Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P24557

- THAS_HUMAN

UniProt

P24557 - THAS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Thromboxane-A synthase

Gene

TBXAS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalytic activityi

(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-9-alpha,11-alpha-epoxy-15-hydroxythromboxa-5,13-dienoate.

Cofactori

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi479 – 4791Iron (heme axial ligand)By similarity

GO - Molecular functioni

  1. heme binding Source: InterPro
  2. iron ion binding Source: InterPro
  3. monooxygenase activity Source: UniProtKB-KW
  4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
  5. thromboxane-A synthase activity Source: UniProtKB-EC

GO - Biological processi

  1. arachidonic acid metabolic process Source: Reactome
  2. cellular chloride ion homeostasis Source: Ensembl
  3. cyclooxygenase pathway Source: Reactome
  4. icosanoid metabolic process Source: Reactome
  5. positive regulation of vasoconstriction Source: Ensembl
  6. small molecule metabolic process Source: Reactome
  7. xenobiotic metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Monooxygenase, Oxidoreductase

Keywords - Biological processi

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00728-MONOMER.
ReactomeiREACT_13645. Eicosanoids.
REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Names & Taxonomyi

Protein namesi
Recommended name:
Thromboxane-A synthase (EC:5.3.99.5)
Short name:
TXA synthase
Short name:
TXS
Alternative name(s):
Cytochrome P450 5A1
Gene namesi
Name:TBXAS1
Synonyms:CYP5, CYP5A1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:11609. TBXAS1.

Subcellular locationi

Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1010CytoplasmicSequence Analysis
Transmembranei11 – 3121HelicalSequence AnalysisAdd
BLAST
Topological domaini32 – 7544LumenalSequence AnalysisAdd
BLAST
Transmembranei76 – 9621HelicalSequence AnalysisAdd
BLAST
Topological domaini97 – 223127CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei224 – 24421HelicalSequence AnalysisAdd
BLAST
Topological domaini245 – 33591LumenalSequence AnalysisAdd
BLAST
Transmembranei336 – 35621HelicalSequence AnalysisAdd
BLAST
Topological domaini357 – 533177CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Involvement in diseasei

Ghosal hematodiaphyseal dysplasia (GHDD) [MIM:231095]: Rare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti82 – 821L → P in GHDD. 1 Publication
VAR_044386
Natural varianti412 – 4121R → Q in GHDD. 1 Publication
VAR_044388
Natural varianti481 – 4811G → W in GHDD. 1 Publication
VAR_044389
Natural varianti487 – 4871L → P in GHDD. 1 Publication
VAR_044390
Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction.1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi231095. phenotype.
Orphaneti1802. Ghosal hematodiaphyseal dysplasia.
PharmGKBiPA349.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 533533Thromboxane-A synthasePRO_0000052256Add
BLAST

Proteomic databases

MaxQBiP24557.
PaxDbiP24557.
PRIDEiP24557.

PTM databases

PhosphoSiteiP24557.

Expressioni

Tissue specificityi

Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.

Gene expression databases

BgeeiP24557.
ExpressionAtlasiP24557. baseline and differential.
GenevestigatoriP24557.

Organism-specific databases

HPAiHPA031257.
HPA031258.
HPA031259.

Interactioni

Subunit structurei

Monomer.

Protein-protein interaction databases

BioGridi112778. 1 interaction.
IntActiP24557. 1 interaction.
MINTiMINT-4823512.

Structurei

3D structure databases

ProteinModelPortaliP24557.
SMRiP24557. Positions 39-533.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG2124.
GeneTreeiENSGT00760000118816.
HOVERGENiHBG108567.
InParanoidiP24557.
KOiK01832.
OMAiCIPRPIL.
PhylomeDBiP24557.

Family and domain databases

Gene3Di1.10.630.10. 2 hits.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 2 hits.
[Graphical view]
PRINTSiPR00463. EP450I.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 2 hits.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P24557-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEALGFLKLE VNGPMVTVAL SVALLALLKW YSTSAFSRLE KLGLRHPKPS
60 70 80 90 100
PFIGNLTFFR QGFWESQMEL RKLYGPLCGY YLGRRMFIVI SEPDMIKQVL
110 120 130 140 150
VENFSNFTNR MASGLEFKSV ADSVLFLRDK RWEEVRGALM SAFSPEKLNE
160 170 180 190 200
MVPLISQACD LLLAHLKRYA ESGDAFDIQR CYCNYTTDVV ASVAFGTPVD
210 220 230 240 250
SWQAPEDPFV KHCKRFFEFC IPRPILVLLL SFPSIMVPLA RILPNKNRDE
260 270 280 290 300
LNGFFNKLIR NVIALRDQQA AEERRRDFLQ MVLDARHSAS PMGVQDFDIV
310 320 330 340 350
RDVFSSTGCK PNPSRQHQPS PMARPLTVDE IVGQAFIFLI AGYEIITNTL
360 370 380 390 400
SFATYLLATN PDCQEKLLRE VDVFKEKHMA PEFCSLEEGL PYLDMVIAET
410 420 430 440 450
LRMYPPAFRF TREAAQDCEV LGQRIPAGAV LEMAVGALHH DPEHWPSPET
460 470 480 490 500
FNPERFTAEA RQQHRPFTYL PFGAGPRSCL GVRLGLLEVK LTLLHVLHKF
510 520 530
RFQACPETQV PLQLESKSAL GPKNGVYIKI VSR
Length:533
Mass (Da):60,518
Last modified:July 28, 2009 - v3
Checksum:iE95E7B7EA77E6DDC
GO
Isoform 2 (identifier: P24557-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Note: No experimental confirmation available.

Show »
Length:466
Mass (Da):52,995
Checksum:iE214331AAC1B7797
GO
Isoform 3 (identifier: P24557-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: E → ELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFC

Show »
Length:579
Mass (Da):65,632
Checksum:iB3FF6087E8892CCF
GO
Isoform 4 (identifier: P24557-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     456-459: FTAE → YRCS
     460-533: Missing.

Show »
Length:459
Mass (Da):52,287
Checksum:i7AE5A27B6467D359
GO

Sequence cautioni

The sequence AAA60617.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAA60618.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAC01761.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAC01761.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence AAF99269.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99270.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99271.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99272.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99274.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99275.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99276.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99277.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99278.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAF99279.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH41157.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAG58828.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence EAW83934.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti102 – 1021E → Q in AAA36742. (PubMed:2043115)Curated
Sequence conflicti148 – 1481L → V in AAC01761. 1 PublicationCurated
Sequence conflicti194 – 1941A → P in AAA60617. (PubMed:1730669)Curated
Sequence conflicti194 – 1941A → P in AAA60618. (PubMed:1730669)Curated
Sequence conflicti194 – 1941A → P in AAC01761. 1 PublicationCurated
Sequence conflicti194 – 1941A → P in AAF99269. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99270. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99271. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99272. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99273. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99274. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99275. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99276. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99277. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99278. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAF99279. (PubMed:11465543)Curated
Sequence conflicti194 – 1941A → P in AAA36742. (PubMed:2043115)Curated
Sequence conflicti385 – 3851S → G no nucleotide entry (PubMed:1714723)Curated
Sequence conflicti483 – 4831R → H in BAA07011. (PubMed:7925341)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti60 – 601R → H in allele CYP5A1*2. 2 Publications
Corresponds to variant rs6138 [ dbSNP | Ensembl ].
VAR_014157
Natural varianti70 – 701L → P.
Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
VAR_058465
Natural varianti70 – 701L → V.
Corresponds to variant rs4529 [ dbSNP | Ensembl ].
VAR_058466
Natural varianti82 – 821L → P in GHDD. 1 Publication
VAR_044386
Natural varianti85 – 851R → W in a breast cancer sample; somatic mutation. 1 Publication
VAR_036294
Natural varianti124 – 1241V → I.1 Publication
VAR_018378
Natural varianti160 – 1601D → E in allele CYP5A1*3. 2 Publications
Corresponds to variant rs5768 [ dbSNP | Ensembl ].
VAR_010919
Natural varianti162 – 1621L → I.1 Publication
Corresponds to variant rs6137 [ dbSNP | Ensembl ].
VAR_014158
Natural varianti245 – 2451N → S in allele CYP5A1*4. 1 Publication
VAR_010920
Natural varianti257 – 2571K → E.
Corresponds to variant rs5769 [ dbSNP | Ensembl ].
VAR_014647
Natural varianti260 – 2601R → G.
Corresponds to variant rs5770 [ dbSNP | Ensembl ].
VAR_014648
Natural varianti316 – 3161Q → K.
Corresponds to variant rs5771 [ dbSNP | Ensembl ].
VAR_014649
Natural varianti331 – 3311I → T.1 Publication
Corresponds to variant rs6140 [ dbSNP | Ensembl ].
VAR_014159
Natural varianti356 – 3561L → V in allele CYP5A1*5. 3 Publications
Corresponds to variant rs4529 [ dbSNP | Ensembl ].
VAR_010921
Natural varianti357 – 3571L → V.
Corresponds to variant rs4529 [ dbSNP | Ensembl ].
VAR_044387
Natural varianti387 – 3871E → K.
Corresponds to variant rs3735354 [ dbSNP | Ensembl ].
VAR_055565
Natural varianti388 – 3881E → K.1 Publication
Corresponds to variant rs3735354 [ dbSNP | Ensembl ].
VAR_018379
Natural varianti389 – 3891G → V.
Corresponds to variant rs5760 [ dbSNP | Ensembl ].
VAR_016158
Natural varianti412 – 4121R → Q in GHDD. 1 Publication
VAR_044388
Natural varianti416 – 4161Q → E in allele CYP5A1*6. 3 Publications
Corresponds to variant rs4528 [ dbSNP | Ensembl ].
VAR_010922
Natural varianti424 – 4241R → C.1 Publication
Corresponds to variant rs5762 [ dbSNP | Ensembl ].
VAR_014160
Natural varianti429 – 4291A → T.2 Publications
Corresponds to variant rs4526 [ dbSNP | Ensembl ].
VAR_014161
Natural varianti449 – 4491E → K in allele CYP5A1*7. 2 Publications
VAR_010923
Natural varianti450 – 4501T → N in allele CYP5A1*8. 1 Publication
Corresponds to variant rs5763 [ dbSNP | Ensembl ].
VAR_010924
Natural varianti465 – 4651R → Q in allele CYP5A1*9. 1 Publication
VAR_010925
Natural varianti481 – 4811G → W in GHDD. 1 Publication
VAR_044389
Natural varianti487 – 4871L → P in GHDD. 1 Publication
VAR_044390
Natural varianti501 – 5011R → Q.1 Publication
VAR_018380
Natural varianti511 – 5111P → L.
Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
VAR_055566
Natural varianti512 – 5121L → P.
Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
VAR_044391

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6767Missing in isoform 2. 1 PublicationVSP_047217Add
BLAST
Alternative sequencei150 – 1501E → ELGLLIMQERIKGHMGGQQA PQRIPPTRLSKPSGIYVNLH YATLPFC in isoform 3. 1 PublicationVSP_054121
Alternative sequencei456 – 4594FTAE → YRCS in isoform 4. 1 PublicationVSP_054122
Alternative sequencei460 – 53374Missing in isoform 4. 1 PublicationVSP_054123Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80646 mRNA. Translation: AAA60617.1. Different initiation.
M80647 mRNA. Translation: AAA60618.1. Different initiation.
D34625 Genomic DNA. Translation: BAA07011.1.
L36085
, L36075, L36076, L36077, L36078, L36079, L36080, L36081, L36082, L36083, L36084 Genomic DNA. Translation: AAC01761.1. Different initiation.
AF233615 Genomic DNA. Translation: AAF99269.1. Different initiation.
AF233616 Genomic DNA. Translation: AAF99270.1. Different initiation.
AF233617 Genomic DNA. Translation: AAF99271.1. Different initiation.
AF233618 Genomic DNA. Translation: AAF99272.1. Different initiation.
AF233619 Genomic DNA. Translation: AAF99273.1. Different initiation.
AF233620 Genomic DNA. Translation: AAF99274.1. Different initiation.
AF233621 Genomic DNA. Translation: AAF99275.1. Different initiation.
AF233622 Genomic DNA. Translation: AAF99276.1. Different initiation.
AF233623 Genomic DNA. Translation: AAF99277.1. Different initiation.
AF233624 Genomic DNA. Translation: AAF99278.1. Different initiation.
AF233625 Genomic DNA. Translation: AAF99279.1. Different initiation.
AK296069 mRNA. Translation: BAG58828.1. Different initiation.
AC004914 Genomic DNA. No translation available.
AC004961 Genomic DNA. No translation available.
AC006021 Genomic DNA. No translation available.
CH471070 Genomic DNA. Translation: EAW83934.1. Different initiation.
BC014117 mRNA. Translation: AAH14117.1.
BC041157 mRNA. Translation: AAH41157.1. Different initiation.
M74055 mRNA. Translation: AAA36742.1.
CCDSiCCDS55175.1. [P24557-2]
PIRiA41766.
S48161.
RefSeqiNP_001052.2. NM_001061.4.
NP_001124438.1. NM_001130966.2.
NP_001159725.1. NM_001166253.1.
NP_001159726.1. NM_001166254.1. [P24557-2]
NP_112246.2. NM_030984.3.
UniGeneiHs.520757.

Genome annotation databases

EnsembliENST00000336425; ENSP00000338087; ENSG00000059377. [P24557-1]
ENST00000411653; ENSP00000411326; ENSG00000059377. [P24557-4]
ENST00000416849; ENSP00000389414; ENSG00000059377.
ENST00000425687; ENSP00000388736; ENSG00000059377. [P24557-2]
ENST00000448866; ENSP00000402536; ENSG00000059377. [P24557-1]
ENST00000458722; ENSP00000411274; ENSG00000059377. [P24557-3]
GeneIDi6916.
KEGGihsa:6916.
UCSCiuc010lne.3. human. [P24557-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP5A1 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80646 mRNA. Translation: AAA60617.1 . Different initiation.
M80647 mRNA. Translation: AAA60618.1 . Different initiation.
D34625 Genomic DNA. Translation: BAA07011.1 .
L36085
, L36075 , L36076 , L36077 , L36078 , L36079 , L36080 , L36081 , L36082 , L36083 , L36084 Genomic DNA. Translation: AAC01761.1 . Different initiation.
AF233615 Genomic DNA. Translation: AAF99269.1 . Different initiation.
AF233616 Genomic DNA. Translation: AAF99270.1 . Different initiation.
AF233617 Genomic DNA. Translation: AAF99271.1 . Different initiation.
AF233618 Genomic DNA. Translation: AAF99272.1 . Different initiation.
AF233619 Genomic DNA. Translation: AAF99273.1 . Different initiation.
AF233620 Genomic DNA. Translation: AAF99274.1 . Different initiation.
AF233621 Genomic DNA. Translation: AAF99275.1 . Different initiation.
AF233622 Genomic DNA. Translation: AAF99276.1 . Different initiation.
AF233623 Genomic DNA. Translation: AAF99277.1 . Different initiation.
AF233624 Genomic DNA. Translation: AAF99278.1 . Different initiation.
AF233625 Genomic DNA. Translation: AAF99279.1 . Different initiation.
AK296069 mRNA. Translation: BAG58828.1 . Different initiation.
AC004914 Genomic DNA. No translation available.
AC004961 Genomic DNA. No translation available.
AC006021 Genomic DNA. No translation available.
CH471070 Genomic DNA. Translation: EAW83934.1 . Different initiation.
BC014117 mRNA. Translation: AAH14117.1 .
BC041157 mRNA. Translation: AAH41157.1 . Different initiation.
M74055 mRNA. Translation: AAA36742.1 .
CCDSi CCDS55175.1. [P24557-2 ]
PIRi A41766.
S48161.
RefSeqi NP_001052.2. NM_001061.4.
NP_001124438.1. NM_001130966.2.
NP_001159725.1. NM_001166253.1.
NP_001159726.1. NM_001166254.1. [P24557-2 ]
NP_112246.2. NM_030984.3.
UniGenei Hs.520757.

3D structure databases

ProteinModelPortali P24557.
SMRi P24557. Positions 39-533.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112778. 1 interaction.
IntActi P24557. 1 interaction.
MINTi MINT-4823512.

Chemistry

BindingDBi P24557.
ChEMBLi CHEMBL1835.
DrugBanki DB01207. Ridogrel.
DB00795. Sulfasalazine.

PTM databases

PhosphoSitei P24557.

Proteomic databases

MaxQBi P24557.
PaxDbi P24557.
PRIDEi P24557.

Protocols and materials databases

DNASUi 6916.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000336425 ; ENSP00000338087 ; ENSG00000059377 . [P24557-1 ]
ENST00000411653 ; ENSP00000411326 ; ENSG00000059377 . [P24557-4 ]
ENST00000416849 ; ENSP00000389414 ; ENSG00000059377 .
ENST00000425687 ; ENSP00000388736 ; ENSG00000059377 . [P24557-2 ]
ENST00000448866 ; ENSP00000402536 ; ENSG00000059377 . [P24557-1 ]
ENST00000458722 ; ENSP00000411274 ; ENSG00000059377 . [P24557-3 ]
GeneIDi 6916.
KEGGi hsa:6916.
UCSCi uc010lne.3. human. [P24557-1 ]

Organism-specific databases

CTDi 6916.
GeneCardsi GC07P139476.
HGNCi HGNC:11609. TBXAS1.
HPAi HPA031257.
HPA031258.
HPA031259.
MIMi 231095. phenotype.
274180. gene.
neXtProti NX_P24557.
Orphaneti 1802. Ghosal hematodiaphyseal dysplasia.
PharmGKBi PA349.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2124.
GeneTreei ENSGT00760000118816.
HOVERGENi HBG108567.
InParanoidi P24557.
KOi K01832.
OMAi CIPRPIL.
PhylomeDBi P24557.

Enzyme and pathway databases

BioCyci MetaCyc:HS00728-MONOMER.
Reactomei REACT_13645. Eicosanoids.
REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Miscellaneous databases

ChiTaRSi TBXAS1. human.
GeneWikii Thromboxane-A_synthase.
GenomeRNAii 6916.
NextBioi 27051.
PROi P24557.
SOURCEi Search...

Gene expression databases

Bgeei P24557.
ExpressionAtlasi P24557. baseline and differential.
Genevestigatori P24557.

Family and domain databases

Gene3Di 1.10.630.10. 2 hits.
InterProi IPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view ]
Pfami PF00067. p450. 2 hits.
[Graphical view ]
PRINTSi PR00463. EP450I.
PR00385. P450.
SUPFAMi SSF48264. SSF48264. 2 hits.
PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Platelet.
  2. "Primary structure of human thromboxane synthase determined from the cDNA sequence."
    Ohashi K., Ruan K.H., Kulmacz R.J., Wu K.K., Wang L.-H.
    J. Biol. Chem. 267:789-793(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4).
    Tissue: Lung.
  3. "Characterization of the human gene (TBXAS1) encoding thromboxane synthase."
    Miyata A., Yokoyama C., Ihara H., Bandoh S., Takeda O., Takahashi E., Tanabe T.
    Eur. J. Biochem. 224:273-279(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Peripheral blood.
  4. "Human thromboxane A2 synthase."
    Shen R.-F.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Identification of genetic variants in the human thromboxane synthase gene (CYP5A1)."
    Chevalier D., Lo-Guidice J.-M., Sergent E., Allorge D., Debuysere H., Ferrari N., Libersa C., Lhermitte M., Broly F.
    Mutat. Res. 432:61-67(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-60; GLU-160; SER-245; VAL-356; GLU-416; LYS-449; ASN-450 AND GLN-465.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Thalamus.
  7. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Lung.
  10. "Isolation of partial complementary DNA encoding human thromboxane synthase."
    Wang L.-H., Oshashi K., Wu K.K.
    Biochem. Biophys. Res. Commun. 177:286-291(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 16-244 (ISOFORM 1/2).
    Tissue: Lung.
  11. "Immunoaffinity purification of human thromboxane synthase."
    Nuesing R., Schneider-Voss S., Ullrich V.
    Arch. Biochem. Biophys. 280:325-330(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: PRELIMINARY PROTEIN SEQUENCE OF 1-26; 96-110 AND 237-280.
  12. Nuesing R.
    Thesis (1990), University of Konstanz, Germany
    Cited for: PARTIAL PROTEIN SEQUENCE.
  13. "Amino-terminal topology of thromboxane synthase in the endoplasmic reticulum."
    Ruan K.H., Wang L.-H., Wu K.K., Kulmacz R.J.
    J. Biol. Chem. 268:19483-19490(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, MEMBRANE TOPOLOGY.
  14. "Severe bleeding associated with defective thromboxane synthetase."
    Mestel F., Oetliker O., Beck E., Felix R., Imbach P., Wagner H.P.
    Lancet 1:157-157(1980) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISEASE.
  15. Cited for: VARIANTS HIS-60; ILE-162; THR-331; VAL-356; GLU-416 AND THR-429.
  16. "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis."
    Halushka M.K., Fan J.-B., Bentley K., Hsie L., Shen N., Weder A., Cooper R., Lipshutz R., Chakravarti A.
    Nat. Genet. 22:239-247(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS GLU-160; VAL-356; GLU-416; CYS-424 AND THR-429.
  17. "Catalog of 680 variations among eight cytochrome p450 (CYP) genes, nine esterase genes, and two other genes in the Japanese population."
    Saito S., Iida A., Sekine A., Kawauchi S., Higuchi S., Ogawa C., Nakamura Y.
    J. Hum. Genet. 48:249-270(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ILE-124; LYS-388; LYS-449 AND GLN-501.
  18. Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-85.
  19. Cited for: VARIANTS GHDD PRO-82; GLN-412; TRP-481 AND PRO-487.

Entry informationi

Entry nameiTHAS_HUMAN
AccessioniPrimary (citable) accession number: P24557
Secondary accession number(s): B4DJG6
, E7EMU9, E7EP08, E7ESB5, O14987, Q16843, Q16844, Q8IUN1, Q96CN2, Q9GZW4, Q9HD77, Q9HD78, Q9HD79, Q9HD80, Q9HD81, Q9HD82, Q9HD83, Q9HD84
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: July 28, 2009
Last modified: November 26, 2014
This is version 167 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3