P24522 (GA45A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Growth arrest and DNA damage-inducible protein GADD45 alpha Alternative name(s): DNA damage-inducible transcript 1 protein Short name=DDIT-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 165 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity By similarity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. |
| Subunit structure | Interacts with MAPK14 By similarity. Predominantly monomeric but also forms dimers and other oligomers as concentration increases. Interacts with GADD45GIP1. Interacts weakly with PCNA. Interacts with AURKA, likely to compete with dimerization. Ref.9 Ref.10 Ref.11 |
| Subcellular location | |
| Induction | By UV irradiation, X-rays, growth arrest and alkylating agents. The induction is mediated by some kinase(s) other than PKC. |
| Sequence similarities | Belongs to the GADD45 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AICDA | Q9GZX7 | 5 | EBI-448167,EBI-3834328 | |
| GADD45GIP1 | Q8TAE8 | 3 | EBI-448167,EBI-372506 | |
| NUCB2 | P80303 | 2 | EBI-448167,EBI-2296670 | |
| SH3GLB1 | Q9Y371 | 2 | EBI-448167,EBI-2623095 | |
| TDG | Q13569 | 3 | EBI-448167,EBI-348333 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P24522-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P24522-2) The sequence of this isoform differs from the canonical sequence as follows: 15-49: RMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNV → S | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 165 | 165 | Growth arrest and DNA damage-inducible protein GADD45 alpha | PRO_0000148331 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Region | 1 – 16 | 16 | Intrinsically disordered | ||||||||||||||||||||||||||||||
| Region | 105 – 118 | 14 | Intrinsically disordered | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 15 – 49 | 35 | RMDKV…KLLNV → S in isoform 2. | VSP_042523 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Mutagenesis | 77 | 1 | L → E: Abolishes dimerization. Ref.11 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Helix | 16 – 33 | 18 | |||||||||||||||||||||||||||||||
| Beta strand | 36 – 38 | 3 | |||||||||||||||||||||||||||||||
| Helix | 40 – 42 | 3 | |||||||||||||||||||||||||||||||
| Helix | 43 – 49 | 7 | |||||||||||||||||||||||||||||||
| Turn | 51 – 53 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 54 – 60 | 7 | |||||||||||||||||||||||||||||||
| Helix | 64 – 67 | 4 | |||||||||||||||||||||||||||||||
| Helix | 69 – 84 | 16 | |||||||||||||||||||||||||||||||
| Beta strand | 89 – 93 | 5 | |||||||||||||||||||||||||||||||
| Helix | 95 – 104 | 10 | |||||||||||||||||||||||||||||||
| Turn | 105 – 107 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 124 – 128 | 5 | |||||||||||||||||||||||||||||||
| Helix | 138 – 151 | 14 | |||||||||||||||||||||||||||||||
| Turn | 152 – 154 | 3 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Induction by ionizing radiation of the gadd45 gene in cultured human cells: lack of mediation by protein kinase C." Papathanasiou M.A., Kerr N.C.K., Robbins J.H., McBride O.W., Alamo I. Jr., Barrett S.F., Hickson I.D., Fornace A.J. Jr. Mol. Cell. Biol. 11:1009-1016(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Analysis of the mammalian gadd45 gene and its response to DNA damage." Hollander M.C., Alamo I. Jr., Jackman J., Wang M.G., McBride O.W., Fornace A.J. Jr. J. Biol. Chem. 268:24385-24393(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Lung. |
| [3] | NIEHS SNPs program Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Nucleolin links to arsenic-induced stabilization of GADD45alpha mRNA." Zhang Y., Bhatia D., Xia H., Castranova V., Shi X., Chen F. Nucleic Acids Res. 34:485-495(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Bronchiolar epithelial cell. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [9] | "CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle." Chung H.K., Yi Y.-W., Jung N.-C., Kim D., Suh J.M., Kim H., Park K.C., Song J.H., Kim D.W., Hwang E.S., Yoon S.-H., Bae Y.-S., Kim J.M., Bae I., Shong M. J. Biol. Chem. 278:28079-28088(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GADD45GIP1. Tissue: Colon carcinoma. |
| [10] | "Interaction of the p53-regulated protein Gadd45 with proliferating cell nuclear antigen." Smith M.L., Chen I.-T., Zhan Q., Bae I., Chen C.-Y., Gilmer T.M., Kastan M.B., O'Connor P.M., Fornace A.J. Jr. Science 266:1376-1380(1994) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH PCNA. |
| [11] | "Solution structure of human growth arrest and DNA damage 45alpha (Gadd45alpha) and its interactions with proliferating cell nuclear antigen (PCNA) and Aurora A kinase." Sanchez R., Pantoja-Uceda D., Prieto J., Diercks T., Marcaida M.J., Montoya G., Campos-Olivas R., Blanco F.J. J. Biol. Chem. 285:22196-22201(2010) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR, SUBUNIT, INTERACTION WITH PCNA AND AURKA, MUTAGENESIS OF LEU-77. |
| + | Additional computationally mapped references. |
Web resources
| NIEHS-SNPs |
| Wikipedia GADD45A entry |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L24498 Genomic DNA. Translation: AAA72045.1. M60974 mRNA. Translation: AAA35863.1. AY135686 Genomic DNA. Translation: AAM88884.1. DQ008445 mRNA. Translation: AAY25021.1. AK314991 mRNA. Translation: BAG37487.1. AL136120 Genomic DNA. Translation: CAI23494.1. AL136120 Genomic DNA. Translation: CAI23495.1. CH471059 Genomic DNA. Translation: EAX06487.1. CH471059 Genomic DNA. Translation: EAX06488.1. BC011757 mRNA. Translation: AAH11757.1. | ||||||||||||
| IPI | IPI00029104. IPI00513748. | ||||||||||||
| PIR | A39617. | ||||||||||||
| RefSeq | NP_001186670.1. NM_001199741.1. NP_001186671.1. NM_001199742.1. NP_001915.1. NM_001924.3. | ||||||||||||
| UniGene | Hs.80409. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P24522. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-24217N. | ||||||||||||
| IntAct | P24522. 15 interactions. | ||||||||||||
| MINT | MINT-133779. | ||||||||||||
| STRING | 9606.ENSP00000360025. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P24522. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 120751. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P24522. | ||||||||||||
| PRIDE | P24522. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 1647. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000370985; ENSP00000360024; ENSG00000116717. ENST00000370986; ENSP00000360025; ENSG00000116717. | ||||||||||||
| GeneID | 1647. | ||||||||||||
| KEGG | hsa:1647. | ||||||||||||
| UCSC | uc001ddz.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1647. | ||||||||||||
| GeneCards | GC01P068111. | ||||||||||||
| HGNC | HGNC:4095. GADD45A. | ||||||||||||
| MIM | 126335. gene. | ||||||||||||
| neXtProt | NX_P24522. | ||||||||||||
| PharmGKB | PA28510. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG75953. | ||||||||||||
| HOGENOM | HOG000013221. | ||||||||||||
| HOVERGEN | HBG051684. | ||||||||||||
| InParanoid | P24522. | ||||||||||||
| KO | K04402. | ||||||||||||
| OMA | HCVLVTS. | ||||||||||||
| OrthoDB | EOG41NTN5. | ||||||||||||
| PhylomeDB | P24522. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | aurora_a_pathway. Aurora A signaling. foxopathway. FoxO family signaling. p38_mkk3_6pathway. p38 MAPK signaling pathway. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P24522. | ||||||||||||
| Bgee | P24522. | ||||||||||||
| CleanEx | HS_GADD45A. | ||||||||||||
| Genevestigator | P24522. | ||||||||||||
| GermOnline | ENSG00000116717. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR024824. GADD45. IPR004038. Ribosomal_L7Ae/L30e/S12e/Gad45. [Graphical view] | ||||||||||||
| PANTHER | PTHR10411. PTHR10411. 1 hit. | ||||||||||||
| Pfam | PF01248. Ribosomal_L7Ae. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P24522. | ||||||||||||
| GenomeRNAi | 1647. | ||||||||||||
| NextBio | 6786. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | GA45A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P24522 Secondary accession number(s): Q5TCA7, Q5TCA8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
