P25189 (MYP0_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 157.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myelin protein P0 Alternative name(s): Myelin peripheral protein Short name=MPP Myelin protein zero | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 248 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. |
| Subunit structure | Homodimer and homotetramer Probable. Ref.15 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Ref.11. Isoform L-MPZ: Myelin membrane; Single-pass type I membrane protein Ref.11. |
| Tissue specificity | Found only in peripheral nervous system Schwann cells. |
| Post-translational modification | N-glycosylated; contains sulfate-substituted glycan By similarity. |
| Involvement in disease | Charcot-Marie-Tooth disease 1B (CMT1B) [MIM:118200]: A dominant demyelinating form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Demyelinating neuropathies are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Charcot-Marie-Tooth disease 2I (CMT2I) [MIM:607677]: A dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. Charcot-Marie-Tooth disease 2J (CMT2J) [MIM:607736]: A dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. Charcot-Marie-Tooth disease type 2J is characterized by the association of axonal peripheral neuropathy with hearing loss and pupillary abnormalities such as Adie pupil. Adie pupil (ADIEP) [MIM:103100]: A stationary, benign disorder characterized by tonic, sluggishly reacting pupil and hypoactive or absent tendon reflexes. Adie pupil is a characteristic of Charcot-Marie-Tooth disease type 2J. Charcot-Marie-Tooth disease, dominant, intermediate type, D (CMTDID) [MIM:607791]: A form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. The dominant intermediate type D is characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec. Dejerine-Sottas syndrome (DSS) [MIM:145900]: A severe degenerating neuropathy of the demyelinating Charcot-Marie-Tooth disease category, with onset by age 2 years. Characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome. Congenital hypomyelination neuropathy (CHN) [MIM:605253]: A severe degenerating neuropathy, clinically characterized by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities (as low as 3m/s). Results from a congenital impairment in myelin formation. Inheritance can be autosomal dominant or recessive. Roussy-Levy syndrome (ROULS) [MIM:180800]: Autosomal dominant disorder that resembles Charcot-Marie-Tooth disease type 1 in that it presents with foot deformity, weakness and atrophy of distal limb muscles, especially the peronei, and absent tendon reflexes. The phenotype differs, however, in that it includes static tremor of the upper limbs and gait ataxia. |
| Sequence similarities | Belongs to the myelin P0 protein family. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence AAH06491.1 differs from that shown. Reason: Erroneous initiation. The sequence AAP35411.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA03540.1 differs from that shown. Reason: Erroneous initiation. The sequence BAG36330.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH70270.1 differs from that shown. Reason: Erroneous initiation. The sequence EAW52606.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Charcot-Marie-Tooth disease Deafness Dejerine-Sottas syndrome Disease mutation Neuropathy |
| Domain | Immunoglobulin domain Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell-cell junction maintenance Inferred from electronic annotation. Source: Compara synaptic transmissionTraceable author statement Ref.18. Source: ProtInc |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.20. Source: ProtInc myelin sheathInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | structural molecule activity Non-traceable author statement Ref.18. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P25189-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform L-MPZ (identifier: P25189-2) The sequence of this isoform differs from the canonical sequence as follows: 248-248: K → KRLAGRAGDRGLGVESAKGPKVMVIEMELRKDEQSPELRPAVKSPSRTSLKNALKNMMGLNSDK | ||||||
| Note: Based on a naturally occurring readthrough transcript. Highly antigenic. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | ||||||||||||||||||||||||||||||
| Chain | 30 – 248 | 219 | Myelin protein P0 | PRO_0000019300 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Topological domain | 30 – 153 | 124 | Extracellular Potential | |||||||||||||||||||||||||||||
| Transmembrane | 154 – 179 | 26 | Helical; Potential | |||||||||||||||||||||||||||||
| Topological domain | 180 – 248 | 69 | Cytoplasmic Potential | |||||||||||||||||||||||||||||
| Domain | 30 – 143 | 114 | Ig-like V-type | |||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||
| Modified residue | 210 | 1 | Phosphoserine; by PKC By similarity | |||||||||||||||||||||||||||||
| Modified residue | 216 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||
| Modified residue | 226 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||
| Modified residue | 228 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||
| Modified residue | 233 | 1 | Phosphoserine; by PKC By similarity | |||||||||||||||||||||||||||||
| Modified residue | 243 | 1 | Phosphoserine; by PKC By similarity | |||||||||||||||||||||||||||||
| Glycosylation | 122 | 1 | N-linked (GlcNAc...) (complex) By similarity | |||||||||||||||||||||||||||||
| Disulfide bond | 50 ↔ 127 | Ref.15 | ||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 248 | 1 | K → KRLAGRAGDRGLGVESAKGP KVMVIEMELRKDEQSPELRP AVKSPSRTSLKNALKNMMGL NSDK in isoform L-MPZ. | VSP_045844 | ||||||||||||||||||||||||||||
| Natural variant | 30 | 1 | I → M in CMT1B. Ref.16 | VAR_004500 | ||||||||||||||||||||||||||||
| Natural variant | 32 | 1 | V → F in CMT1B; severe. Ref.48 | VAR_004501 | ||||||||||||||||||||||||||||
| Natural variant | 34 | 1 | T → I in CMT1B. Ref.27 | VAR_004502 | ||||||||||||||||||||||||||||
| Natural variant | 35 | 1 | D → Y in CMTDID. Ref.42 Ref.59 | VAR_015971 | ||||||||||||||||||||||||||||
| Natural variant | 39 | 1 | H → P in CMT1B; slightly reduces intercellular adhesion; does not affect targeting to the cell membrane. Ref.64 Ref.70 | VAR_054393 | ||||||||||||||||||||||||||||
| Natural variant | 42 | 1 | Missing in DSS. Ref.52 | VAR_031884 | ||||||||||||||||||||||||||||
| Natural variant | 44 | 1 | S → F in CMT2I and CMT1B. Ref.37 Ref.64 | VAR_004503 | ||||||||||||||||||||||||||||
| Natural variant | 50 | 1 | Missing in CMT1B. Ref.64 | VAR_054394 | ||||||||||||||||||||||||||||
| Natural variant | 51 – 57 | 7 | Missing in CMT1B; affects targeting to the cell membrane; reduces intercellular adhesion. | VAR_054395 | ||||||||||||||||||||||||||||
| Natural variant | 51 | 1 | S → F in CMT1B. Ref.51 | VAR_029971 | ||||||||||||||||||||||||||||
| Natural variant | 54 | 1 | S → C in CMT1B; severe. | VAR_004504 | ||||||||||||||||||||||||||||
| Natural variant | 54 | 1 | S → P in CMT1B. Ref.40 | VAR_004505 | ||||||||||||||||||||||||||||
| Natural variant | 56 | 1 | E → K in CMT2. Ref.65 | VAR_054396 | ||||||||||||||||||||||||||||
| Natural variant | 58 | 1 | V → F in CMT1B; moderate. Ref.35 | VAR_004506 | ||||||||||||||||||||||||||||
| Natural variant | 60 | 1 | D → H in CMT2I. Ref.63 | VAR_029972 | ||||||||||||||||||||||||||||
| Natural variant | 61 | 1 | D → G in CMT2; unclassified. Ref.46 | VAR_031885 | ||||||||||||||||||||||||||||
| Natural variant | 62 | 1 | I → F in CMT1B. Ref.43 Ref.59 | VAR_015972 | ||||||||||||||||||||||||||||
| Natural variant | 62 | 1 | I → M in CMT2I. Ref.63 | VAR_029973 | ||||||||||||||||||||||||||||
| Natural variant | 63 | 1 | S → C in DSS. Ref.20 | VAR_004508 | ||||||||||||||||||||||||||||
| Natural variant | 63 | 1 | S → F in CMT1B. Ref.22 Ref.50 | VAR_004509 | ||||||||||||||||||||||||||||
| Natural variant | 63 | 1 | Missing in CMT1B. Ref.9 Ref.55 Ref.59 | VAR_004507 | ||||||||||||||||||||||||||||
| Natural variant | 64 | 1 | Missing in CMT1B and DSS. Ref.24 | VAR_004510 | ||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | T → A in CMT1B. Ref.72 | VAR_031886 | ||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | T → I in CMT1B. Ref.55 | VAR_029974 | ||||||||||||||||||||||||||||
| Natural variant | 68 | 1 | Y → C in CMT1B; severe/mild. Ref.35 Ref.48 Ref.55 Ref.59 | VAR_004511 | ||||||||||||||||||||||||||||
| Natural variant | 75 | 1 | D → V in CMT2J. Ref.49 Ref.55 Ref.59 | VAR_015973 | ||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | S → L in CMT1B; severe. Ref.21 Ref.23 Ref.30 Ref.36 Ref.45 Ref.51 Ref.54 Ref.60 | VAR_004512 | ||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | S → W in CMT1B. Ref.61 | VAR_031887 | ||||||||||||||||||||||||||||
| Natural variant | 81 | 1 | H → R in CMT1B; severe; reduces intercellular adhesion; does not affect targeting to the cell membrane. Ref.31 Ref.59 Ref.70 | VAR_004513 | ||||||||||||||||||||||||||||
| Natural variant | 81 | 1 | H → Y in CMT; associated with F-113. Ref.57 | VAR_031888 | ||||||||||||||||||||||||||||
| Natural variant | 82 | 1 | Y → C in CMT1B and DSS. Ref.17 Ref.36 Ref.54 Ref.55 | VAR_004514 | ||||||||||||||||||||||||||||
| Natural variant | 89 | 1 | I → N in CMT2I; patient carrying also Met-92 and Met-162. Ref.54 | VAR_015974 | ||||||||||||||||||||||||||||
| Natural variant | 90 | 1 | D → E in CMT1B. Ref.18 | VAR_004515 | ||||||||||||||||||||||||||||
| Natural variant | 92 | 1 | V → M in CMT2I; patient carrying also Asn-89 and Met-162. Ref.54 | VAR_015975 | ||||||||||||||||||||||||||||
| Natural variant | 93 | 1 | G → E in CMT1B. Ref.29 Ref.59 | VAR_004516 | ||||||||||||||||||||||||||||
| Natural variant | 96 | 1 | K → E in CMT1B. Ref.18 Ref.19 | VAR_004517 | ||||||||||||||||||||||||||||
| Natural variant | 97 | 1 | E → V in CMT2J. Ref.68 | VAR_029975 | ||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → C in CMT1B; severe and DSS. Ref.27 Ref.28 Ref.30 Ref.50 Ref.59 | VAR_004518 | ||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → H in CMT1B. Ref.2 Ref.27 Ref.47 Ref.51 Ref.56 Ref.64 | VAR_004519 | ||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → P in CMT1B. | VAR_004520 | ||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → S in CMT1B. Ref.28 | VAR_004521 | ||||||||||||||||||||||||||||
| Natural variant | 99 | 1 | I → T in CMT1B. | VAR_004522 | ||||||||||||||||||||||||||||
| Natural variant | 101 | 1 | W → C in CMT1B. Ref.23 | VAR_004523 | ||||||||||||||||||||||||||||
| Natural variant | 103 | 1 | G → E in CMT1B. Ref.53 | VAR_015976 | ||||||||||||||||||||||||||||
| Natural variant | 109 | 1 | D → N in CMT1B. Ref.44 | VAR_031889 | ||||||||||||||||||||||||||||
| Natural variant | 110 | 1 | G → D in DSS. Ref.60 | VAR_029976 | ||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | I → T in CMT1B; severe. Ref.35 | VAR_004524 | ||||||||||||||||||||||||||||
| Natural variant | 113 | 1 | V → F in CMT; unclassified; associated with Y-81. Ref.57 | VAR_031890 | ||||||||||||||||||||||||||||
| Natural variant | 113 | 1 | V → I in CMT2. Ref.55 | VAR_029977 | ||||||||||||||||||||||||||||
| Natural variant | 114 | 1 | I → T in DSS; associated on the same allele as His-116 and Asn-128 in one patient. Ref.32 | VAR_004525 | ||||||||||||||||||||||||||||
| Natural variant | 116 | 1 | N → H in DSS; associated on the same allele as Thr-114 and Asn-128 in one patient. Ref.32 | VAR_004526 | ||||||||||||||||||||||||||||
| Natural variant | 118 | 1 | D → DFY in DSS. | VAR_004527 | ||||||||||||||||||||||||||||
| Natural variant | 118 | 1 | D → N in CMT2I. Ref.66 | VAR_021609 | ||||||||||||||||||||||||||||
| Natural variant | 119 | 1 | Y → C in CMT2; unclassified. Ref.46 | VAR_031891 | ||||||||||||||||||||||||||||
| Natural variant | 122 | 1 | N → S in CMT1B; loss of glycosylation site. Ref.26 | VAR_004528 | ||||||||||||||||||||||||||||
| Natural variant | 123 | 1 | G → C in DSS and CMT1B. Ref.54 Ref.64 | VAR_015977 | ||||||||||||||||||||||||||||
| Natural variant | 124 – 125 | 2 | Missing in DSS. | VAR_004530 | ||||||||||||||||||||||||||||
| Natural variant | 124 | 1 | T → K in CHN. Ref.67 | VAR_029978 | ||||||||||||||||||||||||||||
| Natural variant | 124 | 1 | T → M in CMT1B and CMT2J; CMTJ2 patients present Adie pupil; slightly reduces intercellular adhesion; does not affect targeting to the cell membrane; affects glycosylation. Ref.34 Ref.39 Ref.41 Ref.48 Ref.49 Ref.50 Ref.55 Ref.59 Ref.70 Ref.71 Ref.73 | VAR_004529 | ||||||||||||||||||||||||||||
| Natural variant | 127 | 1 | C → Y in DSS. | VAR_004531 | ||||||||||||||||||||||||||||
| Natural variant | 128 | 1 | D → E in CMT1B. | VAR_004532 | ||||||||||||||||||||||||||||
| Natural variant | 128 | 1 | D → N in DSS; associated on the same allele as Thr-114 and His-116 in one patient. Ref.32 | VAR_004533 | ||||||||||||||||||||||||||||
| Natural variant | 130 | 1 | K → R in CMT1B and DSS. Ref.27 Ref.48 Ref.59 Ref.64 | VAR_004534 | ||||||||||||||||||||||||||||
| Natural variant | 131 | 1 | N → K in ROULS. Ref.38 | VAR_015978 | ||||||||||||||||||||||||||||
| Natural variant | 132 | 1 | P → L in CMT1B; moderate. Ref.35 | VAR_004535 | ||||||||||||||||||||||||||||
| Natural variant | 134 | 1 | D → E in CMT1B. Ref.10 Ref.47 | VAR_004536 | ||||||||||||||||||||||||||||
| Natural variant | 134 | 1 | D → G in CMT1B. Ref.47 | VAR_029979 | ||||||||||||||||||||||||||||
| Natural variant | 134 | 1 | D → N in CMT1B. Ref.21 | VAR_004537 | ||||||||||||||||||||||||||||
| Natural variant | 135 | 1 | I → L in CMT1B and DSS. Ref.27 | VAR_004538 | ||||||||||||||||||||||||||||
| Natural variant | 135 | 1 | I → T in CMT1B. Ref.25 Ref.47 | VAR_004539 | ||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | V → E in DSS. Ref.54 | VAR_015979 | ||||||||||||||||||||||||||||
| Natural variant | 137 | 1 | G → S in CMT1B. Ref.25 | VAR_004540 | ||||||||||||||||||||||||||||
| Natural variant | 138 | 1 | K → N in CMT1B. Ref.47 | VAR_029980 | ||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | T → N in CMT1B. Ref.47 | VAR_029981 | ||||||||||||||||||||||||||||
| Natural variant | 140 | 1 | S → T in CMT1B. Ref.58 Ref.64 | VAR_029982 | ||||||||||||||||||||||||||||
| Natural variant | 143 | 1 | T → M in CMT1B. | VAR_004541 | ||||||||||||||||||||||||||||
| Natural variant | 145 | 1 | Y → S in CMT1B. Ref.62 | VAR_029983 | ||||||||||||||||||||||||||||
| Natural variant | 146 | 1 | V → F in CMT1B. Ref.59 | VAR_029984 | ||||||||||||||||||||||||||||
| Natural variant | 162 | 1 | I → M in CMT2I; patient carrying also Asn-89 and Met-92. Ref.54 | VAR_015980 | ||||||||||||||||||||||||||||
| Natural variant | 163 | 1 | G → R in CMT1B. Ref.55 Ref.58 | VAR_004542 | ||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | G → A in CMT1B and DSS; severe. Ref.35 | VAR_004543 | ||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | G → R in DSS and CMT. Ref.20 Ref.59 | VAR_004544 | ||||||||||||||||||||||||||||
| Natural variant | 170 | 1 | L → R in CMT1B. Ref.55 | VAR_029985 | ||||||||||||||||||||||||||||
| Natural variant | 216 | 1 | T → ER in CMT1B; referred to as 'T216ER'. | VAR_029986 | ||||||||||||||||||||||||||||
| Natural variant | 221 | 1 | A → T in DSS. Ref.52 | VAR_031892 | ||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | D → Y in CMT1B; also in two asymptomatic individuals from the same family. Ref.69 | VAR_054397 | ||||||||||||||||||||||||||||
| Natural variant | 227 | 1 | R → S in CMT1B. Ref.64 | VAR_054398 | ||||||||||||||||||||||||||||
| Natural variant | 236 | 1 | K → E in CMT2I. Ref.66 | VAR_021610 | ||||||||||||||||||||||||||||
| Natural variant | 236 | 1 | Missing in CMT1B. Ref.58 | VAR_029987 | ||||||||||||||||||||||||||||
| Natural variant | 244 | 1 | R → L. | VAR_004545 | ||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 36 – 41 | 6 | ||||||||||||||||||||||||||||||
| Beta strand | 46 – 48 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 63 – 70 | 8 | ||||||||||||||||||||||||||||||
| Beta strand | 77 – 83 | 7 | ||||||||||||||||||||||||||||||
| Beta strand | 86 – 89 | 4 | ||||||||||||||||||||||||||||||
| Turn | 94 – 98 | 5 | ||||||||||||||||||||||||||||||
| Beta strand | 99 – 101 | 3 | ||||||||||||||||||||||||||||||
| Helix | 105 – 107 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 112 – 114 | 3 | ||||||||||||||||||||||||||||||
| Helix | 119 – 121 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 123 – 131 | 9 | ||||||||||||||||||||||||||||||
| Beta strand | 134 – 148 | 15 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and sequence determination of cDNA encoding the major structural protein of human peripheral myelin." Hayasaka K., Nanao K., Tahara M., Sato W., Takada G., Miura M., Uyemura K. Biochem. Biophys. Res. Commun. 180:515-518(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal spinal cord. |
| [2] | "Mutation of the myelin P0 gene in Charcot-Marie-Tooth neuropathy type 1." Hayasaka K., Ohnishi A., Takada G., Fukushima Y., Murai Y. Biochem. Biophys. Res. Commun. 194:1317-1322(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT CMT1B HIS-98. Tissue: Spinal cord. |
| [3] | "The major peripheral myelin protein zero gene: structure and localization in the cluster of Fc gamma receptor genes on human chromosome 1q21.3-q23." Pham-Dinh D., Fourbil Y., Blanquet F., Mattei M.-G., Roeckel N., Latour P., Chazot G., Vandenberghe A., Dautigny A. Hum. Mol. Genet. 2:2051-2054(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pericardium. |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [9] | "Deletion of the serine 34 codon from the major peripheral myelin protein P0 gene in Charcot-Marie-Tooth disease type 1B." Kulkens T., Bolhuis P.A., Wolterman R.A., Kemp S., Te Nijenhuis S., Valentijn L.J., Hensels G.W., Jennekens F.G., de Visser M., Hoogendijk J.E., Baas F. Nat. Genet. 5:35-39(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-115 (ISOFORM 1), VARIANT CMT1B SER-63 DEL. |
| [10] | "Linkage and mutation analysis in an extended family with Charcot-Marie-Tooth disease type 1B." Nelis E., Timmerman V., De Jonghe P., Muylle L., Martin J.-J., Van Broeckhoven C. J. Med. Genet. 31:811-815(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-248, VARIANT CMT1B GLU-134. |
| [11] | "L-MPZ, a novel isoform of myelin P0, is produced by stop codon readthrough." Yamaguchi Y., Hayashi A., Campagnoni C.W., Kimura A., Inuzuka T., Baba H. J. Biol. Chem. 287:17765-17776(2012) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE (ISOFORM L-MPZ), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION (ISOFORM L-MPZ). Tissue: PNS. |
| [12] | "Molecular genetics of Charcot-Marie-Tooth neuropathy." Roa B.B., Lupski J.R. Adv. Hum. Genet. 22:117-152(1994) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON CMT1B VARIANTS. |
| [13] | "Charcot-Marie-Tooth disease: a new paradigm for the mechanism of inherited disease." Patel P.I., Lupski J.R. Trends Genet. 10:128-133(1994) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON CMT1B VARIANTS. |
| [14] | "Mutations in the peripheral myelin genes and associated genes in inherited peripheral neuropathies." Nelis E., Haites N., van Broeckhoven C. Hum. Mutat. 13:11-28(1999) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON CMT1B AND DSS VARIANTS. |
| [15] | "Crystal structure of the extracellular domain of human myelin protein zero." Liu Z., Wang Y., Yedidi R.S., Brunzelle J.S., Kovari I.A., Sohi J., Kamholz J., Kovari L.C. Proteins 80:307-313(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 30-150, SUBUNIT, DISULFIDE BOND. |
| [16] | "Mutation of the myelin P0 gene in Charcot-Marie-Tooth neuropathy type 1B." Hayasaka K., Takada G., Ionasescu V.V. Hum. Mol. Genet. 2:1369-1372(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B MET-30. |
| [17] | "New mutation of the myelin P0 gene in a pedigree of Charcot-Marie-Tooth neuropathy 1." Himoro M., Yoshikawa H., Matsui T., Mitsui Y., Takahashi M., Kaido M., Nishimura T., Sawaishi Y., Takada G., Hayasaka K. Biochem. Mol. Biol. Int. 31:169-173(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B CYS-82. |
| [18] | "Charcot-Marie-Tooth neuropathy type 1B is associated with mutations of the myelin P0 gene." Hayasaka K., Himoro M., Sato W., Takada G., Uyemura K., Shimizu N., Bird T.D., Conneally P.M., Chance P.F. Nat. Genet. 5:31-34(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B GLU-90 AND GLU-96. |
| [19] | "Myelin protein zero gene mutated in Charcot-Marie-Tooth type 1B patients." Su Y., Brooks D.G., Li L., Lepercq J., Trofatter J.A., Ravetch J.V., Lebo R.V. Proc. Natl. Acad. Sci. U.S.A. 90:10856-10860(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B GLU-96 AND 216-THR DELINS GLU-ARG. |
| [20] | "De novo mutation of the myelin P0 gene in Dejerine-Sottas disease (hereditary motor and sensory neuropathy type III)." Hayasaka K., Himoro M., Sawaishi Y., Nanao K., Takahashi T., Takada G., Nicholson G.A., Ouvrier R.A., Tachi N. Nat. Genet. 5:266-268(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DSS CYS-63 AND ARG-167. |
| [21] | "Rapid screening of myelin genes in CMT1 patients by SSCP analysis: identification of new mutations and polymorphisms in the P0 gene." Nelis E., Timmerman V., de Jonghe P., Vandenberghe A., Pham-Dinh D., Dautigny A., Martin J.-J., van Broeckhoven C. Hum. Genet. 94:653-657(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B LEU-78 AND ASN-134. |
| [22] | "Charcot-Marie-Tooth type 1B neuropathy: third mutation of serine 63 codon in the major peripheral myelin glycoprotein PO gene." Blanquet-Grossard F., Pham-Dinh D., Dautigny A., Latour P., Bonnebouche C., Corbillon E., Chazot G., Vandenberghe A. Clin. Genet. 48:281-283(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B PHE-63. |
| [23] | "Mutations in the myelin protein zero gene associated with Charcot-Marie-Tooth disease type 1B." Latour P., Blanquet F., Nelis E., Bonnebouche C., Chapon F., Diraison P., Ollagnon E., Dautigny A., Pham-Dinh D., Chazot G., Boucherat M., van Broeckhoven C., Vandenberghe A. Hum. Mutat. 6:50-54(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B LEU-78 AND CYS-101. |
| [24] | "A novel homozygous mutation of the myelin Po gene producing Dejerine-Sottas disease (hereditary motor and sensory neuropathy type III)." Ikegami T., Nicholson G.A., Ikeda H., Ishida A., Johnston H., Wise G., Ouvrier R.A., Hayasaka K. Biochem. Biophys. Res. Commun. 222:107-110(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DSS PHE-64 DEL. |
| [25] | "Myelin protein zero (MPZ) gene mutations in nonduplication type 1 Charcot-Marie-Tooth disease." Roa B.B., Warner L.E., Garcia C.A., Russo D., Lovelace R., Chance P.F., Lupski J.R. Hum. Mutat. 7:36-45(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B THR-135 AND SER-137. |
| [26] | "Charcot-Marie-Tooth type 1B neuropathy: a mutation at the single glycosylation site in the major peripheral myelin glycoprotein Po." Blanquet-Grossard F., Pham-Dinh D., Dautigny A., Latour P., Bonnebouche C., Diraison P., Chapon F., Chazot G., Vandenberghe A. Hum. Mutat. 8:185-186(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B SER-122. |
| [27] | "Two divergent types of nerve pathology in patients with different P0 mutations in Charcot-Marie-Tooth disease." Gabreeels-Festen A.A.W.M., Hoogendijk J.E., Meijerink P.H., Gabreeels F.J.M., Bolhuis P.A., van Beersum S., Kulkens T., Nelis E., Jennekens F.G., de Visser M., van Engelen B.G., van Broeckhoven C., Mariman E.C. Neurology 47:761-765(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B/DSS ILE-34; CYS-98; HIS-98; ARG-130 AND LEU-135. |
| [28] | "Clinical phenotypes of different MPZ (P0) mutations may include Charcot-Marie-Tooth type 1B, Dejerine-Sottas, and congenital hypomyelination." Warner L.E., Hilz M.J., Appel S.H., Killian J.M., Kolodry E.H., Karpati G., Carpenter S., Watters G.V., Wheeler C., Witt D., Bodell A., Nelis E., van Broeckhoven C., Lupski J.R. Neuron 17:451-460(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B CYS-98 AND SER-98, VARIANT DSS CYS-98. |
| [29] | "Novel mutation of the myelin Po gene in a pedigree with Charcot-Marie-Tooth disease type 1B." Ikegami T., Ikeda H., Mitsui T., Hayasaka K., Ishii S. Am. J. Med. Genet. 71:246-248(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B GLU-93. |
| [30] | "Mutational analysis of the MPZ, PMP22 and Cx32 genes in patients of Spanish ancestry with Charcot-Marie-Tooth disease and hereditary neuropathy with liability to pressure palsies." Bort S., Nelis E., Timmerman V., Sevilla T., Cruz-Martinez A., Martinez F., Millan J.M., Arpa J., Vilchez J.J., Prieto F., van Broeckhoven C., Palau F. Hum. Genet. 99:746-754(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B LEU-78, VARIANT DSS CYS-98. |
| [31] | "Novel mutation of the myelin P0 gene in a CMT1B family." Sorour E., Macmillan J., Upadhyaya M. Hum. Mutat. 9:74-77(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B ARG-81. |
| [32] | "Multiple de novo MPZ (P0) point mutations in a sporadic Dejerine-Sottas case." Warner L.E., Shohat M., Shorer Z., Lupski J.R. Hum. Mutat. 10:21-24(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DSS THR-114; HIS-116 AND ASN-128. |
| [33] | "De novo mutation of the myelin P0 gene in Dejerine-Sottas disease (hereditary motor and sensory neuropathy type III): two amino acid insertion after Asp 118." Ikegami T., Nicholson G.A., Ikeda H., Ishida A., Johnston H., Wise G., Ouvrier R.A., Hayasaka K. Hum. Mutat. Suppl. 1:S103-S105(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DSS PHE-TYR-118 INS. |
| [34] | "Mutations of the same sequence of the myelin P0 gene causing two different phenotypes." Schiavon F., Rampazzo A., Merlini L., Angelini C., Mostacciuolo M.L. Hum. Mutat. Suppl. 1:S217-S219(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B MET-124, VARIANT DSS 124-THR-PHE-125 DEL. |
| [35] | "Mutation analysis in Charcot-Marie-Tooth disease type 1 (CMT1)." Sorour E., Upadhyaya M. Hum. Mutat. Suppl. 1:S242-S247(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B PHE-58; CYS-68; THR-112; LEU-132 AND ALA-167. |
| [36] | "Spectrum of mutations in Finnish patients with Charcot-Marie-Tooth disease and related neuropathies." Silander K., Meretoja P., Juvonen V., Ignatius J., Pihko H., Saarinen A., Wallden T., Herrgaard E., Aula P., Savontaus M.-L. Hum. Mutat. 12:59-68(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B LEU-78, VARIANT DSS CYS-82. |
| [37] | "Charcot-Marie-Tooth disease type 2 associated with mutation of the myelin protein zero gene." Marrosu M.G., Vaccargiu S., Marrosu G., Vannelli A., Cianchetti C., Muntoni F. Neurology 50:1397-1401(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2I PHE-44. |
| [38] | "The Roussy-Levy family: from the original description to the gene." Plante-Bordeneuve V., Guiochon-Mantel A., Lacroix C., Lapresle J., Said G. Ann. Neurol. 46:770-773(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ROULS LYS-131. |
| [39] | "The Thr124Met mutation in the peripheral myelin protein zero (MPZ) gene is associated with a clinically distinct Charcot-Marie-Tooth phenotype." De Jonghe P., Timmerman V., Ceuterick C., Nelis E., De Vriendt E., Lofgren A., Vercruyssen A., Verellen C., Van Maldergem L., Martin J.-J., Van Broeckhoven C. Brain 122:281-290(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2J MET-124. |
| [40] | "Novel mutations of the myelin P0 gene in two Charcot-Marie-Tooth type 1 patients from Turkey." Bissar-Tadmouri N., Latour P., Gulsen-Parman Y., Deymeer F., Serdaroglu P., Ozdemir C., Vandenberghe A. Eur. J. Hum. Genet. Suppl. 7:116-116(1999) Cited for: VARIANT CMT1B PRO-54. |
| [41] | "Axonal phenotype of Charcot-Marie-Tooth disease associated with a mutation in the myelin protein zero gene." Chapon F., Latour P., Diraison P., Schaeffer S., Vandenberghe A. J. Neurol. Neurosurg. Psych. 66:779-782(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2 MET-124. |
| [42] | "Novel mutation in the myelin protein zero gene in a family with intermediate hereditary motor and sensory neuropathy." Mastaglia F.L., Nowak K.J., Stell R., Phillips B.A., Edmondston J.E., Dorosz S.M., Wilton S.D., Hallmayer J., Kakulas B.A., Laing N.G. J. Neurol. Neurosurg. Psych. 67:174-179(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMTDID TYR-35. |
| [43] | "A novel MPZ gene mutation in dominantly inherited neuropathy with focally folded myelin sheaths." Nakagawa M., Suehara M., Saito A., Takashima H., Umehara F., Saito M., Kanzato N., Matsuzaki T., Takenaga S., Sakoda S., Izumo S., Osame M. Neurology 52:1271-1275(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B PHE-62. |
| [44] | "Peripheral myelin modification in CMT1B correlates with MPZ gene mutations." Lagueny A., Latour P., Vital A., Rajabally Y., Le Masson G., Ferrer X., Bernard I., Julien J., Vital C., Vandenberghe A. Neuromuscul. Disord. 9:361-367(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B ASN-109. |
| [45] | "Focally folded myelin in Charcot-Marie-Tooth neuropathy type 1B with Ser49Leu in the myelin protein zero." Fabrizi G.M., Taioli F., Cavallaro T., Rigatelli F., Simonati A., Mariani G., Perrone P., Rizzuto N. Acta Neuropathol. 100:299-304(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B LEU-78. |
| [46] | "Charcot-Marie-Tooth neuropathy type 2 and P0 point mutations: two novel amino acid substitutions (Asp61Gly; Tyr119Cys) and a possible 'hotspot' on Thr124Met." Senderek J., Hermanns B., Lehmann U., Bergmann C., Marx G., Kabus C., Timmerman V., Stoltenburg-Didinger G., Schroder J.M. Brain Pathol. 10:235-248(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT2 GLY-61 AND CYS-119. |
| [47] | "Screening for mutations in the peripheral myelin genes PMP22, MPZ and Cx32 (GJB1) in Russian Charcot-Marie-Tooth neuropathy patients." Mersiyanova I.V., Ismailov S.M., Polyakov A.V., Dadali E.L., Fedotov V.P., Nelis E., Loefgren A., Timmerman V., Van Broeckhoven C., Evgrafov O.V. Hum. Mutat. 15:340-347(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B HIS-98; GLY-134; GLU-134; THR-135; ASN-138 AND ASN-139. |
| [48] | "Mutations in the peripheral myelin protein zero and connexin32 genes detected by non-isotopic RNase cleavage assay and their phenotypes in Japanese patients with Charcot-Marie-Tooth disease." Yoshihara T., Yamamoto M., Doyu M., Misu K., Hattori N., Hasegawa Y., Mokuno K., Mitsuma T., Sobue G. Hum. Mutat. 16:177-178(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT PHE-32; CYS-68; MET-124 AND ARG-130. |
| [49] | "An axonal form of Charcot-Marie-Tooth disease showing distinctive features in association with mutations in the peripheral myelin protein zero gene (Thr124Met or Asp75Val)." Misu K., Yoshihara T., Shikama Y., Awaki E., Yamamoto M., Hattori N., Hirayama M., Takegami T., Nakashima K., Sobue G. J. Neurol. Neurosurg. Psych. 69:806-811(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT2J VAL-75 AND MET-124. |
| [50] | "Charcot-Marie-Tooth disease type I and related demyelinating neuropathies: mutation analysis in a large cohort of Italian families." Mostacciuolo M.L., Righetti E., Zortea M., Bosello V., Schiavon F., Vallo L., Merlini L., Siciliano G., Fabrizi G.M., Rizzuto N., Milani M., Baratta S., Taroni F. Hum. Mutat. 18:32-41(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B PHE-63 AND MET-124, VARIANTS DSS CYS-98 AND 124-THR-PHE-125 DEL. |
| [51] | "Mutation analysis in Chariot-Marie Tooth disease type 1: point mutations in the MPZ gene and the GJB1 gene cause comparable phenotypic heterogeneity." Young P., Grote K., Kuhlenbaeumer G., Debus O., Kurlemann H., Halfter H., Funke H., Ringelstein E.B., Stoegbauer F. J. Neurol. 248:410-415(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B PHE-51; LEU-78 AND HIS-98. |
| [52] | "The range of chronic demyelinating neuropathy of infancy: a clinico-pathological and genetic study of 15 unrelated cases." Plante-Bordeneuve V., Parman Y., Guiochon-Mantel A., Alj Y., Deymeer F., Serdaroglu P., Eraksoy M., Said G. J. Neurol. 248:795-803(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DSS VAL-42 DEL AND THR-221. |
| [53] | "A somatic and germline mosaic mutation in MPZ/P(0) mimics recessive inheritance of CMT1B." Fabrizi G.M., Ferrarini M., Cavallaro T., Jarre L., Polo A., Rizzuto N. Neurology 57:101-105(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B GLU-103. |
| [54] | "Charcot-Marie-Tooth disease and related neuropathies: mutation distribution and genotype-phenotype correlation." Boerkoel C.F., Takashima H., Garcia C.A., Olney R.K., Johnson J., Berry K., Russo P., Kennedy S., Teebi A.S., Scavina M., Williams L.L., Mancias P., Butler I.J., Krajewski K., Shy M., Lupski J.R. Ann. Neurol. 51:190-201(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B LEU-78 AND CYS-82, VARIANTS CMT2I ASN-89; MET-92 AND MET-162, VARIANTS DSS CYS-123 AND GLU-136. |
| [55] | "Molecular analysis in Japanese patients with Charcot-Marie-Tooth disease: DGGE analysis for PMP22, MPZ, and Cx32/GJB1 mutations." Numakura C., Lin C., Ikegami T., Guldberg P., Hayasaka K. Hum. Mutat. 20:392-398(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B SER-63 DEL; ILE-65; CYS-68; CYS-82; MET-124; ARG-163 AND ARG-170, VARIANTS CMT2 VAL-75 AND ILE-113. |
| [56] | "Corticosteroid-responsive asymmetric neuropathy with a myelin protein zero gene mutation." Watanabe M., Yamamoto N., Ohkoshi N., Nagata H., Kohno Y., Hayashi A., Tamaoka A., Shoji S. Neurology 59:767-769(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B HIS-98. |
| [57] | "Two amino-acid substitutions in the myelin protein zero gene of a case of Charcot-Marie-Tooth disease associated with light-near dissociation." Bienfait H.M.E., Baas F., Gabreeels-Festen A.A.W.M., Koelman J.H.T.M., Langerhorst C.T., de Visser M. Neuromuscul. Disord. 12:281-285(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT TYR-81 AND PHE-113. |
| [58] | "Charcot-Marie-Tooth neuropathy: clinical phenotypes of four novel mutations in the MPZ and Cx 32 genes." Street V.A., Meekins G., Lipe H.P., Seltzer W.K., Carter G.T., Kraft G.H., Bird T.D. Neuromuscul. Disord. 12:643-650(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B THR-140; ARG-163 AND LYS-236 DEL. |
| [59] | "Demyelinating and axonal features of Charcot-Marie-Tooth disease with mutations of myelin-related proteins (PMP22, MPZ and Cx32): a clinicopathological study of 205 Japanese patients." The study group for hereditary neuropathy in Japan Hattori N., Yamamoto M., Yoshihara T., Koike H., Nakagawa M., Yoshikawa H., Ohnishi A., Hayasaka K., Onodera O., Baba M., Yasuda H., Saito T., Nakashima K., Kira J., Kaji R., Oka N., Sobue G. Brain 126:134-151(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT TYR-35; PHE-62; SER-63 DEL; CYS-68; VAL-75; ARG-81; GLU-93; CYS-98; MET-124; ARG-130; PHE-146 AND ARG-167. |
| [60] | "Novel mutations in the Charcot-Marie-Tooth disease genes PMP22, MPZ, and GJB1." Huehne K., Benes V., Thiel C., Kraus C., Kress W., Hoeltzenbein M., Ploner C.J., Kotzian J., Reis A., Rott H.D., Rautenstrauss B.W. Hum. Mutat. 21:100-100(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B LEU-78, VARIANT DSS ASP-110. |
| [61] | "Clinical and genetic analysis of CMT1B in a Nigerian family." Kakar R., Ma W., Dutra A., Seltzer W.K., Grewal R.P. Muscle Nerve 27:628-630(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B TRP-78. |
| [62] | "Charcot-Marie-Tooth disease: a novel Tyr145Ser mutation in the myelin protein zero (MPZ, P0) gene causes different phenotypes in homozygous and heterozygous carriers within one family." Leal A., Berghoff C., Berghoff M., Del Valle G., Contreras C., Montoya O., Hernandez E., Barrantes R., Schloetzer-Schrehardt U., Neundoerfer B., Reis A., Rautenstrauss B., Heuss D. Neurogenetics 4:191-197(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B SER-145. |
| [63] | "Late onset Charcot-Marie-Tooth 2 syndrome caused by two novel mutations in the MPZ gene." Auer-Grumbach M., Strasser-Fuchs S., Robl T., Windpassinger C., Wagner K. Neurology 61:1435-1437(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT2I HIS-60 AND MET-62. |
| [64] | "Phenotypic clustering in MPZ mutations." Shy M.E., Jani A., Krajewski K., Grandis M., Lewis R.A., Li J., Shy R.R., Balsamo J., Lilien J., Garbern J.Y., Kamholz J. Brain 127:371-384(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1B PRO-39; PHE-44; CYS-50 DEL; HIS-98; CYS-123; ARG-130; THR-140 AND SER-227. |
| [65] | "An axonal form of Charcot-Marie-Tooth disease with a novel missense mutation in the myelin protein zero gene." Kochanski A., Kabzinska D., Nowakowski A., Drac H., Hausmanowa-Petrusewicz I. J. Peripher. Nerv. Syst. 9:1-2(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2 LYS-56. |
| [66] | "Mutational analysis of PMP22, MPZ, GJB1, EGR2 and NEFL in Korean Charcot-Marie-Tooth neuropathy patients." Choi B.-O., Lee M.S., Shin S.H., Hwang J.H., Choi K.-G., Kim W.-K., Sunwoo I.N., Kim N.K., Chung K.W. Hum. Mutat. 24:185-186(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT2I ASN-118 AND GLU-236. |
| [67] | "A novel MPZ gene mutation in congenital neuropathy with hypomyelination." Kochanski A., Drac H., Kabzinska D., Ryniewicz B., Rowinska-Marcinska K., Nowakowski A., Hausmanowa-Petrusewicz I. Neurology 62:2122-2123(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CHN LYS-124. |
| [68] | "Hearing loss as the first feature of late-onset axonal CMT disease due to a novel P0 mutation." Seeman P., Mazanec R., Huehne K., Suslikova P., Keller O., Rautenstrauss B. Neurology 63:733-735(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2J VAL-97. |
| [69] | "Gene dosage sensitivity of a novel mutation in the intracellular domain of P0 associated with Charcot-Marie-Tooth disease type 1B." Fabrizi G.M., Pellegrini M., Angiari C., Cavallaro T., Morini A., Taioli F., Cabrini I., Orrico D., Rizzuto N. Neuromuscul. Disord. 16:183-187(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B TYR-224. |
| [70] | "Different cellular and molecular mechanisms for early and late-onset myelin protein zero mutations." Grandis M., Vigo T., Passalacqua M., Jain M., Scazzola S., La Padula V., Brucal M., Benvenuto F., Nobbio L., Cadoni A., Mancardi G.L., Kamholz J., Shy M.E., Schenone A. Hum. Mol. Genet. 17:1877-1889(2008) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS CMT1B 51-SER--TRP-57 DEL; PRO-39; ARG-81 AND MET-124. |
| [71] | "Chronic cough due to Thr124Met mutation in the peripheral myelin protein zero (MPZ gene)." Baloh R.H., Jen J.C., Kim G., Baloh R.W. Neurology 62:1905-1906(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2 MET-124. |
| [72] | "A novel mutation, Thr65Ala, in the MPZ gene in a patient with Charcot-Marie-Tooth type 1B disease with focally folded myelin." Kochanski A., Drac H., Kabzinska D., Hausmanowa-Petrusewicz I. Neuromuscul. Disord. 14:229-232(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1B ALA-65. |
| [73] | "Case records of the Massachusetts General Hospital. Case 18-2006. A 57-year-old woman with numbness and weakness of the feet and legs." Triggs W.J., Brown R.H. Jr., Menkes D.L. N. Engl. J. Med. 354:2584-2592(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2J MET-124, INVOLVEMENT IN ADIE PUPIL. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D10537 mRNA. Translation: BAA01395.1. D14720 Genomic DNA. Translation: BAA03540.1. Different initiation. L24893, L24894 Genomic DNA. Translation: AAA20656.1. AK313555 mRNA. Translation: BAG36330.1. Different initiation. BT006765 mRNA. Translation: AAP35411.1. Different initiation. AL592295 Genomic DNA. Translation: CAH70270.1. Different initiation. CH471121 Genomic DNA. Translation: EAW52606.1. Different initiation. BC006491 mRNA. Translation: AAH06491.1. Different initiation. S66705 mRNA. Translation: AAB28708.1. U10018, U10017 Genomic DNA. Translation: AAA18981.1. | ||||||||||||||||||
| IPI | IPI00478921. | ||||||||||||||||||
| PIR | JH0252. | ||||||||||||||||||
| RefSeq | NP_000521.2. NM_000530.6. | ||||||||||||||||||
| UniGene | Hs.591486. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P25189. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P25189. 3 interactions. | ||||||||||||||||||
| MINT | MINT-1390651. | ||||||||||||||||||
| STRING | 9606.ENSP00000353634. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P25189. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 127721. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P25189. | ||||||||||||||||||
| PRIDE | P25189. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 4359. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000360451; ENSP00000353634; ENSG00000158887. ENST00000463290; ENSP00000431538; ENSG00000158887. ENST00000533357; ENSP00000432943; ENSG00000158887. | ||||||||||||||||||
| GeneID | 4359. | ||||||||||||||||||
| KEGG | hsa:4359. | ||||||||||||||||||
| UCSC | uc001gaf.4. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 4359. | ||||||||||||||||||
| GeneCards | GC01M161274. | ||||||||||||||||||
| HGNC | HGNC:7225. MPZ. | ||||||||||||||||||
| MIM | 103100. phenotype. 118200. phenotype. 145900. phenotype. 159440. gene. 180800. phenotype. 605253. phenotype. 607677. phenotype. 607736. phenotype. 607791. phenotype. | ||||||||||||||||||
| neXtProt | NX_P25189. | ||||||||||||||||||
| Orphanet | 99942. Autosomal dominant Charcot-Marie-Tooth disease type 2I. 99943. Autosomal dominant Charcot-Marie-Tooth disease type 2J. 100046. Autosomal dominant intermediate Charcot-Marie-Tooth disease type D. 101082. Charcot-Marie-Tooth disease type 1B. 64748. Dejerine-Sottas syndrome. 3115. Roussy-Levy syndrome. | ||||||||||||||||||
| PharmGKB | PA30930. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG47065. | ||||||||||||||||||
| HOGENOM | HOG000232144. | ||||||||||||||||||
| HOVERGEN | HBG096384. | ||||||||||||||||||
| InParanoid | P25189. | ||||||||||||||||||
| KO | K06770. | ||||||||||||||||||
| OrthoDB | EOG4GTKFB. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P25189. | ||||||||||||||||||
| Bgee | P25189. | ||||||||||||||||||
| CleanEx | HS_MPZ. | ||||||||||||||||||
| Genevestigator | P25189. | ||||||||||||||||||
| GermOnline | ENSG00000158887. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 2.60.40.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013106. Ig_V-set. IPR003596. Ig_V-set_subgr. IPR019566. Myelin-PO_C. IPR000920. Myelin_P0. IPR019738. Myelin_P0_CS. [Graphical view] | ||||||||||||||||||
| Pfam | PF10570. Myelin-PO_C. 1 hit. PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00213. MYELINP0. | ||||||||||||||||||
| SMART | SM00406. IGv. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. PS00568. MYELIN_P0. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| GenomeRNAi | 4359. | ||||||||||||||||||
| NextBio | 17155. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | MYP0_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P25189 Secondary accession number(s): Q16072 Q9BR67 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
