Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P25791

- RBTN2_HUMAN

UniProt

P25791 - RBTN2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rhombotin-2

Gene

LMO2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.

GO - Molecular functioni

  1. bHLH transcription factor binding Source: BHF-UCL
  2. chromatin binding Source: Ensembl
  3. cofactor binding Source: BHF-UCL
  4. E-box binding Source: BHF-UCL
  5. RNA polymerase II activating transcription factor binding Source: BHF-UCL
  6. RNA polymerase II regulatory region sequence-specific DNA binding Source: BHF-UCL
  7. RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
  8. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
  9. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: BHF-UCL
  10. zinc ion binding Source: InterPro

GO - Biological processi

  1. cellular response to thyroid hormone stimulus Source: UniProtKB
  2. embryonic hemopoiesis Source: Ensembl
  3. mRNA transcription from RNA polymerase II promoter Source: BHF-UCL
  4. multicellular organismal development Source: ProtInc
  5. negative regulation of erythrocyte differentiation Source: Ensembl
  6. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Rhombotin-2
Alternative name(s):
Cysteine-rich protein TTG-2
LIM domain only protein 2
Short name:
LMO-2
T-cell translocation protein 2
Gene namesi
Name:LMO2
Synonyms:RBTN2, RBTNL1, RHOM2, TTG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:6642. LMO2.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
  2. transcription factor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA30408.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 158158Rhombotin-2PRO_0000075896Add
BLAST

Proteomic databases

MaxQBiP25791.
PaxDbiP25791.
PRIDEiP25791.

PTM databases

PhosphoSiteiP25791.

Expressioni

Gene expression databases

BgeeiP25791.
CleanExiHS_LMO2.
GenevestigatoriP25791.

Organism-specific databases

HPAiCAB016258.

Interactioni

Subunit structurei

Interacts via its LIM domains with ELF2 and LDB1. Also interacts with basic helix-loop-helix protein TAL1/SCL and can assemble in a complex with LMO2 and TAL1/SCL By similarity. Interacts with BEX2 and KDM5A.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
RELAQ042063EBI-739696,EBI-73886

Protein-protein interaction databases

BioGridi110191. 35 interactions.
IntActiP25791. 26 interactions.
MINTiMINT-233526.
STRINGi9606.ENSP00000257818.

Structurei

Secondary structure

1
158
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni25 – 273
Turni31 – 333
Beta strandi39 – 457
Beta strandi48 – 514
Turni52 – 543
Turni58 – 603
Turni64 – 663
Beta strandi71 – 744
Beta strandi77 – 793
Helixi81 – 888
Turni95 – 973
Beta strandi105 – 1106
Beta strandi113 – 1164
Helixi117 – 1193
Turni123 – 1253
Beta strandi134 – 1385
Beta strandi141 – 1444
Helixi145 – 1473
Helixi148 – 1558

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2XJYX-ray2.40A26-156[»]
2XJZX-ray2.80A/B/C/D/E26-156[»]
2YPAX-ray2.80C25-156[»]
4KFZX-ray2.80A/B9-158[»]
ProteinModelPortaliP25791.
SMRiP25791. Positions 9-156.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP25791.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini30 – 8960LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini94 – 15360LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST

Domaini

The second LIM zinc-binding domain interacts with KDM5A.

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG319108.
GeneTreeiENSGT00720000108603.
HOGENOMiHOG000232175.
HOVERGENiHBG054231.
InParanoidiP25791.
KOiK15612.
OMAiEMTMRVR.
PhylomeDBiP25791.
TreeFamiTF351071.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P25791-1) [UniParc]FASTAAdd to Basket

Also known as: LMO2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSAIERKSL DPSEEPVDEV LQIPPSLLTC GGCQQNIGDR YFLKAIDQYW
60 70 80 90 100
HEDCLSCDLC GCRLGEVGRR LYYKLGRKLC RRDYLRLFGQ DGLCASCDKR
110 120 130 140 150
IRAYEMTMRV KDKVYHLECF KCAACQKHFC VGDRYLLINS DIVCEQDIYE

WTKINGMI
Length:158
Mass (Da):18,358
Last modified:May 1, 1992 - v1
Checksum:i1B4FF02505528C93
GO
Isoform 3 (identifier: P25791-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPM

Show »
Length:227
Mass (Da):25,036
Checksum:iF80DBD6392880361
GO
Isoform 2 (identifier: P25791-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: E → SLKGSQVRCPVWPKTISDPRCWSHSGEAVPDAWPSLQGTSG
     16-158: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:55
Mass (Da):5,941
Checksum:i0576C718F35DABF3
GO

Sequence cautioni

The sequence AAF98804.1 differs from that shown. Reason: Intron retention.
The sequence CAA43430.1 differs from that shown. Reason: Frameshift at several positions.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEGSAVTVLERGGASSPAER RSKRRRRSGGDGGGGGGARA PEGVRAPAAGQPRATKGAPP PPGTPPPSPM in isoform 3. 1 PublicationVSP_038961
Alternative sequencei15 – 151E → SLKGSQVRCPVWPKTISDPR CWSHSGEAVPDAWPSLQGTS G in isoform 2. 1 PublicationVSP_038962
Alternative sequencei16 – 158143Missing in isoform 2. 1 PublicationVSP_038963Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X61118 mRNA. Translation: CAA43430.1. Frameshift.
BC034041 mRNA. Translation: AAH34041.1.
BC035607 mRNA. Translation: AAH35607.1.
BC042426 mRNA. Translation: AAH42426.1.
BC073973 mRNA. Translation: AAH73973.1. Sequence problems.
AF257211 mRNA. Translation: AAF98804.1. Sequence problems.
CCDSiCCDS44567.1. [P25791-1]
CCDS7888.2. [P25791-3]
PIRiS29477.
RefSeqiNP_001135787.1. NM_001142315.1. [P25791-1]
NP_001135788.1. NM_001142316.1. [P25791-1]
NP_005565.2. NM_005574.3. [P25791-3]
XP_005252978.1. XM_005252921.1. [P25791-1]
XP_006718292.1. XM_006718229.1. [P25791-1]
UniGeneiHs.34560.

Genome annotation databases

EnsembliENST00000257818; ENSP00000257818; ENSG00000135363. [P25791-3]
ENST00000395833; ENSP00000379175; ENSG00000135363. [P25791-1]
ENST00000411482; ENSP00000401967; ENSG00000135363. [P25791-4]
GeneIDi4005.
KEGGihsa:4005.
UCSCiuc001mvc.3. human. [P25791-1]
uc010rem.2. human. [P25791-3]

Polymorphism databases

DMDMi132533.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X61118 mRNA. Translation: CAA43430.1 . Frameshift.
BC034041 mRNA. Translation: AAH34041.1 .
BC035607 mRNA. Translation: AAH35607.1 .
BC042426 mRNA. Translation: AAH42426.1 .
BC073973 mRNA. Translation: AAH73973.1 . Sequence problems.
AF257211 mRNA. Translation: AAF98804.1 . Sequence problems.
CCDSi CCDS44567.1. [P25791-1 ]
CCDS7888.2. [P25791-3 ]
PIRi S29477.
RefSeqi NP_001135787.1. NM_001142315.1. [P25791-1 ]
NP_001135788.1. NM_001142316.1. [P25791-1 ]
NP_005565.2. NM_005574.3. [P25791-3 ]
XP_005252978.1. XM_005252921.1. [P25791-1 ]
XP_006718292.1. XM_006718229.1. [P25791-1 ]
UniGenei Hs.34560.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2XJY X-ray 2.40 A 26-156 [» ]
2XJZ X-ray 2.80 A/B/C/D/E 26-156 [» ]
2YPA X-ray 2.80 C 25-156 [» ]
4KFZ X-ray 2.80 A/B 9-158 [» ]
ProteinModelPortali P25791.
SMRi P25791. Positions 9-156.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110191. 35 interactions.
IntActi P25791. 26 interactions.
MINTi MINT-233526.
STRINGi 9606.ENSP00000257818.

PTM databases

PhosphoSitei P25791.

Polymorphism databases

DMDMi 132533.

Proteomic databases

MaxQBi P25791.
PaxDbi P25791.
PRIDEi P25791.

Protocols and materials databases

DNASUi 4005.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000257818 ; ENSP00000257818 ; ENSG00000135363 . [P25791-3 ]
ENST00000395833 ; ENSP00000379175 ; ENSG00000135363 . [P25791-1 ]
ENST00000411482 ; ENSP00000401967 ; ENSG00000135363 . [P25791-4 ]
GeneIDi 4005.
KEGGi hsa:4005.
UCSCi uc001mvc.3. human. [P25791-1 ]
uc010rem.2. human. [P25791-3 ]

Organism-specific databases

CTDi 4005.
GeneCardsi GC11M033880.
H-InvDB HIX0009544.
HGNCi HGNC:6642. LMO2.
HPAi CAB016258.
MIMi 180385. gene.
neXtProti NX_P25791.
PharmGKBi PA30408.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG319108.
GeneTreei ENSGT00720000108603.
HOGENOMi HOG000232175.
HOVERGENi HBG054231.
InParanoidi P25791.
KOi K15612.
OMAi EMTMRVR.
PhylomeDBi P25791.
TreeFami TF351071.

Miscellaneous databases

ChiTaRSi LMO2. human.
EvolutionaryTracei P25791.
GeneWikii LMO2.
GenomeRNAii 4005.
NextBioi 15712.
PROi P25791.
SOURCEi Search...

Gene expression databases

Bgeei P25791.
CleanExi HS_LMO2.
Genevestigatori P25791.

Family and domain databases

Gene3Di 2.10.110.10. 2 hits.
InterProi IPR001781. Znf_LIM.
[Graphical view ]
Pfami PF00412. LIM. 2 hits.
[Graphical view ]
SMARTi SM00132. LIM. 2 hits.
[Graphical view ]
PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TTG-2, a new gene encoding a cysteine-rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with the t(11;14)(p13;q11)."
    Royer-Pokora B., Loos L., Ludwig W.D.
    Oncogene 6:1887-1893(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INVOLVEMENT IN T-CELL ACUTE LYMPHOBLASTIC LEUKEMIA.
    Tissue: Kidney.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Colon.
  3. "New 5'-end of LMO2 (TTG-2/RBTN2)."
    Zhu T.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-158 (ISOFORM 1).
    Tissue: Kidney.
  4. "T-cell oncogene rhombotin-2 interacts with retinoblastoma-binding protein 2."
    Mao S., Neale G.A.M., Goorha R.M.
    Oncogene 14:1531-1539(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KDM5A.
  5. "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex."
    Han C., Liu H., Liu J., Yin K., Xie Y., Shen X., Wang Y., Yuan J., Qiang B., Liu Y.-J., Peng X.
    Nucleic Acids Res. 33:6555-6565(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BEX2.

Entry informationi

Entry nameiRBTN2_HUMAN
AccessioniPrimary (citable) accession number: P25791
Secondary accession number(s): Q9HD58
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: May 1, 1992
Last modified: October 29, 2014
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3