P25791 (RBTN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rhombotin-2 Alternative name(s): Cysteine-rich protein TTG-2 LIM domain only protein 2 Short name=LMO-2 T-cell translocation protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. |
| Subunit structure | Interacts via its LIM domains with ELF2 and LDB1. Also interacts with basic helix-loop-helix protein TAL1/SCL and can assemble in a complex with LMO2 and TAL1/SCL By similarity. Interacts with BEX2 and KDM5A. Ref.4 Ref.5 |
| Subcellular location | Nucleus Potential. |
| Domain | The second LIM zinc-binding domain interacts with KDM5A. |
| Involvement in disease | A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD. |
| Sequence similarities | Contains 2 LIM zinc-binding domains. |
| Sequence caution | The sequence AAF98804.1 differs from that shown. Reason: Intron retention. The sequence AAH73973.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence CAA43430.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| RELA | Q04206 | 3 | EBI-739696,EBI-73886 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P25791-1) Also known as: LMO2a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3 (identifier: P25791-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPM | ||||||
| Isoform 2 (identifier: P25791-4) The sequence of this isoform differs from the canonical sequence as follows: 15-15: E → SLKGSQVRCPVWPKTISDPRCWSHSGEAVPDAWPSLQGTSG 16-158: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 158 | 158 | Rhombotin-2 | PRO_0000075896 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 30 – 89 | 60 | LIM zinc-binding 1 | ||||||||||||||||||||||||||||||||||||||
| Domain | 94 – 153 | 60 | LIM zinc-binding 2 | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MEGSAVTVLERGGASSPAER RSKRRRRSGGDGGGGGGARA PEGVRAPAAGQPRATKGAPP PPGTPPPSPM in isoform 3. | VSP_038961 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 15 | 1 | E → SLKGSQVRCPVWPKTISDPR CWSHSGEAVPDAWPSLQGTS G in isoform 2. | VSP_038962 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 16 – 158 | 143 | Missing in isoform 2. | VSP_038963 | |||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Turn | 31 – 33 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 39 – 45 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 51 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 52 – 54 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 58 – 60 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 64 – 66 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 71 – 74 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 77 – 79 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 81 – 88 | 8 | |||||||||||||||||||||||||||||||||||||||
| Turn | 95 – 97 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 105 – 110 | 6 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 116 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 117 – 119 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 123 – 125 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 138 | 5 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 144 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 145 – 147 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 155 | 8 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TTG-2, a new gene encoding a cysteine-rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with the t(11;14)(p13;q11)." Royer-Pokora B., Loos L., Ludwig W.D. Oncogene 6:1887-1893(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INVOLVEMENT IN T-CELL ACUTE LYMPHOBLASTIC LEUKEMIA. Tissue: Kidney. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Colon. |
| [3] | "New 5'-end of LMO2 (TTG-2/RBTN2)." Zhu T. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-158 (ISOFORM 1). Tissue: Kidney. |
| [4] | "T-cell oncogene rhombotin-2 interacts with retinoblastoma-binding protein 2." Mao S., Neale G.A.M., Goorha R.M. Oncogene 14:1531-1539(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KDM5A. |
| [5] | "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex." Han C., Liu H., Liu J., Yin K., Xie Y., Shen X., Wang Y., Yuan J., Qiang B., Liu Y.-J., Peng X. Nucleic Acids Res. 33:6555-6565(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BEX2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X61118 mRNA. Translation: CAA43430.1. Frameshift. BC034041 mRNA. Translation: AAH34041.1. BC035607 mRNA. Translation: AAH35607.1. BC042426 mRNA. Translation: AAH42426.1. BC073973 mRNA. Translation: AAH73973.1. Sequence problems. AF257211 mRNA. Translation: AAF98804.1. Sequence problems. | ||||||||||||||||||
| IPI | IPI00016852. IPI00915342. IPI00926017. | ||||||||||||||||||
| PIR | S29477. | ||||||||||||||||||
| RefSeq | NP_001135787.1. NM_001142315.1. NP_001135788.1. NM_001142316.1. NP_005565.2. NM_005574.3. | ||||||||||||||||||
| UniGene | Hs.34560. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P25791. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P25791. 23 interactions. | ||||||||||||||||||
| MINT | MINT-233526. | ||||||||||||||||||
| STRING | 9606.ENSP00000257818. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P25791. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 132533. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P25791. | ||||||||||||||||||
| PRIDE | P25791. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 4005. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000257818; ENSP00000257818; ENSG00000135363. ENST00000395833; ENSP00000379175; ENSG00000135363. ENST00000411482; ENSP00000401967; ENSG00000135363. | ||||||||||||||||||
| GeneID | 4005. | ||||||||||||||||||
| KEGG | hsa:4005. | ||||||||||||||||||
| UCSC | uc001mvc.3. human. uc010rem.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 4005. | ||||||||||||||||||
| GeneCards | GC11M033880. | ||||||||||||||||||
| H-InvDB | HIX0009544. | ||||||||||||||||||
| HGNC | HGNC:6642. LMO2. | ||||||||||||||||||
| HPA | CAB016258. | ||||||||||||||||||
| MIM | 180385. gene. | ||||||||||||||||||
| neXtProt | NX_P25791. | ||||||||||||||||||
| PharmGKB | PA30408. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG319108. | ||||||||||||||||||
| HOGENOM | HOG000232175. | ||||||||||||||||||
| HOVERGEN | HBG054231. | ||||||||||||||||||
| InParanoid | P25791. | ||||||||||||||||||
| KO | K15612. | ||||||||||||||||||
| OMA | CEKRIRA. | ||||||||||||||||||
| OrthoDB | EOG4001KG. | ||||||||||||||||||
| PhylomeDB | P25791. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | P25791. | ||||||||||||||||||
| CleanEx | HS_LMO2. | ||||||||||||||||||
| Genevestigator | P25791. | ||||||||||||||||||
| GermOnline | ENSG00000135363. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 2.10.110.10. 2 hits. | ||||||||||||||||||
| InterPro | IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||
| Pfam | PF00412. LIM. 2 hits. [Graphical view] | ||||||||||||||||||
| SMART | SM00132. LIM. 2 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | LMO2. human. | ||||||||||||||||||
| EvolutionaryTrace | P25791. | ||||||||||||||||||
| GenomeRNAi | 4005. | ||||||||||||||||||
| NextBio | 15712. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RBTN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P25791 Secondary accession number(s): Q9HD58 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
