Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thromboxane-A synthase

Gene

TBXAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-9-alpha,11-alpha-epoxy-15-hydroxythromboxa-5,13-dienoate.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi479Iron (heme axial ligand)By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Monooxygenase, Oxidoreductase

Keywords - Biological processi

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00728-MONOMER.
ZFISH:HS00728-MONOMER.
ReactomeiR-HSA-211979. Eicosanoids.
R-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Chemistry databases

SwissLipidsiSLP:000001099.

Names & Taxonomyi

Protein namesi
Recommended name:
Thromboxane-A synthase (EC:5.3.99.5)
Short name:
TXA synthase
Short name:
TXS
Alternative name(s):
Cytochrome P450 5A1
Gene namesi
Name:TBXAS1
Synonyms:CYP5, CYP5A1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:11609. TBXAS1.

Subcellular locationi

  • Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 10CytoplasmicSequence analysis10
Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Topological domaini32 – 75LumenalSequence analysisAdd BLAST44
Transmembranei76 – 96HelicalSequence analysisAdd BLAST21
Topological domaini97 – 223CytoplasmicSequence analysisAdd BLAST127
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21
Topological domaini245 – 335LumenalSequence analysisAdd BLAST91
Transmembranei336 – 356HelicalSequence analysisAdd BLAST21
Topological domaini357 – 533CytoplasmicSequence analysisAdd BLAST177

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Involvement in diseasei

Ghosal hematodiaphyseal dysplasia (GHDD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionRare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all.
See also OMIM:231095
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04438682L → P in GHDD. 1 PublicationCorresponds to variant rs140005285dbSNPEnsembl.1
Natural variantiVAR_044388412R → Q in GHDD. 1 PublicationCorresponds to variant rs199422117dbSNPEnsembl.1
Natural variantiVAR_044389481G → W in GHDD. 1 PublicationCorresponds to variant rs199422116dbSNPEnsembl.1
Natural variantiVAR_044390487L → P in GHDD. 1 PublicationCorresponds to variant rs199422114dbSNPEnsembl.1

Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction.

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi6916.
MalaCardsiTBXAS1.
MIMi231095. phenotype.
OpenTargetsiENSG00000059377.
Orphaneti1802. Ghosal hematodiaphyseal dysplasia.
PharmGKBiPA349.

Chemistry databases

ChEMBLiCHEMBL1835.
DrugBankiDB01207. Ridogrel.
DB00795. Sulfasalazine.
GuidetoPHARMACOLOGYi1353.

Polymorphism and mutation databases

BioMutaiTBXAS1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000522561 – 533Thromboxane-A synthaseAdd BLAST533

Proteomic databases

EPDiP24557.
MaxQBiP24557.
PeptideAtlasiP24557.
PRIDEiP24557.

PTM databases

iPTMnetiP24557.
PhosphoSitePlusiP24557.

Expressioni

Tissue specificityi

Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.

Gene expression databases

BgeeiENSG00000059377.
ExpressionAtlasiP24557. baseline and differential.
GenevisibleiP24557. HS.

Organism-specific databases

HPAiHPA031257.
HPA031258.
HPA031259.

Interactioni

Subunit structurei

Monomer.

Protein-protein interaction databases

BioGridi112778. 2 interactors.
IntActiP24557. 2 interactors.
MINTiMINT-4823512.

Chemistry databases

BindingDBiP24557.

Structurei

3D structure databases

ProteinModelPortaliP24557.
SMRiP24557.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118816.
HOGENOMiHOG000039127.
HOVERGENiHBG108567.
InParanoidiP24557.
KOiK01832.
OMAiRFQACPE.
PhylomeDBiP24557.

Family and domain databases

Gene3Di1.10.630.10. 2 hits.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 2 hits.
[Graphical view]
PRINTSiPR00463. EP450I.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 2 hits.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P24557-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEALGFLKLE VNGPMVTVAL SVALLALLKW YSTSAFSRLE KLGLRHPKPS
60 70 80 90 100
PFIGNLTFFR QGFWESQMEL RKLYGPLCGY YLGRRMFIVI SEPDMIKQVL
110 120 130 140 150
VENFSNFTNR MASGLEFKSV ADSVLFLRDK RWEEVRGALM SAFSPEKLNE
160 170 180 190 200
MVPLISQACD LLLAHLKRYA ESGDAFDIQR CYCNYTTDVV ASVAFGTPVD
210 220 230 240 250
SWQAPEDPFV KHCKRFFEFC IPRPILVLLL SFPSIMVPLA RILPNKNRDE
260 270 280 290 300
LNGFFNKLIR NVIALRDQQA AEERRRDFLQ MVLDARHSAS PMGVQDFDIV
310 320 330 340 350
RDVFSSTGCK PNPSRQHQPS PMARPLTVDE IVGQAFIFLI AGYEIITNTL
360 370 380 390 400
SFATYLLATN PDCQEKLLRE VDVFKEKHMA PEFCSLEEGL PYLDMVIAET
410 420 430 440 450
LRMYPPAFRF TREAAQDCEV LGQRIPAGAV LEMAVGALHH DPEHWPSPET
460 470 480 490 500
FNPERFTAEA RQQHRPFTYL PFGAGPRSCL GVRLGLLEVK LTLLHVLHKF
510 520 530
RFQACPETQV PLQLESKSAL GPKNGVYIKI VSR
Length:533
Mass (Da):60,518
Last modified:July 28, 2009 - v3
Checksum:iE95E7B7EA77E6DDC
GO
Isoform 2 (identifier: P24557-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):52,995
Checksum:iE214331AAC1B7797
GO
Isoform 3 (identifier: P24557-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: E → ELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFC

Show »
Length:579
Mass (Da):65,632
Checksum:iB3FF6087E8892CCF
GO
Isoform 4 (identifier: P24557-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     456-459: FTAE → YRCS
     460-533: Missing.

Show »
Length:459
Mass (Da):52,287
Checksum:i7AE5A27B6467D359
GO

Sequence cautioni

The sequence AAA60617 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAA60618 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAC01761 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAC01761 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAF99269 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99270 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99271 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99272 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99273 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99274 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99275 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99276 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99277 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99278 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99279 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH41157 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAG58828 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence EAW83934 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102E → Q in AAA36742 (PubMed:2043115).Curated1
Sequence conflicti148L → V in AAC01761 (Ref. 4) Curated1
Sequence conflicti194A → P in AAA60617 (PubMed:1730669).Curated1
Sequence conflicti194A → P in AAA60618 (PubMed:1730669).Curated1
Sequence conflicti194A → P in AAC01761 (Ref. 4) Curated1
Sequence conflicti194A → P in AAF99269 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99270 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99271 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99272 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99273 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99274 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99275 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99276 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99277 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99278 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAF99279 (PubMed:11465543).Curated1
Sequence conflicti194A → P in AAA36742 (PubMed:2043115).Curated1
Sequence conflicti385S → G no nucleotide entry (PubMed:1714723).Curated1
Sequence conflicti483R → H in BAA07011 (PubMed:7925341).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01415760R → H in allele CYP5A1*2. 2 PublicationsCorresponds to variant rs6138dbSNPEnsembl.1
Natural variantiVAR_05846570L → P.Corresponds to variant rs13306050dbSNPEnsembl.1
Natural variantiVAR_05846670L → V.Corresponds to variant rs4529dbSNPEnsembl.1
Natural variantiVAR_04438682L → P in GHDD. 1 PublicationCorresponds to variant rs140005285dbSNPEnsembl.1
Natural variantiVAR_03629485R → W in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_018378124V → I.1 PublicationCorresponds to variant rs8192833dbSNPEnsembl.1
Natural variantiVAR_010919160D → E in allele CYP5A1*3. 2 PublicationsCorresponds to variant rs5768dbSNPEnsembl.1
Natural variantiVAR_014158162L → I.1 PublicationCorresponds to variant rs6137dbSNPEnsembl.1
Natural variantiVAR_010920245N → S in allele CYP5A1*4. 1 PublicationCorresponds to variant rs55856189dbSNPEnsembl.1
Natural variantiVAR_014647257K → E.Corresponds to variant rs5769dbSNPEnsembl.1
Natural variantiVAR_014648260R → G.Corresponds to variant rs5770dbSNPEnsembl.1
Natural variantiVAR_014649316Q → K.Corresponds to variant rs5771dbSNPEnsembl.1
Natural variantiVAR_014159331I → T.1 PublicationCorresponds to variant rs6140dbSNPEnsembl.1
Natural variantiVAR_010921356L → V in allele CYP5A1*5. 3 PublicationsCorresponds to variant rs4529dbSNPEnsembl.1
Natural variantiVAR_044387357L → V.Corresponds to variant rs4529dbSNPEnsembl.1
Natural variantiVAR_055565387E → K.Corresponds to variant rs3735354dbSNPEnsembl.1
Natural variantiVAR_018379388E → K.1 PublicationCorresponds to variant rs3735354dbSNPEnsembl.1
Natural variantiVAR_016158389G → V.Corresponds to variant rs5760dbSNPEnsembl.1
Natural variantiVAR_044388412R → Q in GHDD. 1 PublicationCorresponds to variant rs199422117dbSNPEnsembl.1
Natural variantiVAR_010922416Q → E in allele CYP5A1*6. 3 PublicationsCorresponds to variant rs4528dbSNPEnsembl.1
Natural variantiVAR_014160424R → C.1 PublicationCorresponds to variant rs5762dbSNPEnsembl.1
Natural variantiVAR_014161429A → T.2 PublicationsCorresponds to variant rs4526dbSNPEnsembl.1
Natural variantiVAR_010923449E → K in allele CYP5A1*7. 2 PublicationsCorresponds to variant rs8192868dbSNPEnsembl.1
Natural variantiVAR_010924450T → N in allele CYP5A1*8. 1 PublicationCorresponds to variant rs5763dbSNPEnsembl.1
Natural variantiVAR_010925465R → Q in allele CYP5A1*9. 1 PublicationCorresponds to variant rs41311778dbSNPEnsembl.1
Natural variantiVAR_044389481G → W in GHDD. 1 PublicationCorresponds to variant rs199422116dbSNPEnsembl.1
Natural variantiVAR_044390487L → P in GHDD. 1 PublicationCorresponds to variant rs199422114dbSNPEnsembl.1
Natural variantiVAR_018380501R → Q.1 PublicationCorresponds to variant rs8192864dbSNPEnsembl.1
Natural variantiVAR_055566511P → L.Corresponds to variant rs13306050dbSNPEnsembl.1
Natural variantiVAR_044391512L → P.Corresponds to variant rs13306050dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472171 – 67Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_054121150E → ELGLLIMQERIKGHMGGQQA PQRIPPTRLSKPSGIYVNLH YATLPFC in isoform 3. 1 Publication1
Alternative sequenceiVSP_054122456 – 459FTAE → YRCS in isoform 4. 1 Publication4
Alternative sequenceiVSP_054123460 – 533Missing in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80646 mRNA. Translation: AAA60617.1. Different initiation.
M80647 mRNA. Translation: AAA60618.1. Different initiation.
D34625 Genomic DNA. Translation: BAA07011.1.
L36085
, L36075, L36076, L36077, L36078, L36079, L36080, L36081, L36082, L36083, L36084 Genomic DNA. Translation: AAC01761.1. Different initiation.
AF233615 Genomic DNA. Translation: AAF99269.1. Different initiation.
AF233616 Genomic DNA. Translation: AAF99270.1. Different initiation.
AF233617 Genomic DNA. Translation: AAF99271.1. Different initiation.
AF233618 Genomic DNA. Translation: AAF99272.1. Different initiation.
AF233619 Genomic DNA. Translation: AAF99273.1. Different initiation.
AF233620 Genomic DNA. Translation: AAF99274.1. Different initiation.
AF233621 Genomic DNA. Translation: AAF99275.1. Different initiation.
AF233622 Genomic DNA. Translation: AAF99276.1. Different initiation.
AF233623 Genomic DNA. Translation: AAF99277.1. Different initiation.
AF233624 Genomic DNA. Translation: AAF99278.1. Different initiation.
AF233625 Genomic DNA. Translation: AAF99279.1. Different initiation.
AK296069 mRNA. Translation: BAG58828.1. Different initiation.
AC004914 Genomic DNA. No translation available.
AC004961 Genomic DNA. No translation available.
AC006021 Genomic DNA. No translation available.
CH471070 Genomic DNA. Translation: EAW83934.1. Different initiation.
BC014117 mRNA. Translation: AAH14117.1.
BC041157 mRNA. Translation: AAH41157.1. Different initiation.
M74055 mRNA. Translation: AAA36742.1.
CCDSiCCDS55175.1. [P24557-2]
PIRiA41766.
S48161.
RefSeqiNP_001052.2. NM_001061.4.
NP_001124438.1. NM_001130966.2.
NP_001159725.1. NM_001166253.1.
NP_001159726.1. NM_001166254.1. [P24557-2]
NP_112246.2. NM_030984.3.
UniGeneiHs.520757.

Genome annotation databases

EnsembliENST00000336425; ENSP00000338087; ENSG00000059377. [P24557-1]
ENST00000411653; ENSP00000411326; ENSG00000059377. [P24557-4]
ENST00000425687; ENSP00000388736; ENSG00000059377. [P24557-2]
ENST00000448866; ENSP00000402536; ENSG00000059377. [P24557-1]
ENST00000458722; ENSP00000411274; ENSG00000059377. [P24557-3]
GeneIDi6916.
KEGGihsa:6916.
UCSCiuc010lne.4. human. [P24557-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP5A1 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80646 mRNA. Translation: AAA60617.1. Different initiation.
M80647 mRNA. Translation: AAA60618.1. Different initiation.
D34625 Genomic DNA. Translation: BAA07011.1.
L36085
, L36075, L36076, L36077, L36078, L36079, L36080, L36081, L36082, L36083, L36084 Genomic DNA. Translation: AAC01761.1. Different initiation.
AF233615 Genomic DNA. Translation: AAF99269.1. Different initiation.
AF233616 Genomic DNA. Translation: AAF99270.1. Different initiation.
AF233617 Genomic DNA. Translation: AAF99271.1. Different initiation.
AF233618 Genomic DNA. Translation: AAF99272.1. Different initiation.
AF233619 Genomic DNA. Translation: AAF99273.1. Different initiation.
AF233620 Genomic DNA. Translation: AAF99274.1. Different initiation.
AF233621 Genomic DNA. Translation: AAF99275.1. Different initiation.
AF233622 Genomic DNA. Translation: AAF99276.1. Different initiation.
AF233623 Genomic DNA. Translation: AAF99277.1. Different initiation.
AF233624 Genomic DNA. Translation: AAF99278.1. Different initiation.
AF233625 Genomic DNA. Translation: AAF99279.1. Different initiation.
AK296069 mRNA. Translation: BAG58828.1. Different initiation.
AC004914 Genomic DNA. No translation available.
AC004961 Genomic DNA. No translation available.
AC006021 Genomic DNA. No translation available.
CH471070 Genomic DNA. Translation: EAW83934.1. Different initiation.
BC014117 mRNA. Translation: AAH14117.1.
BC041157 mRNA. Translation: AAH41157.1. Different initiation.
M74055 mRNA. Translation: AAA36742.1.
CCDSiCCDS55175.1. [P24557-2]
PIRiA41766.
S48161.
RefSeqiNP_001052.2. NM_001061.4.
NP_001124438.1. NM_001130966.2.
NP_001159725.1. NM_001166253.1.
NP_001159726.1. NM_001166254.1. [P24557-2]
NP_112246.2. NM_030984.3.
UniGeneiHs.520757.

3D structure databases

ProteinModelPortaliP24557.
SMRiP24557.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112778. 2 interactors.
IntActiP24557. 2 interactors.
MINTiMINT-4823512.

Chemistry databases

BindingDBiP24557.
ChEMBLiCHEMBL1835.
DrugBankiDB01207. Ridogrel.
DB00795. Sulfasalazine.
GuidetoPHARMACOLOGYi1353.
SwissLipidsiSLP:000001099.

PTM databases

iPTMnetiP24557.
PhosphoSitePlusiP24557.

Polymorphism and mutation databases

BioMutaiTBXAS1.

Proteomic databases

EPDiP24557.
MaxQBiP24557.
PeptideAtlasiP24557.
PRIDEiP24557.

Protocols and materials databases

DNASUi6916.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336425; ENSP00000338087; ENSG00000059377. [P24557-1]
ENST00000411653; ENSP00000411326; ENSG00000059377. [P24557-4]
ENST00000425687; ENSP00000388736; ENSG00000059377. [P24557-2]
ENST00000448866; ENSP00000402536; ENSG00000059377. [P24557-1]
ENST00000458722; ENSP00000411274; ENSG00000059377. [P24557-3]
GeneIDi6916.
KEGGihsa:6916.
UCSCiuc010lne.4. human. [P24557-1]

Organism-specific databases

CTDi6916.
DisGeNETi6916.
GeneCardsiTBXAS1.
HGNCiHGNC:11609. TBXAS1.
HPAiHPA031257.
HPA031258.
HPA031259.
MalaCardsiTBXAS1.
MIMi231095. phenotype.
274180. gene.
neXtProtiNX_P24557.
OpenTargetsiENSG00000059377.
Orphaneti1802. Ghosal hematodiaphyseal dysplasia.
PharmGKBiPA349.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118816.
HOGENOMiHOG000039127.
HOVERGENiHBG108567.
InParanoidiP24557.
KOiK01832.
OMAiRFQACPE.
PhylomeDBiP24557.

Enzyme and pathway databases

BioCyciMetaCyc:HS00728-MONOMER.
ZFISH:HS00728-MONOMER.
ReactomeiR-HSA-211979. Eicosanoids.
R-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Miscellaneous databases

ChiTaRSiTBXAS1. human.
GeneWikiiThromboxane-A_synthase.
GenomeRNAii6916.
PROiP24557.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000059377.
ExpressionAtlasiP24557. baseline and differential.
GenevisibleiP24557. HS.

Family and domain databases

Gene3Di1.10.630.10. 2 hits.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 2 hits.
[Graphical view]
PRINTSiPR00463. EP450I.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 2 hits.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTHAS_HUMAN
AccessioniPrimary (citable) accession number: P24557
Secondary accession number(s): B4DJG6
, E7EMU9, E7EP08, E7ESB5, O14987, Q16843, Q16844, Q8IUN1, Q96CN2, Q9GZW4, Q9HD77, Q9HD78, Q9HD79, Q9HD80, Q9HD81, Q9HD82, Q9HD83, Q9HD84
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: July 28, 2009
Last modified: November 30, 2016
This is version 185 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 is the initiator. An alternative upstream Met is found in primates, but not in other mammals.Curated

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.