Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P24557

- THAS_HUMAN

UniProt

P24557 - THAS_HUMAN

Protein

Thromboxane-A synthase

Gene

TBXAS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 165 (01 Oct 2014)
      Sequence version 3 (28 Jul 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-9-alpha,11-alpha-epoxy-15-hydroxythromboxa-5,13-dienoate.

    Cofactori

    Heme group.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi479 – 4791Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. heme binding Source: InterPro
    2. iron ion binding Source: InterPro
    3. monooxygenase activity Source: UniProtKB-KW
    4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
    5. thromboxane-A synthase activity Source: UniProtKB-EC

    GO - Biological processi

    1. arachidonic acid metabolic process Source: Reactome
    2. cyclooxygenase pathway Source: Reactome
    3. icosanoid metabolic process Source: Reactome
    4. small molecule metabolic process Source: Reactome
    5. xenobiotic metabolic process Source: Reactome

    Keywords - Molecular functioni

    Isomerase, Monooxygenase, Oxidoreductase

    Keywords - Biological processi

    Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS00728-MONOMER.
    ReactomeiREACT_13645. Eicosanoids.
    REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Thromboxane-A synthase (EC:5.3.99.5)
    Short name:
    TXA synthase
    Short name:
    TXS
    Alternative name(s):
    Cytochrome P450 5A1
    Gene namesi
    Name:TBXAS1
    Synonyms:CYP5, CYP5A1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:11609. TBXAS1.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Ghosal hematodiaphyseal dysplasia (GHDD) [MIM:231095]: Rare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti82 – 821L → P in GHDD. 1 Publication
    VAR_044386
    Natural varianti412 – 4121R → Q in GHDD. 1 Publication
    VAR_044388
    Natural varianti481 – 4811G → W in GHDD. 1 Publication
    VAR_044389
    Natural varianti487 – 4871L → P in GHDD. 1 Publication
    VAR_044390
    Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction.1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi231095. phenotype.
    Orphaneti1802. Ghosal hematodiaphyseal dysplasia.
    PharmGKBiPA349.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 533533Thromboxane-A synthasePRO_0000052256Add
    BLAST

    Proteomic databases

    MaxQBiP24557.
    PaxDbiP24557.
    PRIDEiP24557.

    PTM databases

    PhosphoSiteiP24557.

    Expressioni

    Tissue specificityi

    Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.

    Gene expression databases

    ArrayExpressiP24557.
    BgeeiP24557.
    GenevestigatoriP24557.

    Organism-specific databases

    HPAiHPA031257.
    HPA031258.
    HPA031259.

    Interactioni

    Subunit structurei

    Monomer.

    Protein-protein interaction databases

    BioGridi112778. 1 interaction.
    IntActiP24557. 1 interaction.
    MINTiMINT-4823512.

    Structurei

    3D structure databases

    ProteinModelPortaliP24557.
    SMRiP24557. Positions 39-533.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1010CytoplasmicSequence Analysis
    Topological domaini32 – 7544LumenalSequence AnalysisAdd
    BLAST
    Topological domaini97 – 223127CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini245 – 33591LumenalSequence AnalysisAdd
    BLAST
    Topological domaini357 – 533177CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei11 – 3121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei76 – 9621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei224 – 24421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei336 – 35621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG2124.
    HOVERGENiHBG108567.
    InParanoidiP24557.
    KOiK01832.
    OMAiCIPRPIL.
    PhylomeDBiP24557.

    Family and domain databases

    Gene3Di1.10.630.10. 2 hits.
    InterProiIPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view]
    PfamiPF00067. p450. 2 hits.
    [Graphical view]
    PRINTSiPR00463. EP450I.
    PR00385. P450.
    SUPFAMiSSF48264. SSF48264. 2 hits.
    PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P24557-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEALGFLKLE VNGPMVTVAL SVALLALLKW YSTSAFSRLE KLGLRHPKPS    50
    PFIGNLTFFR QGFWESQMEL RKLYGPLCGY YLGRRMFIVI SEPDMIKQVL 100
    VENFSNFTNR MASGLEFKSV ADSVLFLRDK RWEEVRGALM SAFSPEKLNE 150
    MVPLISQACD LLLAHLKRYA ESGDAFDIQR CYCNYTTDVV ASVAFGTPVD 200
    SWQAPEDPFV KHCKRFFEFC IPRPILVLLL SFPSIMVPLA RILPNKNRDE 250
    LNGFFNKLIR NVIALRDQQA AEERRRDFLQ MVLDARHSAS PMGVQDFDIV 300
    RDVFSSTGCK PNPSRQHQPS PMARPLTVDE IVGQAFIFLI AGYEIITNTL 350
    SFATYLLATN PDCQEKLLRE VDVFKEKHMA PEFCSLEEGL PYLDMVIAET 400
    LRMYPPAFRF TREAAQDCEV LGQRIPAGAV LEMAVGALHH DPEHWPSPET 450
    FNPERFTAEA RQQHRPFTYL PFGAGPRSCL GVRLGLLEVK LTLLHVLHKF 500
    RFQACPETQV PLQLESKSAL GPKNGVYIKI VSR 533
    Length:533
    Mass (Da):60,518
    Last modified:July 28, 2009 - v3
    Checksum:iE95E7B7EA77E6DDC
    GO
    Isoform 2 (identifier: P24557-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-67: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:466
    Mass (Da):52,995
    Checksum:iE214331AAC1B7797
    GO
    Isoform 3 (identifier: P24557-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         150-150: E → ELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFC

    Show »
    Length:579
    Mass (Da):65,632
    Checksum:iB3FF6087E8892CCF
    GO
    Isoform 4 (identifier: P24557-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         456-459: FTAE → YRCS
         460-533: Missing.

    Show »
    Length:459
    Mass (Da):52,287
    Checksum:i7AE5A27B6467D359
    GO

    Sequence cautioni

    The sequence AAA60617.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAA60618.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAC01761.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99269.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99270.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99271.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99272.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99274.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99275.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99276.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99277.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99278.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF99279.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAH41157.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAG58828.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence EAW83934.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAC01761.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti102 – 1021E → Q in AAA36742. (PubMed:2043115)Curated
    Sequence conflicti148 – 1481L → V in AAC01761. 1 PublicationCurated
    Sequence conflicti194 – 1941A → P in AAA60617. (PubMed:1730669)Curated
    Sequence conflicti194 – 1941A → P in AAA60618. (PubMed:1730669)Curated
    Sequence conflicti194 – 1941A → P in AAC01761. 1 PublicationCurated
    Sequence conflicti194 – 1941A → P in AAF99269. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99270. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99271. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99272. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99273. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99274. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99275. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99276. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99277. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99278. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAF99279. (PubMed:11465543)Curated
    Sequence conflicti194 – 1941A → P in AAA36742. (PubMed:2043115)Curated
    Sequence conflicti385 – 3851S → G no nucleotide entry (PubMed:1714723)Curated
    Sequence conflicti483 – 4831R → H in BAA07011. (PubMed:7925341)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti60 – 601R → H in allele CYP5A1*2. 2 Publications
    Corresponds to variant rs6138 [ dbSNP | Ensembl ].
    VAR_014157
    Natural varianti70 – 701L → P.
    Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
    VAR_058465
    Natural varianti70 – 701L → V.
    Corresponds to variant rs4529 [ dbSNP | Ensembl ].
    VAR_058466
    Natural varianti82 – 821L → P in GHDD. 1 Publication
    VAR_044386
    Natural varianti85 – 851R → W in a breast cancer sample; somatic mutation. 1 Publication
    VAR_036294
    Natural varianti124 – 1241V → I.1 Publication
    VAR_018378
    Natural varianti160 – 1601D → E in allele CYP5A1*3. 2 Publications
    Corresponds to variant rs5768 [ dbSNP | Ensembl ].
    VAR_010919
    Natural varianti162 – 1621L → I.1 Publication
    Corresponds to variant rs6137 [ dbSNP | Ensembl ].
    VAR_014158
    Natural varianti245 – 2451N → S in allele CYP5A1*4. 1 Publication
    VAR_010920
    Natural varianti257 – 2571K → E.
    Corresponds to variant rs5769 [ dbSNP | Ensembl ].
    VAR_014647
    Natural varianti260 – 2601R → G.
    Corresponds to variant rs5770 [ dbSNP | Ensembl ].
    VAR_014648
    Natural varianti316 – 3161Q → K.
    Corresponds to variant rs5771 [ dbSNP | Ensembl ].
    VAR_014649
    Natural varianti331 – 3311I → T.1 Publication
    Corresponds to variant rs6140 [ dbSNP | Ensembl ].
    VAR_014159
    Natural varianti356 – 3561L → V in allele CYP5A1*5. 3 Publications
    Corresponds to variant rs4529 [ dbSNP | Ensembl ].
    VAR_010921
    Natural varianti357 – 3571L → V.
    Corresponds to variant rs4529 [ dbSNP | Ensembl ].
    VAR_044387
    Natural varianti387 – 3871E → K.
    Corresponds to variant rs3735354 [ dbSNP | Ensembl ].
    VAR_055565
    Natural varianti388 – 3881E → K.1 Publication
    Corresponds to variant rs3735354 [ dbSNP | Ensembl ].
    VAR_018379
    Natural varianti389 – 3891G → V.
    Corresponds to variant rs5760 [ dbSNP | Ensembl ].
    VAR_016158
    Natural varianti412 – 4121R → Q in GHDD. 1 Publication
    VAR_044388
    Natural varianti416 – 4161Q → E in allele CYP5A1*6. 3 Publications
    Corresponds to variant rs4528 [ dbSNP | Ensembl ].
    VAR_010922
    Natural varianti424 – 4241R → C.1 Publication
    Corresponds to variant rs5762 [ dbSNP | Ensembl ].
    VAR_014160
    Natural varianti429 – 4291A → T.2 Publications
    Corresponds to variant rs4526 [ dbSNP | Ensembl ].
    VAR_014161
    Natural varianti449 – 4491E → K in allele CYP5A1*7. 2 Publications
    VAR_010923
    Natural varianti450 – 4501T → N in allele CYP5A1*8. 1 Publication
    Corresponds to variant rs5763 [ dbSNP | Ensembl ].
    VAR_010924
    Natural varianti465 – 4651R → Q in allele CYP5A1*9. 1 Publication
    VAR_010925
    Natural varianti481 – 4811G → W in GHDD. 1 Publication
    VAR_044389
    Natural varianti487 – 4871L → P in GHDD. 1 Publication
    VAR_044390
    Natural varianti501 – 5011R → Q.1 Publication
    VAR_018380
    Natural varianti511 – 5111P → L.
    Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
    VAR_055566
    Natural varianti512 – 5121L → P.
    Corresponds to variant rs13306050 [ dbSNP | Ensembl ].
    VAR_044391

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6767Missing in isoform 2. 1 PublicationVSP_047217Add
    BLAST
    Alternative sequencei150 – 1501E → ELGLLIMQERIKGHMGGQQA PQRIPPTRLSKPSGIYVNLH YATLPFC in isoform 3. 1 PublicationVSP_054121
    Alternative sequencei456 – 4594FTAE → YRCS in isoform 4. 1 PublicationVSP_054122
    Alternative sequencei460 – 53374Missing in isoform 4. 1 PublicationVSP_054123Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M80646 mRNA. Translation: AAA60617.1. Different initiation.
    M80647 mRNA. Translation: AAA60618.1. Different initiation.
    D34625 Genomic DNA. Translation: BAA07011.1.
    L36085
    , L36075, L36076, L36077, L36078, L36079, L36080, L36081, L36082, L36083, L36084 Genomic DNA. Translation: AAC01761.1. Different initiation.
    AF233615 Genomic DNA. Translation: AAF99269.1. Different initiation.
    AF233616 Genomic DNA. Translation: AAF99270.1. Different initiation.
    AF233617 Genomic DNA. Translation: AAF99271.1. Different initiation.
    AF233618 Genomic DNA. Translation: AAF99272.1. Different initiation.
    AF233619 Genomic DNA. Translation: AAF99273.1. Different initiation.
    AF233620 Genomic DNA. Translation: AAF99274.1. Different initiation.
    AF233621 Genomic DNA. Translation: AAF99275.1. Different initiation.
    AF233622 Genomic DNA. Translation: AAF99276.1. Different initiation.
    AF233623 Genomic DNA. Translation: AAF99277.1. Different initiation.
    AF233624 Genomic DNA. Translation: AAF99278.1. Different initiation.
    AF233625 Genomic DNA. Translation: AAF99279.1. Different initiation.
    AK296069 mRNA. Translation: BAG58828.1. Different initiation.
    AC004914 Genomic DNA. No translation available.
    AC004961 Genomic DNA. No translation available.
    AC006021 Genomic DNA. No translation available.
    CH471070 Genomic DNA. Translation: EAW83934.1. Different initiation.
    BC014117 mRNA. Translation: AAH14117.1.
    BC041157 mRNA. Translation: AAH41157.1. Different initiation.
    M74055 mRNA. Translation: AAA36742.1.
    CCDSiCCDS55175.1. [P24557-2]
    PIRiA41766.
    S48161.
    RefSeqiNP_001052.2. NM_001061.4.
    NP_001124438.1. NM_001130966.2.
    NP_001159725.1. NM_001166253.1.
    NP_001159726.1. NM_001166254.1. [P24557-2]
    NP_112246.2. NM_030984.3.
    UniGeneiHs.520757.

    Genome annotation databases

    EnsembliENST00000263552; ENSP00000263552; ENSG00000059377.
    ENST00000336425; ENSP00000338087; ENSG00000059377.
    ENST00000414508; ENSP00000392702; ENSG00000059377.
    ENST00000416849; ENSP00000389414; ENSG00000059377.
    ENST00000425687; ENSP00000388736; ENSG00000059377.
    ENST00000436047; ENSP00000392361; ENSG00000059377.
    ENST00000448866; ENSP00000402536; ENSG00000059377.
    GeneIDi6916.
    KEGGihsa:6916.
    UCSCiuc010lne.3. human. [P24557-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Cytochrome P450 Allele Nomenclature Committee

    CYP5A1 alleles

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M80646 mRNA. Translation: AAA60617.1 . Different initiation.
    M80647 mRNA. Translation: AAA60618.1 . Different initiation.
    D34625 Genomic DNA. Translation: BAA07011.1 .
    L36085
    , L36075 , L36076 , L36077 , L36078 , L36079 , L36080 , L36081 , L36082 , L36083 , L36084 Genomic DNA. Translation: AAC01761.1 . Different initiation.
    AF233615 Genomic DNA. Translation: AAF99269.1 . Different initiation.
    AF233616 Genomic DNA. Translation: AAF99270.1 . Different initiation.
    AF233617 Genomic DNA. Translation: AAF99271.1 . Different initiation.
    AF233618 Genomic DNA. Translation: AAF99272.1 . Different initiation.
    AF233619 Genomic DNA. Translation: AAF99273.1 . Different initiation.
    AF233620 Genomic DNA. Translation: AAF99274.1 . Different initiation.
    AF233621 Genomic DNA. Translation: AAF99275.1 . Different initiation.
    AF233622 Genomic DNA. Translation: AAF99276.1 . Different initiation.
    AF233623 Genomic DNA. Translation: AAF99277.1 . Different initiation.
    AF233624 Genomic DNA. Translation: AAF99278.1 . Different initiation.
    AF233625 Genomic DNA. Translation: AAF99279.1 . Different initiation.
    AK296069 mRNA. Translation: BAG58828.1 . Different initiation.
    AC004914 Genomic DNA. No translation available.
    AC004961 Genomic DNA. No translation available.
    AC006021 Genomic DNA. No translation available.
    CH471070 Genomic DNA. Translation: EAW83934.1 . Different initiation.
    BC014117 mRNA. Translation: AAH14117.1 .
    BC041157 mRNA. Translation: AAH41157.1 . Different initiation.
    M74055 mRNA. Translation: AAA36742.1 .
    CCDSi CCDS55175.1. [P24557-2 ]
    PIRi A41766.
    S48161.
    RefSeqi NP_001052.2. NM_001061.4.
    NP_001124438.1. NM_001130966.2.
    NP_001159725.1. NM_001166253.1.
    NP_001159726.1. NM_001166254.1. [P24557-2 ]
    NP_112246.2. NM_030984.3.
    UniGenei Hs.520757.

    3D structure databases

    ProteinModelPortali P24557.
    SMRi P24557. Positions 39-533.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112778. 1 interaction.
    IntActi P24557. 1 interaction.
    MINTi MINT-4823512.

    Chemistry

    BindingDBi P24557.
    ChEMBLi CHEMBL1835.

    PTM databases

    PhosphoSitei P24557.

    Proteomic databases

    MaxQBi P24557.
    PaxDbi P24557.
    PRIDEi P24557.

    Protocols and materials databases

    DNASUi 6916.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263552 ; ENSP00000263552 ; ENSG00000059377 .
    ENST00000336425 ; ENSP00000338087 ; ENSG00000059377 .
    ENST00000414508 ; ENSP00000392702 ; ENSG00000059377 .
    ENST00000416849 ; ENSP00000389414 ; ENSG00000059377 .
    ENST00000425687 ; ENSP00000388736 ; ENSG00000059377 .
    ENST00000436047 ; ENSP00000392361 ; ENSG00000059377 .
    ENST00000448866 ; ENSP00000402536 ; ENSG00000059377 .
    GeneIDi 6916.
    KEGGi hsa:6916.
    UCSCi uc010lne.3. human. [P24557-1 ]

    Organism-specific databases

    CTDi 6916.
    GeneCardsi GC07P139476.
    HGNCi HGNC:11609. TBXAS1.
    HPAi HPA031257.
    HPA031258.
    HPA031259.
    MIMi 231095. phenotype.
    274180. gene.
    neXtProti NX_P24557.
    Orphaneti 1802. Ghosal hematodiaphyseal dysplasia.
    PharmGKBi PA349.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOVERGENi HBG108567.
    InParanoidi P24557.
    KOi K01832.
    OMAi CIPRPIL.
    PhylomeDBi P24557.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS00728-MONOMER.
    Reactomei REACT_13645. Eicosanoids.
    REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

    Miscellaneous databases

    GeneWikii Thromboxane-A_synthase.
    GenomeRNAii 6916.
    NextBioi 27051.
    PROi P24557.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P24557.
    Bgeei P24557.
    Genevestigatori P24557.

    Family and domain databases

    Gene3Di 1.10.630.10. 2 hits.
    InterProi IPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view ]
    Pfami PF00067. p450. 2 hits.
    [Graphical view ]
    PRINTSi PR00463. EP450I.
    PR00385. P450.
    SUPFAMi SSF48264. SSF48264. 2 hits.
    PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Platelet.
    2. "Primary structure of human thromboxane synthase determined from the cDNA sequence."
      Ohashi K., Ruan K.H., Kulmacz R.J., Wu K.K., Wang L.-H.
      J. Biol. Chem. 267:789-793(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4).
      Tissue: Lung.
    3. "Characterization of the human gene (TBXAS1) encoding thromboxane synthase."
      Miyata A., Yokoyama C., Ihara H., Bandoh S., Takeda O., Takahashi E., Tanabe T.
      Eur. J. Biochem. 224:273-279(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Peripheral blood.
    4. "Human thromboxane A2 synthase."
      Shen R.-F.
      Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Identification of genetic variants in the human thromboxane synthase gene (CYP5A1)."
      Chevalier D., Lo-Guidice J.-M., Sergent E., Allorge D., Debuysere H., Ferrari N., Libersa C., Lhermitte M., Broly F.
      Mutat. Res. 432:61-67(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-60; GLU-160; SER-245; VAL-356; GLU-416; LYS-449; ASN-450 AND GLN-465.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Thalamus.
    7. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Lung.
    10. "Isolation of partial complementary DNA encoding human thromboxane synthase."
      Wang L.-H., Oshashi K., Wu K.K.
      Biochem. Biophys. Res. Commun. 177:286-291(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 16-244 (ISOFORM 1/2).
      Tissue: Lung.
    11. "Immunoaffinity purification of human thromboxane synthase."
      Nuesing R., Schneider-Voss S., Ullrich V.
      Arch. Biochem. Biophys. 280:325-330(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: PRELIMINARY PROTEIN SEQUENCE OF 1-26; 96-110 AND 237-280.
    12. Nuesing R.
      Thesis (1990), University of Konstanz, Germany
      Cited for: PARTIAL PROTEIN SEQUENCE.
    13. "Amino-terminal topology of thromboxane synthase in the endoplasmic reticulum."
      Ruan K.H., Wang L.-H., Wu K.K., Kulmacz R.J.
      J. Biol. Chem. 268:19483-19490(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, MEMBRANE TOPOLOGY.
    14. "Severe bleeding associated with defective thromboxane synthetase."
      Mestel F., Oetliker O., Beck E., Felix R., Imbach P., Wagner H.P.
      Lancet 1:157-157(1980) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISEASE.
    15. Cited for: VARIANTS HIS-60; ILE-162; THR-331; VAL-356; GLU-416 AND THR-429.
    16. "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis."
      Halushka M.K., Fan J.-B., Bentley K., Hsie L., Shen N., Weder A., Cooper R., Lipshutz R., Chakravarti A.
      Nat. Genet. 22:239-247(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS GLU-160; VAL-356; GLU-416; CYS-424 AND THR-429.
    17. "Catalog of 680 variations among eight cytochrome p450 (CYP) genes, nine esterase genes, and two other genes in the Japanese population."
      Saito S., Iida A., Sekine A., Kawauchi S., Higuchi S., Ogawa C., Nakamura Y.
      J. Hum. Genet. 48:249-270(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ILE-124; LYS-388; LYS-449 AND GLN-501.
    18. Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-85.
    19. Cited for: VARIANTS GHDD PRO-82; GLN-412; TRP-481 AND PRO-487.

    Entry informationi

    Entry nameiTHAS_HUMAN
    AccessioniPrimary (citable) accession number: P24557
    Secondary accession number(s): B4DJG6
    , E7EMU9, E7EP08, E7ESB5, O14987, Q16843, Q16844, Q8IUN1, Q96CN2, Q9GZW4, Q9HD77, Q9HD78, Q9HD79, Q9HD80, Q9HD81, Q9HD82, Q9HD83, Q9HD84
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 1992
    Last sequence update: July 28, 2009
    Last modified: October 1, 2014
    This is version 165 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3