Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bromodomain-containing protein 2

Gene

BRD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.By similarity1 Publication

GO - Molecular functioni

  • chromatin binding Source: UniProtKB
  • lysine-acetylated histone binding Source: UniProtKB

GO - Biological processi

  • nucleosome assembly Source: UniProtKB
  • regulation of transcription by RNA polymerase II Source: UniProtKB
  • spermatogenesis Source: ProtInc
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionChromatin regulator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-8951936 RUNX3 regulates p14-ARF
SIGNORiP25440

Names & Taxonomyi

Protein namesi
Recommended name:
Bromodomain-containing protein 2
Alternative name(s):
O27.1.1
Really interesting new gene 3 protein
Gene namesi
Name:BRD2
Synonyms:KIAA9001, RING3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204256.12
HGNCiHGNC:1103 BRD2
MIMi601540 gene
neXtProtiNX_P25440

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi78Q → A: Loss of homodimerization. 1 Publication1
Mutagenesisi142 – 143MQ → AA: Loss of homodimerization. 1 Publication2
Mutagenesisi153Y → K: Loss of homodimerization. 1 Publication1
Mutagenesisi154I → A: Partial loss of homodimerization; when associated with A-182. 1 Publication1
Mutagenesisi170E → A: Loss of homodimerization. 1 Publication1
Mutagenesisi174L → E: Loss of homodimerization. 1 Publication1
Mutagenesisi177V → E: Loss of homodimerization. 1 Publication1
Mutagenesisi182Q → A: Partial loss of homodimerization; when associated with A-154. 1 Publication1

Organism-specific databases

DisGeNETi6046
OpenTargetsiENSG00000204256
PharmGKBiPA25414

Chemistry databases

ChEMBLiCHEMBL1293289
GuidetoPHARMACOLOGYi1944

Polymorphism and mutation databases

BioMutaiBRD2
DMDMi12230989

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002111801 – 801Bromodomain-containing protein 2Add BLAST801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei6PhosphothreonineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei305PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP25440
MaxQBiP25440
PaxDbiP25440
PeptideAtlasiP25440
PRIDEiP25440

PTM databases

iPTMnetiP25440
PhosphoSitePlusiP25440

Expressioni

Gene expression databases

BgeeiENSG00000204256
CleanExiHS_BRD2
ExpressionAtlasiP25440 baseline and differential
GenevisibleiP25440 HS

Organism-specific databases

HPAiHPA042816

Interactioni

Subunit structurei

Homodimer. Interacts with E2F1 and with histone H4 acetylated at 'Lys-13'.2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • lysine-acetylated histone binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111973, 41 interactors
DIPiDIP-60835N
IntActiP25440, 23 interactors
MINTiP25440
STRINGi9606.ENSP00000378702

Chemistry databases

BindingDBiP25440

Structurei

Secondary structure

1801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi77 – 84Combined sources8
Helixi86 – 91Combined sources6
Helixi97 – 99Combined sources3
Helixi105 – 108Combined sources4
Helixi113 – 116Combined sources4
Helixi123 – 131Combined sources9
Helixi138 – 155Combined sources18
Helixi161 – 177Combined sources17
Helixi348 – 360Combined sources13
Helixi363 – 365Combined sources3
Helixi366 – 369Combined sources4
Helixi370 – 372Combined sources3
Helixi378 – 381Combined sources4
Helixi386 – 389Combined sources4
Helixi396 – 404Combined sources9
Turni406 – 408Combined sources3
Helixi411 – 428Combined sources18
Beta strandi431 – 433Combined sources3
Helixi434 – 450Combined sources17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X0JX-ray1.80A/B/C73-194[»]
2DVQX-ray2.04A/B/C73-194[»]
2DVRX-ray2.30A/B/C73-194[»]
2DVSX-ray2.04A/B/C73-194[»]
2DVVX-ray1.80A348-455[»]
2E3KX-ray2.30A/B/C/D348-455[»]
2G4ANMR-A348-455[»]
2YDWX-ray1.90A/B/C67-200[»]
2YEKX-ray1.98A/B/C67-200[»]
3AQAX-ray2.30A/B/C73-194[»]
3ONIX-ray1.61A344-455[»]
4A9EX-ray1.91A/B/C67-200[»]
4A9FX-ray1.73A/B/C67-200[»]
4A9HX-ray2.05A/B/C67-200[»]
4A9IX-ray2.25A/B/C67-200[»]
4A9JX-ray1.90A/B/C67-200[»]
4A9MX-ray2.06A/B/C67-200[»]
4A9NX-ray1.85A/B/C67-200[»]
4A9OX-ray1.78A/B/C67-200[»]
4AKNX-ray1.82A/B/C67-200[»]
4ALGX-ray1.60A67-200[»]
4ALHX-ray1.78A/B/C67-200[»]
4J1PX-ray1.08A344-455[»]
4MR5X-ray1.63A344-455[»]
4MR6X-ray1.67A344-455[»]
4QEUX-ray1.50A344-455[»]
4QEVX-ray1.80A344-455[»]
4QEWX-ray1.70A344-455[»]
4UYFX-ray1.60A/B/C67-200[»]
4UYGX-ray2.50A/B/C/D/E/F338-473[»]
4UYHX-ray1.73A/B/C67-200[»]
5BT5X-ray1.40A344-455[»]
5DFBX-ray1.40A344-455[»]
5DFCX-ray1.50A344-455[»]
5DFDX-ray1.50A344-455[»]
5DW1X-ray1.55A/B/C/D345-455[»]
5EK9X-ray2.08A/B344-455[»]
5HELX-ray1.45A71-194[»]
5HEMX-ray1.65A/B71-194[»]
5HENX-ray1.79A/B/C71-194[»]
5HFQX-ray1.40A344-455[»]
5IBNX-ray0.94A348-455[»]
5IG6X-ray0.91A348-454[»]
5N2LX-ray1.89A/B/C/D344-455[»]
5O38X-ray1.20A344-455[»]
5O39X-ray1.74A344-455[»]
5O3AX-ray2.40A344-455[»]
5O3BX-ray1.95A/B/C/D344-455[»]
5O3CX-ray1.60A344-455[»]
5O3DX-ray1.60A345-455[»]
5O3EX-ray1.40A344-455[»]
5O3FX-ray1.75A344-455[»]
5O3GX-ray1.85A/B344-455[»]
5O3HX-ray1.40A344-455[»]
5O3IX-ray1.20A344-455[»]
5U5SNMR-A344-455[»]
5U6VX-ray1.77A347-455[»]
5UEWX-ray1.83A/B347-454[»]
5XHEX-ray1.40A348-455[»]
5XHKX-ray1.28A348-455[»]
ProteinModelPortaliP25440
SMRiP25440
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP25440

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini91 – 163Bromo 1PROSITE-ProRule annotationAdd BLAST73
Domaini364 – 436Bromo 2PROSITE-ProRule annotationAdd BLAST73
Domaini632 – 714NETPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi555 – 559Nuclear localization signalSequence analysis5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi61 – 64Poly-Pro4
Compositional biasi476 – 515Glu/Ser-richAdd BLAST40
Compositional biasi492 – 506Poly-GluAdd BLAST15
Compositional biasi544 – 566Arg/Lys-rich (highly basic)Add BLAST23
Compositional biasi551 – 559Poly-Lys9
Compositional biasi634 – 638Poly-Glu5
Compositional biasi775 – 801Ser-richAdd BLAST27
Compositional biasi775 – 793Poly-SerAdd BLAST19

Domaini

One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.

Keywords - Domaini

Bromodomain, Repeat

Phylogenomic databases

eggNOGiKOG1474 Eukaryota
COG5076 LUCA
GeneTreeiENSGT00760000119206
HOGENOMiHOG000231200
HOVERGENiHBG004896
InParanoidiP25440
KOiK08871
OMAiPTGYDSE
OrthoDBiEOG091G01QC
PhylomeDBiP25440
TreeFamiTF317345

Family and domain databases

Gene3Di1.20.1270.220, 1 hit
1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR018359 Bromodomain_CS
IPR027353 NET_dom
IPR038336 NET_sf
PfamiView protein in Pfam
PF17035 BET, 1 hit
PF00439 Bromodomain, 2 hits
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS00633 BROMODOMAIN_1, 2 hits
PS50014 BROMODOMAIN_2, 2 hits
PS51525 NET, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P25440-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLQNVTPHNK LPGEGNAGLL GLGPEAAAPG KRIRKPSLLY EGFESPTMAS
60 70 80 90 100
VPALQLTPAN PPPPEVSNPK KPGRVTNQLQ YLHKVVMKAL WKHQFAWPFR
110 120 130 140 150
QPVDAVKLGL PDYHKIIKQP MDMGTIKRRL ENNYYWAASE CMQDFNTMFT
160 170 180 190 200
NCYIYNKPTD DIVLMAQTLE KIFLQKVASM PQEEQELVVT IPKNSHKKGA
210 220 230 240 250
KLAALQGSVT SAHQVPAVSS VSHTALYTPP PEIPTTVLNI PHPSVISSPL
260 270 280 290 300
LKSLHSAGPP LLAVTAAPPA QPLAKKKGVK RKADTTTPTP TAILAPGSPA
310 320 330 340 350
SPPGSLEPKA ARLPPMRRES GRPIKPPRKD LPDSQQQHQS SKKGKLSEQL
360 370 380 390 400
KHCNGILKEL LSKKHAAYAW PFYKPVDASA LGLHDYHDII KHPMDLSTVK
410 420 430 440 450
RKMENRDYRD AQEFAADVRL MFSNCYKYNP PDHDVVAMAR KLQDVFEFRY
460 470 480 490 500
AKMPDEPLEP GPLPVSTAMP PGLAKSSSES SSEESSSESS SEEEEEEDEE
510 520 530 540 550
DEEEEESESS DSEEERAHRL AELQEQLRAV HEQLAALSQG PISKPKRKRE
560 570 580 590 600
KKEKKKKRKA EKHRGRAGAD EDDKGPRAPR PPQPKKSKKA SGSGGGSAAL
610 620 630 640 650
GPSGFGPSGG SGTKLPKKAT KTAPPALPTG YDSEEEEESR PMSYDEKRQL
660 670 680 690 700
SLDINKLPGE KLGRVVHIIQ AREPSLRDSN PEEIEIDFET LKPSTLRELE
710 720 730 740 750
RYVLSCLRKK PRKPYTIKKP VGKTKEELAL EKKRELEKRL QDVSGQLNST
760 770 780 790 800
KKPPKKANEK TESSSAQQVA VSRLSASSSS SDSSSSSSSS SSSDTSDSDS

G
Length:801
Mass (Da):88,061
Last modified:January 11, 2001 - v2
Checksum:i9A075EEB13507D8E
GO
Isoform 2 (identifier: P25440-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: L → LQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRL

Note: No experimental confirmation available.
Show »
Length:836
Mass (Da):92,033
Checksum:i9064FEB42F773B84
GO
Isoform 3 (identifier: P25440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:754
Mass (Da):83,151
Checksum:i2DC450BD2727B979
GO
Isoform 4 (identifier: P25440-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:681
Mass (Da):74,881
Checksum:i22CE98AEC0994F92
GO

Sequence cautioni

The sequence AAA68890 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti490S → F in CAH56179 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04190430G → E in a glioblastoma multiforme sample; somatic mutation. 1 Publication1
Natural variantiVAR_04190549A → G1 PublicationCorresponds to variant dbSNP:rs3918144Ensembl.1
Natural variantiVAR_04190649A → S1 PublicationCorresponds to variant dbSNP:rs55669504Ensembl.1
Natural variantiVAR_041907212A → P1 PublicationCorresponds to variant dbSNP:rs35952031Ensembl.1
Natural variantiVAR_022132238L → F2 PublicationsCorresponds to variant dbSNP:rs176250Ensembl.1
Natural variantiVAR_041908260P → Q1 PublicationCorresponds to variant dbSNP:rs35294809Ensembl.1
Natural variantiVAR_029300474A → V1 PublicationCorresponds to variant dbSNP:rs3918143Ensembl.1
Natural variantiVAR_029301547R → K. Corresponds to variant dbSNP:rs1049369Ensembl.1
Natural variantiVAR_041909558R → G in a gastric adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041910569A → T1 PublicationCorresponds to variant dbSNP:rs34530779Ensembl.1
Natural variantiVAR_041911599A → P1 PublicationCorresponds to variant dbSNP:rs55952113Ensembl.1
Natural variantiVAR_041912714P → L in a glioblastoma multiforme sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0550281 – 120Missing in isoform 4. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0550291 – 47Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_022600615L → LQAGVQWRDLGLLQPPLLGF KRFSCLSLPSSQDYRL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X62083 mRNA Translation: CAA43996.1
M80613 mRNA Translation: AAA68890.1 Different initiation.
X96670 Genomic DNA Translation: CAA65450.1
Z96104 Genomic DNA Translation: CAC69989.1
D42040 mRNA Translation: BAA07641.1
BX647233 mRNA Translation: CAH56179.1
BX648109 mRNA Translation: CAH56171.1
AL832722 mRNA Translation: CAH56208.1
AL645941 Genomic DNA No translation available.
AL662845 Genomic DNA No translation available.
AL805913 Genomic DNA No translation available.
BX005422 Genomic DNA No translation available.
BX908719 Genomic DNA No translation available.
CR936909 Genomic DNA No translation available.
AL935042 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03662.1
CH471081 Genomic DNA Translation: EAX03663.1
BC063840 mRNA Translation: AAH63840.1
CCDSiCCDS4762.1 [P25440-1]
CCDS56420.1 [P25440-2]
CCDS56421.1 [P25440-3]
PIRiA56619
RefSeqiNP_001106653.1, NM_001113182.2 [P25440-1]
NP_001186384.1, NM_001199455.1 [P25440-2]
NP_001186385.1, NM_001199456.1 [P25440-3]
NP_001278915.1, NM_001291986.1 [P25440-4]
NP_005095.1, NM_005104.3 [P25440-1]
UniGeneiHs.734797
Hs.75243

Genome annotation databases

EnsembliENST00000374825; ENSP00000363958; ENSG00000204256 [P25440-1]
ENST00000374831; ENSP00000363964; ENSG00000204256 [P25440-1]
ENST00000383108; ENSP00000372588; ENSG00000234507 [P25440-1]
ENST00000395287; ENSP00000378702; ENSG00000204256 [P25440-2]
ENST00000399527; ENSP00000382443; ENSG00000215077 [P25440-2]
ENST00000399528; ENSP00000382444; ENSG00000215077 [P25440-1]
ENST00000399529; ENSP00000382445; ENSG00000215077 [P25440-1]
ENST00000414731; ENSP00000391246; ENSG00000234704
ENST00000436979; ENSP00000405634; ENSG00000235307 [P25440-3]
ENST00000438194; ENSP00000401791; ENSG00000234507 [P25440-1]
ENST00000442863; ENSP00000410994; ENSG00000234507 [P25440-2]
ENST00000448067; ENSP00000412885; ENSG00000235307 [P25440-2]
ENST00000449085; ENSP00000409145; ENSG00000204256 [P25440-3]
ENST00000449118; ENSP00000399009; ENSG00000234704
ENST00000549126; ENSP00000449380; ENSG00000235307 [P25440-1]
ENST00000552587; ENSP00000449609; ENSG00000235307 [P25440-1]
GeneIDi6046
KEGGihsa:6046
UCSCiuc003ocn.4 human [P25440-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBRD2_HUMAN
AccessioniPrimary (citable) accession number: P25440
Secondary accession number(s): A2AAU0
, B0S7P0, B1AZT1, O00699, O00700, Q15310, Q5STC9, Q63HQ9, Q658Y7, Q6P3U2, Q969U4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 1992
Last sequence update: January 11, 2001
Last modified: May 23, 2018
This is version 183 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health