Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

ACP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
A phosphate monoester + H2O = an alcohol + phosphate.

Enzyme regulationi

Inhibited by sulfhydryl reagents.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: ProtInc
  • non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:HS07096-MONOMER.
BRENDAi3.1.3.48. 2681.
SignaLinkiP24666.
SIGNORiP24666.

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Adipocyte acid phosphatase
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Red cell acid phosphatase 1
Gene namesi
Name:ACP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:122. ACP1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytoplasmic side of plasma membrane Source: UniProtKB
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi13C → S: Inactive. 1 Publication1
Mutagenesisi132Y → F: Reduced phosphorylation and activity. 1 Publication1
Mutagenesisi133Y → F: Reduced phosphorylation. No effect on activity. 1 Publication1

Organism-specific databases

DisGeNETi52.
OpenTargetsiENSG00000143727.
PharmGKBiPA24446.

Chemistry databases

ChEMBLiCHEMBL4903.
DrugBankiDB00173. Adenine.

Polymorphism and mutation databases

BioMutaiACP1.
DMDMi1709543.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00000465582 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanine1 Publication1
Modified residuei132Phosphotyrosine1 Publication1
Modified residuei133Phosphotyrosine1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP24666.
MaxQBiP24666.
PaxDbiP24666.
PeptideAtlasiP24666.
PRIDEiP24666.

2D gel databases

REPRODUCTION-2DPAGEIPI00218847.
IPI00219861.

PTM databases

DEPODiP24666.
iPTMnetiP24666.
PhosphoSitePlusiP24666.
SwissPalmiP24666.

Expressioni

Tissue specificityi

T-lymphocytes express only isoform 2.1 Publication

Gene expression databases

BgeeiENSG00000143727.
CleanExiHS_ACP1.
ExpressionAtlasiP24666. baseline and differential.
GenevisibleiP24666. HS.

Organism-specific databases

HPAiHPA016754.

Interactioni

Subunit structurei

Isoform 1 interacts with the SH3 domain of SPTAN1. There is no interaction observed for isoforms 2 or 3. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1.3 Publications

Protein-protein interaction databases

BioGridi106568. 31 interactors.
IntActiP24666. 8 interactors.
STRINGi9606.ENSP00000272065.

Chemistry databases

BindingDBiP24666.

Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi7 – 18Combined sources12
Helixi19 – 33Combined sources15
Helixi37 – 39Combined sources3
Beta strandi40 – 49Combined sources10
Turni50 – 53Combined sources4
Helixi58 – 66Combined sources9
Helixi80 – 85Combined sources6
Beta strandi87 – 93Combined sources7
Helixi94 – 104Combined sources11
Beta strandi113 – 116Combined sources4
Helixi117 – 120Combined sources4
Helixi136 – 155Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XWWX-ray1.63A2-158[»]
3N8IX-ray1.50A2-158[»]
4Z99X-ray2.30A1-158[»]
4Z9AX-ray2.10A1-158[»]
4Z9BX-ray2.41A1-158[»]
5KQGX-ray1.50A1-158[»]
5KQLX-ray1.45A1-158[»]
5KQMX-ray1.91A1-158[»]
5KQPX-ray2.05A1-158[»]
5PNTX-ray2.20A2-158[»]
ProteinModelPortaliP24666.
SMRiP24666.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP24666.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3217. Eukaryota.
COG0394. LUCA.
GeneTreeiENSGT00500000044891.
HOGENOMiHOG000074091.
HOVERGENiHBG007540.
InParanoidiP24666.
KOiK14394.
OMAiCEIAPEM.
OrthoDBiEOG091G0P0O.
PhylomeDBiP24666.
TreeFamiTF353727.

Family and domain databases

CDDicd00115. LMWPc. 1 hit.
InterProiIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERiPTHR11717:SF7. PTHR11717:SF7. 1 hit.
PfamiPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMiSSF52788. SSF52788. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: The ratio of isoform 1 to isoform 2 is 2:1 in allele A, 4:1 in allele B and 1:4 in allele C.
Isoform 1 (identifier: P24666-1) [UniParc]FASTAAdd to basket
Also known as: F, A, Alpha, LMPTP-A, HCPTP-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEQATKSVL FVCLGNICRS PIAEAVFRKL VTDQNISENW RVDSAATSGY
60 70 80 90 100
EIGNPPDYRG QSCMKRHGIP MSHVARQITK EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKTC KAKIELLGSY DPQKQLIIED PYYGNDSDFE TVYQQCVRCC

RAFLEKAH
Length:158
Mass (Da):18,042
Last modified:January 23, 2007 - v3
Checksum:i46617BD799313EED
GO
Isoform 2 (identifier: P24666-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: S, B, Beta, LMPTP-B, HCPTP-B

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV → VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK

Show »
Length:158
Mass (Da):17,977
Checksum:iA137F38F06F39161
GO
Isoform 3 (identifier: P24666-3) [UniParc]FASTAAdd to basket
Also known as: C, LMPTP-C

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.

Show »
Length:124
Mass (Da):14,342
Checksum:iD68ED15D431D2484
GO
Isoform 4 (identifier: P24666-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-112: ITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKA → VPSLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL
     113-158: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,230
Checksum:i805DBFA90F43D732
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2 – 6AEQAT → PRRGR in AAB27086 (PubMed:1304913).Curated5
Sequence conflicti2A → P in BP363227 (PubMed:16344560).Curated1
Sequence conflicti13 – 20CLGNICRS → PARREAAR in AAB27085 (PubMed:1304913).Curated8
Sequence conflicti32T → W AA sequence (PubMed:1939112).Curated1
Sequence conflicti32T → W AA sequence (PubMed:1627603).Curated1

Polymorphismi

ACP1 is genetically polymorphic. Three common alleles are known in Caucasians: ACP1*A, ACP1*B and ACP1*C. They give rise to six different phenotypes. Each allele appears to encode two electrophoretically different isozymes, F and S, which are produced in allele-specific ratios (PubMed:1939112). The sequence shown is that of allele ACP1*B and allele ACP1*C.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0505267K → N.Corresponds to variant rs11691572dbSNPEnsembl.1
Natural variantiVAR_006171106Q → R in allele ACP1*A. 1 PublicationCorresponds to variant rs7576247dbSNPEnsembl.1
Natural variantiVAR_050527137S → F.Corresponds to variant rs35569198dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01008741 – 74RVDSA…PMSHV → VIDSGAVSDWNVGRSPDPRA VSCLRNHGIHTAHK in isoform 2. 5 PublicationsAdd BLAST34
Alternative sequenceiVSP_01008841 – 74Missing in isoform 3. CuratedAdd BLAST34
Alternative sequenceiVSP_05407478 – 112ITKED…KTCKA → VPSLDLKLCVLCFSGSLTAV LFLTGTWAGPQTQEL in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_054075113 – 158Missing in isoform 4. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83653 mRNA. Translation: AAB59354.1.
M83654 mRNA. Translation: AAB59355.1.
U25849, U25847, U25848 Genomic DNA. Translation: AAC52067.1.
S62884 mRNA. Translation: AAB27085.1.
S62885 mRNA. Translation: AAB27086.1.
M87545 mRNA. No translation available.
BT007136 mRNA. Translation: AAP35800.1.
AK289934 mRNA. Translation: BAF82623.1.
AK291861 mRNA. Translation: BAF84550.1.
BP363227 mRNA. No translation available.
AC079779 Genomic DNA. Translation: AAY14958.1.
CH471053 Genomic DNA. Translation: EAX01112.1.
CH471053 Genomic DNA. Translation: EAX01116.1.
BC007422 mRNA. Translation: AAH07422.1.
BC106011 mRNA. Translation: AAI06012.1.
L06508 Genomic DNA. Translation: AAB59628.1.
CCDSiCCDS1639.1. [P24666-1]
CCDS1640.1. [P24666-2]
CCDS46217.1. [P24666-4]
PIRiA38148.
B38148.
RefSeqiNP_004291.1. NM_004300.3. [P24666-1]
NP_009030.1. NM_007099.3. [P24666-2]
UniGeneiHs.558296.

Genome annotation databases

EnsembliENST00000272065; ENSP00000272065; ENSG00000143727. [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727. [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727. [P24666-4]
GeneIDi52.
KEGGihsa:52.
UCSCiuc002qwd.3. human. [P24666-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M83653 mRNA. Translation: AAB59354.1.
M83654 mRNA. Translation: AAB59355.1.
U25849, U25847, U25848 Genomic DNA. Translation: AAC52067.1.
S62884 mRNA. Translation: AAB27085.1.
S62885 mRNA. Translation: AAB27086.1.
M87545 mRNA. No translation available.
BT007136 mRNA. Translation: AAP35800.1.
AK289934 mRNA. Translation: BAF82623.1.
AK291861 mRNA. Translation: BAF84550.1.
BP363227 mRNA. No translation available.
AC079779 Genomic DNA. Translation: AAY14958.1.
CH471053 Genomic DNA. Translation: EAX01112.1.
CH471053 Genomic DNA. Translation: EAX01116.1.
BC007422 mRNA. Translation: AAH07422.1.
BC106011 mRNA. Translation: AAI06012.1.
L06508 Genomic DNA. Translation: AAB59628.1.
CCDSiCCDS1639.1. [P24666-1]
CCDS1640.1. [P24666-2]
CCDS46217.1. [P24666-4]
PIRiA38148.
B38148.
RefSeqiNP_004291.1. NM_004300.3. [P24666-1]
NP_009030.1. NM_007099.3. [P24666-2]
UniGeneiHs.558296.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XWWX-ray1.63A2-158[»]
3N8IX-ray1.50A2-158[»]
4Z99X-ray2.30A1-158[»]
4Z9AX-ray2.10A1-158[»]
4Z9BX-ray2.41A1-158[»]
5KQGX-ray1.50A1-158[»]
5KQLX-ray1.45A1-158[»]
5KQMX-ray1.91A1-158[»]
5KQPX-ray2.05A1-158[»]
5PNTX-ray2.20A2-158[»]
ProteinModelPortaliP24666.
SMRiP24666.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106568. 31 interactors.
IntActiP24666. 8 interactors.
STRINGi9606.ENSP00000272065.

Chemistry databases

BindingDBiP24666.
ChEMBLiCHEMBL4903.
DrugBankiDB00173. Adenine.

PTM databases

DEPODiP24666.
iPTMnetiP24666.
PhosphoSitePlusiP24666.
SwissPalmiP24666.

Polymorphism and mutation databases

BioMutaiACP1.
DMDMi1709543.

2D gel databases

REPRODUCTION-2DPAGEIPI00218847.
IPI00219861.

Proteomic databases

EPDiP24666.
MaxQBiP24666.
PaxDbiP24666.
PeptideAtlasiP24666.
PRIDEiP24666.

Protocols and materials databases

DNASUi52.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272065; ENSP00000272065; ENSG00000143727. [P24666-1]
ENST00000272067; ENSP00000272067; ENSG00000143727. [P24666-2]
ENST00000407983; ENSP00000385404; ENSG00000143727. [P24666-4]
GeneIDi52.
KEGGihsa:52.
UCSCiuc002qwd.3. human. [P24666-1]

Organism-specific databases

CTDi52.
DisGeNETi52.
GeneCardsiACP1.
HGNCiHGNC:122. ACP1.
HPAiHPA016754.
MIMi171500. gene.
neXtProtiNX_P24666.
OpenTargetsiENSG00000143727.
PharmGKBiPA24446.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3217. Eukaryota.
COG0394. LUCA.
GeneTreeiENSGT00500000044891.
HOGENOMiHOG000074091.
HOVERGENiHBG007540.
InParanoidiP24666.
KOiK14394.
OMAiCEIAPEM.
OrthoDBiEOG091G0P0O.
PhylomeDBiP24666.
TreeFamiTF353727.

Enzyme and pathway databases

BioCyciZFISH:HS07096-MONOMER.
BRENDAi3.1.3.48. 2681.
SignaLinkiP24666.
SIGNORiP24666.

Miscellaneous databases

EvolutionaryTraceiP24666.
GeneWikiiACP1.
GenomeRNAii52.
PROiP24666.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143727.
CleanExiHS_ACP1.
ExpressionAtlasiP24666. baseline and differential.
GenevisibleiP24666. HS.

Family and domain databases

CDDicd00115. LMWPc. 1 hit.
InterProiIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERiPTHR11717:SF7. PTHR11717:SF7. 1 hit.
PfamiPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMiSSF52788. SSF52788. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPPAC_HUMAN
AccessioniPrimary (citable) accession number: P24666
Secondary accession number(s): A8K1L9
, B5MCC7, P24667, Q16035, Q16036, Q16725, Q3KQX8, Q53RU0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 185 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.