Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P25791

- RBTN2_HUMAN

UniProt

P25791 - RBTN2_HUMAN

Protein

Rhombotin-2

Gene

LMO2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.

    GO - Molecular functioni

    1. bHLH transcription factor binding Source: BHF-UCL
    2. chromatin binding Source: Ensembl
    3. cofactor binding Source: BHF-UCL
    4. E-box binding Source: BHF-UCL
    5. protein binding Source: IntAct
    6. RNA polymerase II activating transcription factor binding Source: BHF-UCL
    7. RNA polymerase II regulatory region sequence-specific DNA binding Source: BHF-UCL
    8. RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
    9. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
    10. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: BHF-UCL
    11. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cellular response to thyroid hormone stimulus Source: UniProtKB
    2. embryonic hemopoiesis Source: Ensembl
    3. mRNA transcription from RNA polymerase II promoter Source: BHF-UCL
    4. multicellular organismal development Source: ProtInc
    5. negative regulation of erythrocyte differentiation Source: Ensembl
    6. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rhombotin-2
    Alternative name(s):
    Cysteine-rich protein TTG-2
    LIM domain only protein 2
    Short name:
    LMO-2
    T-cell translocation protein 2
    Gene namesi
    Name:LMO2
    Synonyms:RBTN2, RBTNL1, RHOM2, TTG2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:6642. LMO2.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell
    2. transcription factor complex Source: BHF-UCL

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    PharmGKBiPA30408.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 158158Rhombotin-2PRO_0000075896Add
    BLAST

    Proteomic databases

    MaxQBiP25791.
    PaxDbiP25791.
    PRIDEiP25791.

    PTM databases

    PhosphoSiteiP25791.

    Expressioni

    Gene expression databases

    BgeeiP25791.
    CleanExiHS_LMO2.
    GenevestigatoriP25791.

    Organism-specific databases

    HPAiCAB016258.

    Interactioni

    Subunit structurei

    Interacts via its LIM domains with ELF2 and LDB1. Also interacts with basic helix-loop-helix protein TAL1/SCL and can assemble in a complex with LMO2 and TAL1/SCL By similarity. Interacts with BEX2 and KDM5A.By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    RELAQ042063EBI-739696,EBI-73886

    Protein-protein interaction databases

    BioGridi110191. 35 interactions.
    IntActiP25791. 26 interactions.
    MINTiMINT-233526.
    STRINGi9606.ENSP00000257818.

    Structurei

    Secondary structure

    1
    158
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni25 – 273
    Turni31 – 333
    Beta strandi39 – 457
    Beta strandi48 – 514
    Turni52 – 543
    Turni58 – 603
    Turni64 – 663
    Beta strandi71 – 744
    Beta strandi77 – 793
    Helixi81 – 888
    Turni95 – 973
    Beta strandi105 – 1106
    Beta strandi113 – 1164
    Helixi117 – 1193
    Turni123 – 1253
    Beta strandi134 – 1385
    Beta strandi141 – 1444
    Helixi145 – 1473
    Helixi148 – 1558

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2XJYX-ray2.40A26-156[»]
    2XJZX-ray2.80A/B/C/D/E26-156[»]
    2YPAX-ray2.80C25-156[»]
    4KFZX-ray2.80A/B9-158[»]
    ProteinModelPortaliP25791.
    SMRiP25791. Positions 9-156.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP25791.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini30 – 8960LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini94 – 15360LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The second LIM zinc-binding domain interacts with KDM5A.

    Sequence similaritiesi

    Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG319108.
    HOGENOMiHOG000232175.
    HOVERGENiHBG054231.
    InParanoidiP25791.
    KOiK15612.
    OMAiEMTMRVR.
    PhylomeDBiP25791.
    TreeFamiTF351071.

    Family and domain databases

    Gene3Di2.10.110.10. 2 hits.
    InterProiIPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 2 hits.
    [Graphical view]
    SMARTiSM00132. LIM. 2 hits.
    [Graphical view]
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P25791-1) [UniParc]FASTAAdd to Basket

    Also known as: LMO2a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSAIERKSL DPSEEPVDEV LQIPPSLLTC GGCQQNIGDR YFLKAIDQYW    50
    HEDCLSCDLC GCRLGEVGRR LYYKLGRKLC RRDYLRLFGQ DGLCASCDKR 100
    IRAYEMTMRV KDKVYHLECF KCAACQKHFC VGDRYLLINS DIVCEQDIYE 150
    WTKINGMI 158
    Length:158
    Mass (Da):18,358
    Last modified:May 1, 1992 - v1
    Checksum:i1B4FF02505528C93
    GO
    Isoform 3 (identifier: P25791-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPM

    Show »
    Length:227
    Mass (Da):25,036
    Checksum:iF80DBD6392880361
    GO
    Isoform 2 (identifier: P25791-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         15-15: E → SLKGSQVRCPVWPKTISDPRCWSHSGEAVPDAWPSLQGTSG
         16-158: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:55
    Mass (Da):5,941
    Checksum:i0576C718F35DABF3
    GO

    Sequence cautioni

    The sequence AAF98804.1 differs from that shown. Reason: Intron retention.
    The sequence CAA43430.1 differs from that shown. Reason: Frameshift at several positions.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MEGSAVTVLERGGASSPAER RSKRRRRSGGDGGGGGGARA PEGVRAPAAGQPRATKGAPP PPGTPPPSPM in isoform 3. 1 PublicationVSP_038961
    Alternative sequencei15 – 151E → SLKGSQVRCPVWPKTISDPR CWSHSGEAVPDAWPSLQGTS G in isoform 2. 1 PublicationVSP_038962
    Alternative sequencei16 – 158143Missing in isoform 2. 1 PublicationVSP_038963Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X61118 mRNA. Translation: CAA43430.1. Frameshift.
    BC034041 mRNA. Translation: AAH34041.1.
    BC035607 mRNA. Translation: AAH35607.1.
    BC042426 mRNA. Translation: AAH42426.1.
    BC073973 mRNA. Translation: AAH73973.1. Sequence problems.
    AF257211 mRNA. Translation: AAF98804.1. Sequence problems.
    CCDSiCCDS44567.1. [P25791-1]
    CCDS7888.2. [P25791-3]
    PIRiS29477.
    RefSeqiNP_001135787.1. NM_001142315.1. [P25791-1]
    NP_001135788.1. NM_001142316.1. [P25791-1]
    NP_005565.2. NM_005574.3. [P25791-3]
    XP_005252978.1. XM_005252921.1. [P25791-1]
    XP_006718292.1. XM_006718229.1. [P25791-1]
    UniGeneiHs.34560.

    Genome annotation databases

    EnsembliENST00000257818; ENSP00000257818; ENSG00000135363. [P25791-3]
    ENST00000395833; ENSP00000379175; ENSG00000135363. [P25791-1]
    ENST00000411482; ENSP00000401967; ENSG00000135363. [P25791-4]
    GeneIDi4005.
    KEGGihsa:4005.
    UCSCiuc001mvc.3. human. [P25791-1]
    uc010rem.2. human. [P25791-3]

    Polymorphism databases

    DMDMi132533.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X61118 mRNA. Translation: CAA43430.1 . Frameshift.
    BC034041 mRNA. Translation: AAH34041.1 .
    BC035607 mRNA. Translation: AAH35607.1 .
    BC042426 mRNA. Translation: AAH42426.1 .
    BC073973 mRNA. Translation: AAH73973.1 . Sequence problems.
    AF257211 mRNA. Translation: AAF98804.1 . Sequence problems.
    CCDSi CCDS44567.1. [P25791-1 ]
    CCDS7888.2. [P25791-3 ]
    PIRi S29477.
    RefSeqi NP_001135787.1. NM_001142315.1. [P25791-1 ]
    NP_001135788.1. NM_001142316.1. [P25791-1 ]
    NP_005565.2. NM_005574.3. [P25791-3 ]
    XP_005252978.1. XM_005252921.1. [P25791-1 ]
    XP_006718292.1. XM_006718229.1. [P25791-1 ]
    UniGenei Hs.34560.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2XJY X-ray 2.40 A 26-156 [» ]
    2XJZ X-ray 2.80 A/B/C/D/E 26-156 [» ]
    2YPA X-ray 2.80 C 25-156 [» ]
    4KFZ X-ray 2.80 A/B 9-158 [» ]
    ProteinModelPortali P25791.
    SMRi P25791. Positions 9-156.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110191. 35 interactions.
    IntActi P25791. 26 interactions.
    MINTi MINT-233526.
    STRINGi 9606.ENSP00000257818.

    PTM databases

    PhosphoSitei P25791.

    Polymorphism databases

    DMDMi 132533.

    Proteomic databases

    MaxQBi P25791.
    PaxDbi P25791.
    PRIDEi P25791.

    Protocols and materials databases

    DNASUi 4005.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000257818 ; ENSP00000257818 ; ENSG00000135363 . [P25791-3 ]
    ENST00000395833 ; ENSP00000379175 ; ENSG00000135363 . [P25791-1 ]
    ENST00000411482 ; ENSP00000401967 ; ENSG00000135363 . [P25791-4 ]
    GeneIDi 4005.
    KEGGi hsa:4005.
    UCSCi uc001mvc.3. human. [P25791-1 ]
    uc010rem.2. human. [P25791-3 ]

    Organism-specific databases

    CTDi 4005.
    GeneCardsi GC11M033880.
    H-InvDB HIX0009544.
    HGNCi HGNC:6642. LMO2.
    HPAi CAB016258.
    MIMi 180385. gene.
    neXtProti NX_P25791.
    PharmGKBi PA30408.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG319108.
    HOGENOMi HOG000232175.
    HOVERGENi HBG054231.
    InParanoidi P25791.
    KOi K15612.
    OMAi EMTMRVR.
    PhylomeDBi P25791.
    TreeFami TF351071.

    Miscellaneous databases

    ChiTaRSi LMO2. human.
    EvolutionaryTracei P25791.
    GeneWikii LMO2.
    GenomeRNAii 4005.
    NextBioi 15712.
    PROi P25791.
    SOURCEi Search...

    Gene expression databases

    Bgeei P25791.
    CleanExi HS_LMO2.
    Genevestigatori P25791.

    Family and domain databases

    Gene3Di 2.10.110.10. 2 hits.
    InterProi IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 2 hits.
    [Graphical view ]
    SMARTi SM00132. LIM. 2 hits.
    [Graphical view ]
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "TTG-2, a new gene encoding a cysteine-rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with the t(11;14)(p13;q11)."
      Royer-Pokora B., Loos L., Ludwig W.D.
      Oncogene 6:1887-1893(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INVOLVEMENT IN T-CELL ACUTE LYMPHOBLASTIC LEUKEMIA.
      Tissue: Kidney.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Colon.
    3. "New 5'-end of LMO2 (TTG-2/RBTN2)."
      Zhu T.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-158 (ISOFORM 1).
      Tissue: Kidney.
    4. "T-cell oncogene rhombotin-2 interacts with retinoblastoma-binding protein 2."
      Mao S., Neale G.A.M., Goorha R.M.
      Oncogene 14:1531-1539(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KDM5A.
    5. "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex."
      Han C., Liu H., Liu J., Yin K., Xie Y., Shen X., Wang Y., Yuan J., Qiang B., Liu Y.-J., Peng X.
      Nucleic Acids Res. 33:6555-6565(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH BEX2.

    Entry informationi

    Entry nameiRBTN2_HUMAN
    AccessioniPrimary (citable) accession number: P25791
    Secondary accession number(s): Q9HD58
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 1992
    Last sequence update: May 1, 1992
    Last modified: October 1, 2014
    This is version 143 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3