P25123 (GBRB_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Gamma-aminobutyric acid receptor subunit beta Alternative name(s): GABA(A) receptor subunit beta Protein cyclodiene resistance | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 606 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | GABA, an inhibitory neurotransmitter, mediates neuronal inhibition by binding to the GABA receptor and opening an integral chloride channel. |
| Subcellular location | Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
| Miscellaneous | Resistance is thought to be due to insensitivity of the cyclodiene/picrotoxinin binding site on the GABA(A) receptor-chloride ionophore complex. |
| Sequence similarities | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. [View classification] |
| RNA editing | Edited at positions 122, 283, 294 and 360. |
| Sequence caution | The sequence AAK92842.1 differs from that shown. Reason: Frameshift at position 448. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform C (identifier: P25123-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P25123-2) The sequence of this isoform differs from the canonical sequence as follows: 97-101: VSEVL → LSEVK 216-248: FWRDGLSSVGMSSEVELPQFRVLGHRQRATEIN → KWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEIS | ||||||
| Isoform B (identifier: P25123-3) The sequence of this isoform differs from the canonical sequence as follows: 97-101: VSEVL → LSEVK 449-470: SNRPIGFSNIQQNVGTRGCSIV → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 44 | 44 | Potential | ||||||||
| Chain | 45 – 606 | 562 | Gamma-aminobutyric acid receptor subunit beta | PRO_0000000452 | |||||||
Regions | |||||||||||
| Topological domain | 45 – 268 | 224 | Extracellular Potential | ||||||||
| Transmembrane | 269 – 291 | 23 | Helical; Potential | ||||||||
| Transmembrane | 297 – 316 | 20 | Helical; Potential | ||||||||
| Transmembrane | 333 – 356 | 24 | Helical; Potential | ||||||||
| Topological domain | 357 – 568 | 212 | Cytoplasmic Potential | ||||||||
| Transmembrane | 569 – 590 | 22 | Helical; Potential | ||||||||
| Compositional bias | 499 – 535 | 37 | Gly-rich | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 253 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 185 ↔ 199 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 97 – 101 | 5 | VSEVL → LSEVK in isoform A and isoform B. | VSP_018587 | |||||||
| Alternative sequence | 216 – 248 | 33 | FWRDG…ATEIN → KWNEGPNSVGVSSEVSLPQF KVLGHRQRAMEIS in isoform A. | VSP_018588 | |||||||
| Alternative sequence | 449 – 470 | 22 | SNRPI…GCSIV → M in isoform B. | VSP_018589 | |||||||
| Natural variant | 122 | 1 | R → G in RNA edited version. | ||||||||
| Natural variant | 283 | 1 | I → V in RNA edited version. | ||||||||
| Natural variant | 294 | 1 | N → D in RNA edited version. | ||||||||
| Natural variant | 360 | 1 | M → V in RNA edited version. | ||||||||
Experimental info | |||||||||||
| Sequence conflict | 38 | 1 | H → N in AAA19249. Ref.2 | ||||||||
| Sequence conflict | 68 | 1 | V → I in AAA19249. Ref.2 | ||||||||
| Sequence conflict | 428 | 1 | G → R in AAA19249. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and transformation of cyclodiene resistance in Drosophila: an invertebrate gamma-aminobutyric acid subtype A receptor locus." ffrench-Constant R.H., Mortlock D.P., Shaffer C.D., Macintyre R.J., Roush R.T. Proc. Natl. Acad. Sci. U.S.A. 88:7209-7213(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), RNA EDITING OF POSITION 283. Tissue: Embryo. |
| [2] | "Cloning and functional expression of a Drosophila gamma-aminobutyric acid receptor." Chen R., Belelli D., Reyes A., Lambert J.J., Peters J.A., Lan N.C. Proc. Natl. Acad. Sci. U.S.A. 91:6069-6073(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), RNA EDITING OF POSITIONS 122; 283 AND 360. Tissue: Head. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), RNA EDITING OF POSITION 283. Strain: Berkeley. Tissue: Head. |
| [6] | "Drosophila gamma-aminobutyric acid receptor gene Rdl shows extensive alternative splicing." ffrench-Constant R.H., Rocheleau T.A. J. Neurochem. 60:2323-2326(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 70-113 (ISOFORMS A/B). |
| [7] | "Nervous system targets of RNA editing identified by comparative genomics." Hoopengardner B., Bhalla T., Staber C., Reenan R. Science 301:832-836(2003) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M69057 mRNA. Translation: AAA28556.1. M69057 mRNA. Translation: AAA28557.1. Sequence problems. M69057 mRNA. Translation: AAA28558.1. Sequence problems. U02042 mRNA. Translation: AAA19249.1. AE014296 Genomic DNA. Translation: AAF50311.1. AE014296 Genomic DNA. Translation: AAN11988.1. AE014296 Genomic DNA. Translation: AAN11989.1. AY051418 mRNA. Translation: AAK92842.1. Frameshift. S61113 mRNA. Translation: AAB26669.1. |
| PIR | A41145. |
| RefSeq | NP_001261616.1. NM_001274687.1. NP_523991.2. NM_079267.4. NP_729461.1. NM_168321.3. NP_729462.2. NM_168322.3. |
3D structure databases | |
| ProteinModelPortal | P25123. |
| SMR | P25123. Positions 66-386. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | P25123. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0076536; FBpp0076263; FBgn0004244. |
| GeneID | 39054. |
| KEGG | dme:Dmel_CG10537. |
Organism-specific databases | |
| CTD | 39054. |
| FlyBase | FBgn0004244. Rdl. |
Phylogenomic databases | |
| eggNOG | NOG265706. |
| GeneTree | ENSGT00630000089685. |
| InParanoid | P25123. |
| KO | K05195. |
| OMA | GGMFGDV. |
| OrthoDB | EOG44B8HM. |
| PhylomeDB | P25123. |
Gene expression databases | |
| Bgee | P25123. |
| GermOnline | CG10537. Drosophila melanogaster. |
Family and domain databases | |
| Gene3D | 2.70.170.10. 1 hit. |
| InterPro | IPR006028. GABAA_rcpt. IPR002289. GABAAb_rcpt. IPR006202. Neur_chan_lig-bd. IPR006201. Neur_channel. IPR006029. Neurotrans-gated_channel_TM. IPR018000. Neurotransmitter_ion_chnl_CS. [Graphical view] |
| PANTHER | PTHR18945. PTHR18945. 1 hit. |
| Pfam | PF02931. Neur_chan_LBD. 1 hit. PF02932. Neur_chan_memb. 1 hit. [Graphical view] |
| PRINTS | PR01160. GABAARBETA. PR00253. GABAARECEPTR. PR00252. NRIONCHANNEL. |
| SUPFAM | SSF90112. Neu_channel_TM. 1 hit. SSF63712. Neur_chan_LBD. 1 hit. |
| TIGRFAMs | TIGR00860. LIC. 1 hit. |
| PROSITE | PS00236. NEUROTR_ION_CHANNEL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | Rdl. drosophila. |
| GenomeRNAi | 39054. |
| NextBio | 811688. |
Entry information
| Entry name | GBRB_DROME | ||||||||
| Accession | Primary (citable) accession number: P25123 Secondary accession number(s): P92138 Q9VSV0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
