Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bromodomain-containing protein 2

Gene

BRD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.By similarity1 Publication

GO - Molecular functioni

  • chromatin binding Source: UniProtKB
  • lysine-acetylated histone binding Source: UniProtKB

GO - Biological processi

  • chromatin modification Source: UniProtKB-KW
  • nucleosome assembly Source: UniProtKB
  • regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • spermatogenesis Source: ProtInc
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112526-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Bromodomain-containing protein 2
Alternative name(s):
O27.1.1
Really interesting new gene 3 protein
Gene namesi
Name:BRD2
Synonyms:KIAA9001, RING3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:1103. BRD2.

Subcellular locationi

  • Nucleus Curated

  • Note: Detected on chromatin and nucleosomes.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi78Q → A: Loss of homodimerization. 1 Publication1
Mutagenesisi142 – 143MQ → AA: Loss of homodimerization. 1 Publication2
Mutagenesisi153Y → K: Loss of homodimerization. 1 Publication1
Mutagenesisi154I → A: Partial loss of homodimerization; when associated with A-182. 1 Publication1
Mutagenesisi170E → A: Loss of homodimerization. 1 Publication1
Mutagenesisi174L → E: Loss of homodimerization. 1 Publication1
Mutagenesisi177V → E: Loss of homodimerization. 1 Publication1
Mutagenesisi182Q → A: Partial loss of homodimerization; when associated with A-154. 1 Publication1

Organism-specific databases

DisGeNETi6046.
OpenTargetsiENSG00000204256.
ENSG00000215077.
ENSG00000234507.
ENSG00000235307.
PharmGKBiPA25414.

Chemistry databases

ChEMBLiCHEMBL1293289.
GuidetoPHARMACOLOGYi1944.

Polymorphism and mutation databases

BioMutaiBRD2.
DMDMi12230989.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002111801 – 801Bromodomain-containing protein 2Add BLAST801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei6PhosphothreonineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei305PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP25440.
MaxQBiP25440.
PaxDbiP25440.
PeptideAtlasiP25440.
PRIDEiP25440.

PTM databases

iPTMnetiP25440.
PhosphoSitePlusiP25440.

Expressioni

Gene expression databases

BgeeiENSG00000204256.
CleanExiHS_BRD2.
ExpressionAtlasiP25440. baseline and differential.
GenevisibleiP25440. HS.

Organism-specific databases

HPAiHPA042816.
HPA054746.

Interactioni

Subunit structurei

Homodimer. Interacts with E2F1 and with histone H4 acetylated at 'Lys-13'.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HIST2H4BP628055EBI-2874802,EBI-302023
RUNX3Q137618EBI-2874802,EBI-925990

GO - Molecular functioni

  • lysine-acetylated histone binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111973. 37 interactors.
DIPiDIP-60835N.
IntActiP25440. 20 interactors.
MINTiMINT-4530155.
STRINGi9606.ENSP00000378702.

Chemistry databases

BindingDBiP25440.

Structurei

Secondary structure

1801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi77 – 84Combined sources8
Helixi86 – 91Combined sources6
Helixi97 – 99Combined sources3
Helixi105 – 108Combined sources4
Helixi113 – 116Combined sources4
Helixi123 – 131Combined sources9
Helixi138 – 155Combined sources18
Helixi161 – 177Combined sources17
Helixi348 – 360Combined sources13
Helixi363 – 365Combined sources3
Helixi366 – 369Combined sources4
Helixi370 – 372Combined sources3
Helixi378 – 381Combined sources4
Helixi386 – 389Combined sources4
Helixi396 – 404Combined sources9
Turni406 – 408Combined sources3
Helixi411 – 428Combined sources18
Helixi434 – 450Combined sources17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X0JX-ray1.80A/B/C73-194[»]
2DVQX-ray2.04A/B/C73-194[»]
2DVRX-ray2.30A/B/C73-194[»]
2DVSX-ray2.04A/B/C73-194[»]
2DVVX-ray1.80A348-455[»]
2E3KX-ray2.30A/B/C/D348-455[»]
2G4ANMR-A348-455[»]
2YDWX-ray1.90A/B/C67-200[»]
2YEKX-ray1.98A/B/C67-200[»]
3AQAX-ray2.30A/B/C73-194[»]
3ONIX-ray1.61A344-455[»]
4A9EX-ray1.91A/B/C67-200[»]
4A9FX-ray1.73A/B/C67-200[»]
4A9HX-ray2.05A/B/C67-200[»]
4A9IX-ray2.25A/B/C67-200[»]
4A9JX-ray1.90A/B/C67-200[»]
4A9MX-ray2.06A/B/C67-200[»]
4A9NX-ray1.85A/B/C67-200[»]
4A9OX-ray1.78A/B/C67-200[»]
4AKNX-ray1.82A/B/C67-200[»]
4ALGX-ray1.60A67-200[»]
4ALHX-ray1.78A/B/C67-200[»]
4J1PX-ray1.08A344-455[»]
4MR5X-ray1.63A344-455[»]
4MR6X-ray1.67A344-455[»]
4QEUX-ray1.50A344-455[»]
4QEVX-ray1.80A344-455[»]
4QEWX-ray1.70A344-455[»]
4UYFX-ray1.60A/B/C67-200[»]
4UYGX-ray2.50A/B/C/D/E/F338-473[»]
4UYHX-ray1.73A/B/C67-200[»]
5BT5X-ray1.40A344-455[»]
5DFBX-ray1.40A344-455[»]
5DFCX-ray1.50A344-455[»]
5DFDX-ray1.50A344-455[»]
5DW1X-ray1.55A/B/C/D345-455[»]
5HELX-ray1.45A71-194[»]
5HEMX-ray1.65A/B71-194[»]
5HENX-ray1.79A/B/C71-194[»]
5HFQX-ray1.40A344-455[»]
5IBNX-ray0.94A348-455[»]
5IG6X-ray0.91A348-454[»]
ProteinModelPortaliP25440.
SMRiP25440.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP25440.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini91 – 163Bromo 1PROSITE-ProRule annotationAdd BLAST73
Domaini364 – 436Bromo 2PROSITE-ProRule annotationAdd BLAST73
Domaini632 – 714NETPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi555 – 559Nuclear localization signalSequence analysis5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi61 – 64Poly-Pro4
Compositional biasi476 – 515Glu/Ser-richAdd BLAST40
Compositional biasi492 – 506Poly-GluAdd BLAST15
Compositional biasi544 – 566Arg/Lys-rich (highly basic)Add BLAST23
Compositional biasi551 – 559Poly-Lys9
Compositional biasi634 – 638Poly-Glu5
Compositional biasi775 – 801Ser-richAdd BLAST27
Compositional biasi775 – 793Poly-SerAdd BLAST19

Domaini

One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.

Sequence similaritiesi

Contains 2 bromo domains.PROSITE-ProRule annotation
Contains 1 NET domain.PROSITE-ProRule annotation

Keywords - Domaini

Bromodomain, Repeat

Phylogenomic databases

eggNOGiKOG1474. Eukaryota.
COG5076. LUCA.
GeneTreeiENSGT00760000119206.
HOGENOMiHOG000231200.
HOVERGENiHBG004896.
InParanoidiP25440.
KOiK08871.
OMAiTESSVAQ.
OrthoDBiEOG091G01QC.
PhylomeDBiP25440.
TreeFamiTF317345.

Family and domain databases

Gene3Di1.20.920.10. 3 hits.
InterProiIPR001487. Bromodomain.
IPR018359. Bromodomain_CS.
IPR027353. NET_dom.
[Graphical view]
PfamiPF17035. BET. 1 hit.
PF00439. Bromodomain. 2 hits.
[Graphical view]
PRINTSiPR00503. BROMODOMAIN.
SMARTiSM00297. BROMO. 2 hits.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 2 hits.
PROSITEiPS00633. BROMODOMAIN_1. 2 hits.
PS50014. BROMODOMAIN_2. 2 hits.
PS51525. NET. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P25440-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLQNVTPHNK LPGEGNAGLL GLGPEAAAPG KRIRKPSLLY EGFESPTMAS
60 70 80 90 100
VPALQLTPAN PPPPEVSNPK KPGRVTNQLQ YLHKVVMKAL WKHQFAWPFR
110 120 130 140 150
QPVDAVKLGL PDYHKIIKQP MDMGTIKRRL ENNYYWAASE CMQDFNTMFT
160 170 180 190 200
NCYIYNKPTD DIVLMAQTLE KIFLQKVASM PQEEQELVVT IPKNSHKKGA
210 220 230 240 250
KLAALQGSVT SAHQVPAVSS VSHTALYTPP PEIPTTVLNI PHPSVISSPL
260 270 280 290 300
LKSLHSAGPP LLAVTAAPPA QPLAKKKGVK RKADTTTPTP TAILAPGSPA
310 320 330 340 350
SPPGSLEPKA ARLPPMRRES GRPIKPPRKD LPDSQQQHQS SKKGKLSEQL
360 370 380 390 400
KHCNGILKEL LSKKHAAYAW PFYKPVDASA LGLHDYHDII KHPMDLSTVK
410 420 430 440 450
RKMENRDYRD AQEFAADVRL MFSNCYKYNP PDHDVVAMAR KLQDVFEFRY
460 470 480 490 500
AKMPDEPLEP GPLPVSTAMP PGLAKSSSES SSEESSSESS SEEEEEEDEE
510 520 530 540 550
DEEEEESESS DSEEERAHRL AELQEQLRAV HEQLAALSQG PISKPKRKRE
560 570 580 590 600
KKEKKKKRKA EKHRGRAGAD EDDKGPRAPR PPQPKKSKKA SGSGGGSAAL
610 620 630 640 650
GPSGFGPSGG SGTKLPKKAT KTAPPALPTG YDSEEEEESR PMSYDEKRQL
660 670 680 690 700
SLDINKLPGE KLGRVVHIIQ AREPSLRDSN PEEIEIDFET LKPSTLRELE
710 720 730 740 750
RYVLSCLRKK PRKPYTIKKP VGKTKEELAL EKKRELEKRL QDVSGQLNST
760 770 780 790 800
KKPPKKANEK TESSSAQQVA VSRLSASSSS SDSSSSSSSS SSSDTSDSDS

G
Length:801
Mass (Da):88,061
Last modified:January 11, 2001 - v2
Checksum:i9A075EEB13507D8E
GO
Isoform 2 (identifier: P25440-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: L → LQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRL

Note: No experimental confirmation available.
Show »
Length:836
Mass (Da):92,033
Checksum:i9064FEB42F773B84
GO
Isoform 3 (identifier: P25440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:754
Mass (Da):83,151
Checksum:i2DC450BD2727B979
GO
Isoform 4 (identifier: P25440-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:681
Mass (Da):74,881
Checksum:i22CE98AEC0994F92
GO

Sequence cautioni

The sequence AAA68890 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti490S → F in CAH56179 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04190430G → E in a glioblastoma multiforme sample; somatic mutation. 1 Publication1
Natural variantiVAR_04190549A → G.1 PublicationCorresponds to variant rs115232156dbSNPEnsembl.1
Natural variantiVAR_04190649A → S.1 PublicationCorresponds to variant rs55669504dbSNPEnsembl.1
Natural variantiVAR_041907212A → P.1 PublicationCorresponds to variant rs35952031dbSNPEnsembl.1
Natural variantiVAR_022132238L → F.2 PublicationsCorresponds to variant rs176250dbSNPEnsembl.1
Natural variantiVAR_041908260P → Q.1 PublicationCorresponds to variant rs35294809dbSNPEnsembl.1
Natural variantiVAR_029300474A → V.1 PublicationCorresponds to variant rs3918143dbSNPEnsembl.1
Natural variantiVAR_029301547R → K.Corresponds to variant rs1049369dbSNPEnsembl.1
Natural variantiVAR_041909558R → G in a gastric adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041910569A → T.1 PublicationCorresponds to variant rs34530779dbSNPEnsembl.1
Natural variantiVAR_041911599A → P.1 PublicationCorresponds to variant rs55952113dbSNPEnsembl.1
Natural variantiVAR_041912714P → L in a glioblastoma multiforme sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0550281 – 120Missing in isoform 4. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0550291 – 47Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_022600615L → LQAGVQWRDLGLLQPPLLGF KRFSCLSLPSSQDYRL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X62083 mRNA. Translation: CAA43996.1.
M80613 mRNA. Translation: AAA68890.1. Different initiation.
X96670 Genomic DNA. Translation: CAA65450.1.
Z96104 Genomic DNA. Translation: CAC69989.1.
D42040 mRNA. Translation: BAA07641.1.
BX647233 mRNA. Translation: CAH56179.1.
BX648109 mRNA. Translation: CAH56171.1.
AL832722 mRNA. Translation: CAH56208.1.
AL645941 Genomic DNA. No translation available.
AL662845 Genomic DNA. No translation available.
AL805913 Genomic DNA. No translation available.
BX005422 Genomic DNA. No translation available.
BX908719 Genomic DNA. No translation available.
CR936909 Genomic DNA. No translation available.
AL935042 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX03662.1.
CH471081 Genomic DNA. Translation: EAX03663.1.
BC063840 mRNA. Translation: AAH63840.1.
CCDSiCCDS4762.1. [P25440-1]
CCDS56420.1. [P25440-2]
CCDS56421.1. [P25440-3]
PIRiA56619.
RefSeqiNP_001106653.1. NM_001113182.2. [P25440-1]
NP_001186384.1. NM_001199455.1. [P25440-2]
NP_001186385.1. NM_001199456.1. [P25440-3]
NP_001278915.1. NM_001291986.1. [P25440-4]
NP_005095.1. NM_005104.3. [P25440-1]
UniGeneiHs.75243.

Genome annotation databases

EnsembliENST00000374825; ENSP00000363958; ENSG00000204256. [P25440-1]
ENST00000374831; ENSP00000363964; ENSG00000204256. [P25440-1]
ENST00000383108; ENSP00000372588; ENSG00000234507. [P25440-1]
ENST00000395287; ENSP00000378702; ENSG00000204256. [P25440-2]
ENST00000399527; ENSP00000382443; ENSG00000215077. [P25440-2]
ENST00000399528; ENSP00000382444; ENSG00000215077. [P25440-1]
ENST00000399529; ENSP00000382445; ENSG00000215077. [P25440-1]
ENST00000414731; ENSP00000391246; ENSG00000234704.
ENST00000436979; ENSP00000405634; ENSG00000235307. [P25440-3]
ENST00000438194; ENSP00000401791; ENSG00000234507. [P25440-1]
ENST00000442863; ENSP00000410994; ENSG00000234507. [P25440-2]
ENST00000448067; ENSP00000412885; ENSG00000235307. [P25440-2]
ENST00000449085; ENSP00000409145; ENSG00000204256. [P25440-3]
ENST00000449118; ENSP00000399009; ENSG00000234704.
ENST00000549126; ENSP00000449380; ENSG00000235307. [P25440-1]
ENST00000552587; ENSP00000449609; ENSG00000235307. [P25440-1]
GeneIDi6046.
KEGGihsa:6046.
UCSCiuc003ocn.4. human. [P25440-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X62083 mRNA. Translation: CAA43996.1.
M80613 mRNA. Translation: AAA68890.1. Different initiation.
X96670 Genomic DNA. Translation: CAA65450.1.
Z96104 Genomic DNA. Translation: CAC69989.1.
D42040 mRNA. Translation: BAA07641.1.
BX647233 mRNA. Translation: CAH56179.1.
BX648109 mRNA. Translation: CAH56171.1.
AL832722 mRNA. Translation: CAH56208.1.
AL645941 Genomic DNA. No translation available.
AL662845 Genomic DNA. No translation available.
AL805913 Genomic DNA. No translation available.
BX005422 Genomic DNA. No translation available.
BX908719 Genomic DNA. No translation available.
CR936909 Genomic DNA. No translation available.
AL935042 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX03662.1.
CH471081 Genomic DNA. Translation: EAX03663.1.
BC063840 mRNA. Translation: AAH63840.1.
CCDSiCCDS4762.1. [P25440-1]
CCDS56420.1. [P25440-2]
CCDS56421.1. [P25440-3]
PIRiA56619.
RefSeqiNP_001106653.1. NM_001113182.2. [P25440-1]
NP_001186384.1. NM_001199455.1. [P25440-2]
NP_001186385.1. NM_001199456.1. [P25440-3]
NP_001278915.1. NM_001291986.1. [P25440-4]
NP_005095.1. NM_005104.3. [P25440-1]
UniGeneiHs.75243.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X0JX-ray1.80A/B/C73-194[»]
2DVQX-ray2.04A/B/C73-194[»]
2DVRX-ray2.30A/B/C73-194[»]
2DVSX-ray2.04A/B/C73-194[»]
2DVVX-ray1.80A348-455[»]
2E3KX-ray2.30A/B/C/D348-455[»]
2G4ANMR-A348-455[»]
2YDWX-ray1.90A/B/C67-200[»]
2YEKX-ray1.98A/B/C67-200[»]
3AQAX-ray2.30A/B/C73-194[»]
3ONIX-ray1.61A344-455[»]
4A9EX-ray1.91A/B/C67-200[»]
4A9FX-ray1.73A/B/C67-200[»]
4A9HX-ray2.05A/B/C67-200[»]
4A9IX-ray2.25A/B/C67-200[»]
4A9JX-ray1.90A/B/C67-200[»]
4A9MX-ray2.06A/B/C67-200[»]
4A9NX-ray1.85A/B/C67-200[»]
4A9OX-ray1.78A/B/C67-200[»]
4AKNX-ray1.82A/B/C67-200[»]
4ALGX-ray1.60A67-200[»]
4ALHX-ray1.78A/B/C67-200[»]
4J1PX-ray1.08A344-455[»]
4MR5X-ray1.63A344-455[»]
4MR6X-ray1.67A344-455[»]
4QEUX-ray1.50A344-455[»]
4QEVX-ray1.80A344-455[»]
4QEWX-ray1.70A344-455[»]
4UYFX-ray1.60A/B/C67-200[»]
4UYGX-ray2.50A/B/C/D/E/F338-473[»]
4UYHX-ray1.73A/B/C67-200[»]
5BT5X-ray1.40A344-455[»]
5DFBX-ray1.40A344-455[»]
5DFCX-ray1.50A344-455[»]
5DFDX-ray1.50A344-455[»]
5DW1X-ray1.55A/B/C/D345-455[»]
5HELX-ray1.45A71-194[»]
5HEMX-ray1.65A/B71-194[»]
5HENX-ray1.79A/B/C71-194[»]
5HFQX-ray1.40A344-455[»]
5IBNX-ray0.94A348-455[»]
5IG6X-ray0.91A348-454[»]
ProteinModelPortaliP25440.
SMRiP25440.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111973. 37 interactors.
DIPiDIP-60835N.
IntActiP25440. 20 interactors.
MINTiMINT-4530155.
STRINGi9606.ENSP00000378702.

Chemistry databases

BindingDBiP25440.
ChEMBLiCHEMBL1293289.
GuidetoPHARMACOLOGYi1944.

PTM databases

iPTMnetiP25440.
PhosphoSitePlusiP25440.

Polymorphism and mutation databases

BioMutaiBRD2.
DMDMi12230989.

Proteomic databases

EPDiP25440.
MaxQBiP25440.
PaxDbiP25440.
PeptideAtlasiP25440.
PRIDEiP25440.

Protocols and materials databases

DNASUi6046.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374825; ENSP00000363958; ENSG00000204256. [P25440-1]
ENST00000374831; ENSP00000363964; ENSG00000204256. [P25440-1]
ENST00000383108; ENSP00000372588; ENSG00000234507. [P25440-1]
ENST00000395287; ENSP00000378702; ENSG00000204256. [P25440-2]
ENST00000399527; ENSP00000382443; ENSG00000215077. [P25440-2]
ENST00000399528; ENSP00000382444; ENSG00000215077. [P25440-1]
ENST00000399529; ENSP00000382445; ENSG00000215077. [P25440-1]
ENST00000414731; ENSP00000391246; ENSG00000234704.
ENST00000436979; ENSP00000405634; ENSG00000235307. [P25440-3]
ENST00000438194; ENSP00000401791; ENSG00000234507. [P25440-1]
ENST00000442863; ENSP00000410994; ENSG00000234507. [P25440-2]
ENST00000448067; ENSP00000412885; ENSG00000235307. [P25440-2]
ENST00000449085; ENSP00000409145; ENSG00000204256. [P25440-3]
ENST00000449118; ENSP00000399009; ENSG00000234704.
ENST00000549126; ENSP00000449380; ENSG00000235307. [P25440-1]
ENST00000552587; ENSP00000449609; ENSG00000235307. [P25440-1]
GeneIDi6046.
KEGGihsa:6046.
UCSCiuc003ocn.4. human. [P25440-1]

Organism-specific databases

CTDi6046.
DisGeNETi6046.
GeneCardsiBRD2.
HGNCiHGNC:1103. BRD2.
HPAiHPA042816.
HPA054746.
MIMi601540. gene.
neXtProtiNX_P25440.
OpenTargetsiENSG00000204256.
ENSG00000215077.
ENSG00000234507.
ENSG00000235307.
PharmGKBiPA25414.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1474. Eukaryota.
COG5076. LUCA.
GeneTreeiENSGT00760000119206.
HOGENOMiHOG000231200.
HOVERGENiHBG004896.
InParanoidiP25440.
KOiK08871.
OMAiTESSVAQ.
OrthoDBiEOG091G01QC.
PhylomeDBiP25440.
TreeFamiTF317345.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112526-MONOMER.

Miscellaneous databases

ChiTaRSiBRD2. human.
EvolutionaryTraceiP25440.
GeneWikiiBRD2.
GenomeRNAii6046.
PROiP25440.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000204256.
CleanExiHS_BRD2.
ExpressionAtlasiP25440. baseline and differential.
GenevisibleiP25440. HS.

Family and domain databases

Gene3Di1.20.920.10. 3 hits.
InterProiIPR001487. Bromodomain.
IPR018359. Bromodomain_CS.
IPR027353. NET_dom.
[Graphical view]
PfamiPF17035. BET. 1 hit.
PF00439. Bromodomain. 2 hits.
[Graphical view]
PRINTSiPR00503. BROMODOMAIN.
SMARTiSM00297. BROMO. 2 hits.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 2 hits.
PROSITEiPS00633. BROMODOMAIN_1. 2 hits.
PS50014. BROMODOMAIN_2. 2 hits.
PS51525. NET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBRD2_HUMAN
AccessioniPrimary (citable) accession number: P25440
Secondary accession number(s): A2AAU0
, B0S7P0, B1AZT1, O00699, O00700, Q15310, Q5STC9, Q63HQ9, Q658Y7, Q6P3U2, Q969U4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 11, 2001
Last modified: November 30, 2016
This is version 168 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.