2.60.40.10. Ig-like_fold. 1 hit. G3DSA:2.60.40.340. RHD. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00023. Ank. 6 hits. PF00531. Death. 1 hit. PF00554. RHD. 1 hit. PF01833. TIG. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00057. NFKBTNSCPFCT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00248. ANK. 6 hits. SM00005. DEATH. 1 hit. SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 5 hits. PS50017. DEATH_DOMAIN. False negative. PS01204. REL_1. 1 hit. PS50254. REL_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 293121. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NFKB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P25799 Secondary accession number(s): Q3TZE8 Q8C712 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


