P25440 (BRD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bromodomain-containing protein 2 Alternative name(s): O27.1.1 Really interesting new gene 3 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 801 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in spermatogenesis or folliculogenesis By similarity. |
| Subunit structure | Homodimer. Interacts with E2F1 and with histone H4 acetylated at 'Lys-13'. Ref.15 |
| Subcellular location | Nucleus By similarity. |
| Domain | One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'. |
| Sequence similarities | Contains 2 bromo domains. Contains 1 ET domain. |
| Sequence caution | The sequence AAA68890.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Bromodomain Repeat |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | spermatogenesis Traceable author statement. Source: ProtInc |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein serine/threonine kinase activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P25440-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P25440-2) The sequence of this isoform differs from the canonical sequence as follows: 615-615: L → LQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 801 | 801 | Bromodomain-containing protein 2 | PRO_0000211180 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Domain | 91 – 163 | 73 | Bromo 1 | |||||||||||||||||||||||||||||||||||||
| Domain | 364 – 436 | 73 | Bromo 2 | |||||||||||||||||||||||||||||||||||||
| Domain | 638 – 801 | 164 | ET | |||||||||||||||||||||||||||||||||||||
| Motif | 555 – 559 | 5 | Nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 61 – 64 | 4 | Poly-Pro | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 476 – 515 | 40 | Glu/Ser-rich | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 492 – 506 | 15 | Poly-Glu | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 544 – 566 | 23 | Arg/Lys-rich (highly basic) | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 551 – 559 | 9 | Poly-Lys | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 634 – 638 | 5 | Poly-Glu | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 775 – 801 | 27 | Ser-rich | |||||||||||||||||||||||||||||||||||||
| Compositional bias | 775 – 793 | 19 | Poly-Ser | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.12 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 37 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.8 Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 301 | 1 | Phosphoserine Ref.8 Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 305 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 320 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 633 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 724 | 1 | Phosphothreonine Ref.9 | |||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 615 | 1 | L → LQAGVQWRDLGLLQPPLLGF KRFSCLSLPSSQDYRL in isoform 2. | VSP_022600 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 30 | 1 | G → E in a glioblastoma multiforme sample; somatic mutation. Ref.17 | VAR_041904 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | A → G. Ref.17 | VAR_041905 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | A → S. Ref.17 Corresponds to variant rs55669504 [ dbSNP | Ensembl ]. | VAR_041906 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 212 | 1 | A → P. Ref.17 Corresponds to variant rs35952031 [ dbSNP | Ensembl ]. | VAR_041907 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 238 | 1 | L → F. Ref.5 Ref.17 Corresponds to variant rs176250 [ dbSNP | Ensembl ]. | VAR_022132 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 260 | 1 | P → Q. Ref.17 Corresponds to variant rs35294809 [ dbSNP | Ensembl ]. | VAR_041908 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 474 | 1 | A → V. Ref.17 Corresponds to variant rs3918143 [ dbSNP | Ensembl ]. | VAR_029300 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 547 | 1 | R → K. Corresponds to variant rs1049369 [ dbSNP | Ensembl ]. | VAR_029301 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 558 | 1 | R → G in a gastric adenocarcinoma sample; somatic mutation. Ref.17 | VAR_041909 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 569 | 1 | A → T. Ref.17 Corresponds to variant rs34530779 [ dbSNP | Ensembl ]. | VAR_041910 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 599 | 1 | A → P. Ref.17 Corresponds to variant rs55952113 [ dbSNP | Ensembl ]. | VAR_041911 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 714 | 1 | P → L in a glioblastoma multiforme sample; somatic mutation. Ref.17 | VAR_041912 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 78 | 1 | Q → A: Loss of homodimerization. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 142 – 143 | 2 | MQ → AA: Loss of homodimerization. | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 153 | 1 | Y → K: Loss of homodimerization. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 154 | 1 | I → A: Partial loss of homodimerization; when associated with A-182. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 170 | 1 | E → A: Loss of homodimerization. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 174 | 1 | L → E: Loss of homodimerization. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 177 | 1 | V → E: Loss of homodimerization. Ref.15 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 182 | 1 | Q → A: Partial loss of homodimerization; when associated with A-154. Ref.15 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 84 | 8 | ||||||||||||||||||||||||||||||||||||||
| Helix | 86 – 92 | 7 | ||||||||||||||||||||||||||||||||||||||
| Helix | 97 – 99 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 105 – 108 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 116 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 123 – 131 | 9 | ||||||||||||||||||||||||||||||||||||||
| Helix | 138 – 155 | 18 | ||||||||||||||||||||||||||||||||||||||
| Helix | 161 – 177 | 17 | ||||||||||||||||||||||||||||||||||||||
| Helix | 349 – 362 | 14 | ||||||||||||||||||||||||||||||||||||||
| Helix | 366 – 373 | 8 | ||||||||||||||||||||||||||||||||||||||
| Helix | 378 – 382 | 5 | ||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 389 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 405 | 10 | ||||||||||||||||||||||||||||||||||||||
| Turn | 406 – 408 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 411 – 428 | 18 | ||||||||||||||||||||||||||||||||||||||
| Helix | 434 – 452 | 19 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A homologue of the Drosophila female sterile homeotic (fsh) gene in the class II region of the human MHC." Beck S., Hanson I., Kelly A., Pappin D.J.C., Trowsdale J. DNA Seq. 2:203-210(1992) [PubMed: 1352711] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: T-cell. |
| [2] | "Phylogeny and structure of the RING3 gene." Thorpe K.L., Abdulla S., Kaufman J., Trowsdale J., Beck S. Immunogenetics 44:391-396(1996) [PubMed: 8781126] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], SEQUENCE REVISION TO N-TERMINUS. |
| [3] | Nomura N., Miyajima N., Sazuka T., Tanaka A., Kawarabayasi Y., Sato S., Nagase T., Seki T., Ishikawa K., Tabata S. Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PHE-238. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: PNS. |
| [8] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298 AND SER-301, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-724, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-320, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298; SER-301; SER-305 AND SER-633, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298 AND SER-301, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-37; SER-298 AND SER-301, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Crystal structure of the human BRD2 bromodomain: insights into dimerization and recognition of acetylated histone h4." Nakamura Y., Umehara T., Nakano K., Jang M.K., Shirouzu M., Morita S., Uda-Tochio H., Hamana H., Terada T., Adachi N., Matsumoto T., Tanaka A., Horikoshi M., Ozato K., Padmanabhan B., Yokoyama S. J. Biol. Chem. 282:4193-4201(2007) [PubMed: 17148447] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 73-194, HOMODIMERIZATION, INTERACTION WITH E2F1 AND HISTONE H4, MUTAGENESIS OF GLN-78; 142-MET-GLN-143; TYR-153; ILE-154; GLU-170; LEU-174; VAL-177 AND GLN-182. |
| [16] | "Selective inhibition of BET bromodomains." Filippakopoulos P., Qi J., Picaud S., Shen Y., Smith W.B., Fedorov O., Morse E.M., Keates T., Hickman T.T., Felletar I., Philpott M., Munro S., McKeown M.R., Wang Y., Christie A.L., West N., Cameron M.J., Schwartz B. Bradner J.E.Nature 468:1067-1073(2010) [PubMed: 20871596] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.61 ANGSTROMS) OF 344-452. |
| [17] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLU-30; GLY-49; SER-49; PRO-212; PHE-238; GLN-260; VAL-474; GLY-558; THR-569; PRO-599 AND LEU-714. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X62083 mRNA. Translation: CAA43996.1. M80613 mRNA. Translation: AAA68890.1. Different initiation. X96670 Genomic DNA. Translation: CAA65450.1. D42040 mRNA. Translation: BAA07641.1. BX648109 mRNA. Translation: CAH56171.1. AL645941 Genomic DNA. Translation: CAI18110.1. AL662845 Genomic DNA. Translation: CAI17492.1. AL805913, AL935042 Genomic DNA. Translation: CAI18548.1. AL935042, AL805913 Genomic DNA. Translation: CAI18689.1. BX005422 Genomic DNA. Translation: CAM26115.1. BX908719, CR936909 Genomic DNA. Translation: CAQ09037.1. CR936909, BX908719 Genomic DNA. Translation: CAQ07147.1. Z96104 Genomic DNA. Translation: CAC69989.1. CH471081 Genomic DNA. Translation: EAX03663.1. BC063840 mRNA. Translation: AAH63840.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00014414. IPI00440502. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A56619. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001106653.1. NM_001113182.2. NP_001186384.1. NM_001199455.1. NP_001186385.1. NM_001199456.1. NP_005095.1. NM_005104.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.75243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P25440. Positions 73-186, 346-455, 637-714. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P25440. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 12230989. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000374825; ENSP00000363958; ENSG00000204256. ENST00000374831; ENSP00000363964; ENSG00000204256. ENST00000383108; ENSP00000372588; ENSG00000234507. ENST00000399528; ENSP00000382444; ENSG00000215077. ENST00000399529; ENSP00000382445; ENSG00000215077. ENST00000422217; ENSP00000411714; ENSG00000235307. ENST00000438194; ENSP00000401791; ENSG00000234507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 6046. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6046. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003ocn.2. human. uc010juh.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6046. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC06P032983. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:1103. BRD2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA042816. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 601540. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25414. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG004896. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | RPSQPKK. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4NZTT4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_BRD2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P25440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000204256. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001487. Bromodomain. IPR018359. Bromodomain_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.20.920.10. Bromodomain. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08871. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00439. Bromodomain. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00503. BROMODOMAIN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00297. BROMO. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47370. Bromodomain. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00633. BROMODOMAIN_1. 2 hits. PS50014. BROMODOMAIN_2. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 23557. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | BRD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P25440 Secondary accession number(s): B0S7P0 Q969U4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with