Reviewed,
UniProtKB/Swiss-Prot P24666 (PPAC_HUMAN)
Last modified
June 16, 2009.
Version 109.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Low molecular weight phosphotyrosine protein phosphatase Short name=LMW-PTPase Short name=LMW-PTP EC=3.1.3.48 Alternative name(s): Low molecular weight cytosolic acid phosphatase EC=3.1.3.2 Red cell acid phosphatase 1 Adipocyte acid phosphatase | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphate monoester + H2O = an alcohol + phosphate. |
| Enzyme regulation | Inhibited by sulfhydryl reagents. |
| Subunit structure | Isoform 1 interacts with the SH3 domain of SPTAN1. There is no interaction observed for isoforms 2 or 3. Ref.15 |
| Subcellular location | |
| Tissue specificity | |
| Polymorphism | ACP1 is genetically polymorphic. Three common alleles are known in Caucasians: ACP1*A, ACP1*B and ACP1*C. They give rise to six different phenotypes. Each allele appears to encode two electrophoretically different isozymes, F and S, which are produced in allele-specific ratios. The sequence shown is that of allele ACP1*B and allele ACP1*C. |
| Sequence similarities | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | protein amino acid dephosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell soluble fraction Ref.3Traceable author statement. Source: ProtInc |
| Molecular function | acid phosphatase activity Ref.3 Traceable author statement. Source: ProtInc identical protein bindingInferred from physical interaction. Source: IntAct non-membrane spanning protein tyrosine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: The ratio of isoform 1 to isoform 2 is 2:1 in allele A, 4:1 in allele B and 1:4 in allele C. | ||||||
| Isoform 1 (identifier: P24666-1) Also known as: F; A; Alpha; LMPTP-A; HCPTP-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P24666-2) Also known as: S; B; Beta; LMPTP-B; HCPTP-B; The sequence of this isoform differs from the canonical sequence as follows: 41-74: RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV → VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK | ||||||
| Isoform 3 (identifier: P24666-3) Also known as: C; LMPTP-C; The sequence of this isoform differs from the canonical sequence as follows: 41-74: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | |||||||||||||||||||||||||
| Chain | 2 – 158 | 157 | Low molecular weight phosphotyrosine protein phosphatase | PRO_0000046558 | ||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||
| Active site | 13 | 1 | Nucleophile By similarity | |||||||||||||||||||||||||
| Active site | 19 | 1 | By similarity | |||||||||||||||||||||||||
| Active site | 130 | 1 | Proton donor By similarity | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.1 | |||||||||||||||||||||||||
| Modified residue | 132 | 1 | Phosphotyrosine Ref.6 Ref.16 Ref.17 | |||||||||||||||||||||||||
| Modified residue | 133 | 1 | Phosphotyrosine Ref.6 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 41 – 74 | 34 | RVDSA…PMSHV → VIDSGAVSDWNVGRSPDPRA VSCLRNHGIHTAHK in isoform 2. | VSP_010087 | ||||||||||||||||||||||||
| Alternative sequence | 41 – 74 | 34 | Missing in isoform 3. | VSP_010088 | ||||||||||||||||||||||||
| Natural variant | 7 | 1 | K → N: dbSNP rs11691572. | VAR_050526 | ||||||||||||||||||||||||
| Natural variant | 106 | 1 | Q → R in allele ACP1*A. Ref.12 | VAR_006171 | ||||||||||||||||||||||||
| Natural variant | 137 | 1 | S → F: dbSNP rs35569198. | VAR_050527 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Mutagenesis | 13 | 1 | C → S: Inactive. Ref.6 | |||||||||||||||||||||||||
| Mutagenesis | 132 | 1 | Y → F: Reduced phosphorylation and activity. Ref.6 | |||||||||||||||||||||||||
| Mutagenesis | 133 | 1 | Y → F: Reduced phosphorylation. No effect on activity. Ref.6 | |||||||||||||||||||||||||
| Sequence conflict | 2 – 6 | 5 | AEQAT → PRRGR in AAB27086. Ref.5 | |||||||||||||||||||||||||
| Sequence conflict | 13 – 20 | 8 | CLGNICRS → PARREAAR in AAB27085. Ref.5 | |||||||||||||||||||||||||
| Sequence conflict | 32 | 1 | T → W Ref.1 | |||||||||||||||||||||||||
| Sequence conflict | 32 | 1 | T → W Ref.2 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Beta strand | 7 – 18 | 12 | ||||||||||||||||||||||||||
| Helix | 19 – 33 | 15 | ||||||||||||||||||||||||||
| Helix | 37 – 39 | 3 | ||||||||||||||||||||||||||
| Beta strand | 40 – 49 | 10 | ||||||||||||||||||||||||||
| Turn | 50 – 53 | 4 | ||||||||||||||||||||||||||
| Helix | 58 – 66 | 9 | ||||||||||||||||||||||||||
| Helix | 80 – 85 | 6 | ||||||||||||||||||||||||||
| Beta strand | 87 – 93 | 7 | ||||||||||||||||||||||||||
| Helix | 94 – 105 | 12 | ||||||||||||||||||||||||||
| Beta strand | 113 – 116 | 4 | ||||||||||||||||||||||||||
| Helix | 117 – 120 | 4 | ||||||||||||||||||||||||||
| Helix | 136 – 156 | 21 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human red cell acid phosphatase (ACP1). The amino acid sequence of the two isozymes Bf and Bs encoded by the ACP1*B allele." Dissing J., Johnsen A.H., Sensabaugh G.F. J. Biol. Chem. 266:20619-20625(1991) [PubMed: 1939112] [Abstract] Cited for: PROTEIN SEQUENCE (ALLELE B; ISOFORMS 1 AND 2). |
| [2] | "Human red cell acid phosphatase (ACP1): the primary structure of the two pairs of isozymes encoded by the ACP1*A and ACP1*C alleles." Dissing J., Johnsen A.H. Biochim. Biophys. Acta 1121:261-268(1992) [PubMed: 1627603] [Abstract] Cited for: PROTEIN SEQUENCE (ALLELES A AND C; ISOFORMS 1 AND 2). |
| [3] | "Sequencing, cloning, and expression of human red cell-type acid phosphatase, a cytoplasmic phosphotyrosyl protein phosphatase." Wo Y.-Y.P., McCormack A.L., Shabonowitz J., Hunt D.F., Davis J.P., Mitchell G.L., van Etten R.L. J. Biol. Chem. 267:10856-10865(1992) [PubMed: 1587862] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [4] | "Gene structure, sequence, and chromosomal localization of the human red cell-type low-molecular-weight acid phosphotyrosyl phosphatase gene, ACP1." Bryson G.L.M., Massa H., Trask B.J., van Etten R.L. Genomics 30:133-140(1995) [PubMed: 8586411] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Identification of the adipocyte acid phosphatase as a PAO-sensitive tyrosyl phosphatase." Shekels L.L., Smith A.J., van Etten R.L., Bernlohr D.A. Protein Sci. 1:710-721(1992) [PubMed: 1304913] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 2). Tissue: Adipocyte. |
| [6] | "Regulation of the low molecular weight phosphotyrosine phosphatase by phosphorylation at tyrosines 131 and 132." Tailor P., Gilman J., Williams S., Couture C., Mustelin T. J. Biol. Chem. 272:5371-5374(1997) [PubMed: 9038134] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2), TISSUE SPECIFICITY, PHOSPHORYLATION AT TYR-132 AND TYR-133, MUTAGENESIS OF CYS-13; TYR-132 AND TYR-133. |
| [7] | "A novel isoform of the low molecular weight phosphotyrosine phosphatase, LMPTP-C, arising from alternative mRNA splicing." Tailor P., Gilman J., Williams S., Mustelin T. Eur. J. Biochem. 262:277-282(1999) [PubMed: 10336608] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3). |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skeletal muscle. |
| [9] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [10] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-106. Tissue: Muscle and Placenta. |
| [13] | Lubec G., Vishwanath V. Submitted (MAR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 42-59, MASS SPECTROMETRY. Tissue: Brain and Cajal-Retzius cell. |
| [14] | "A TaqI site identifies the *A allele at the ACP1 locus." Sensabaugh G.F., Lazaruk K.A. Hum. Mol. Genet. 2:1079-1079(1993) [PubMed: 8364553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 99-158 (ISOFORMS 1/2). Tissue: Blood. |
| [15] | "Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain." Nicolas G., Fournier C.M., Galand C., Malbert-Colas L., Bournier O., Kroviarski Y., Bourgeois M., Camonis J.H., Dhermy D., Grandchamp B., Lecomte M.-C. Mol. Cell. Biol. 22:3527-3536(2002) [PubMed: 11971983] [Abstract] Cited for: INTERACTION WITH SPTAN1. |
| [16] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-132, MASS SPECTROMETRY. Tissue: Epithelium. |
| [17] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-132, MASS SPECTROMETRY. |
| [18] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [19] | "Crystal structure of a human low molecular weight phosphotyrosyl phosphatase. Implications for substrate specificity." Zhang M., Stauffacher C.V., Lin D., van Etten R.L. J. Biol. Chem. 273:21714-21720(1998) [PubMed: 9705307] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M83653 mRNA. Translation: AAB59354.1. M83654 mRNA. Translation: AAB59355.1. U25849, U25847, U25848 Genomic DNA. Translation: AAC52067.1. S62884 mRNA. Translation: AAB27085.1. S62885 mRNA. Translation: AAB27086.1. M87545 mRNA. No translation available. AK291861 mRNA. Translation: BAF84550.1. BT007136 mRNA. Translation: AAP35800.1. AC079779 Genomic DNA. Translation: AAY14958.1. CH471053 Genomic DNA. Translation: EAX01112.1. BC007422 mRNA. Translation: AAH07422.1. BC106011 mRNA. Translation: AAI06012.1. L06508 Genomic DNA. Translation: AAB59628.1. | |||||||||||||||||||
| IPI | IPI00218847. IPI00219861. IPI00410615. | ||||||||||||||||||
| PIR | A38148. B38148. | ||||||||||||||||||
| RefSeq | NP_004291.1. NP_009030.1. | ||||||||||||||||||
| UniGene | Hs.558296 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P24666. 11 interactions. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P24666. | ||||||||||||||||||
2-D gel databases | |||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00218847. IPI00219861. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P24666. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000143727. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 52. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC02P000254. | ||||||||||||||||||
| H-InvDB | HIX0001778. | ||||||||||||||||||
| HGNC | HGNC:122. ACP1. | ||||||||||||||||||
| HPA | HPA016754. | ||||||||||||||||||
| MIM | 171500. gene. | ||||||||||||||||||
| PharmGKB | PA24446. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | P24666. | ||||||||||||||||||
| OMA | P24666. CHGNICR. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.1.3.2. 247. 3.1.3.48. 247. | ||||||||||||||||||
| Pathway_Interaction_DB | epha2_fwdpathway. EPHA2 forward signaling. pdgfrbpathway. PDGFR-beta signaling pathway. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P24666. | ||||||||||||||||||
| Bgee | P24666. | ||||||||||||||||||
| CleanEx | HS_ACP1. | ||||||||||||||||||
| GermOnline | ENSG00000143727. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR002115. Tyr_Pase_low_mol_wt_mml. IPR000106. Tyr_phospatase/Ars_reductase. IPR017867. Tyr_phospatase_low_mol_wt. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR11717. Low_mwt_PTPase. 1 hit. | ||||||||||||||||||
| Pfam | PF01451. LMWPc. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00719. LMWPTPASE. PR00720. MAMMALPTPASE. | ||||||||||||||||||
| SMART | SM00226. LMWPc. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 205. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PPAC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P24666 Secondary accession number(s): P24667 Q53RU0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


