Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P24462

- CP3A7_HUMAN

UniProt

P24462 - CP3A7_HUMAN

Protein

Cytochrome P450 3A7

Gene

CYP3A7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 2 (21 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

    Catalytic activityi

    RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

    Cofactori

    Heme group.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi442 – 4421Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. aromatase activity Source: UniProtKB-EC
    2. heme binding Source: InterPro
    3. iron ion binding Source: InterPro
    4. monooxygenase activity Source: UniProtKB
    5. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Source: InterPro
    6. oxygen binding Source: ProtInc

    GO - Biological processi

    1. small molecule metabolic process Source: Reactome
    2. xenobiotic metabolic process Source: Reactome

    Keywords - Molecular functioni

    Monooxygenase, Oxidoreductase

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_13543. Xenobiotics.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome P450 3A7 (EC:1.14.14.1)
    Alternative name(s):
    CYPIIIA7
    Cytochrome P450-HFLA
    Gene namesi
    Name:CYP3A7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:2640. CYP3A7.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA122.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 503503Cytochrome P450 3A7PRO_0000051790Add
    BLAST

    Proteomic databases

    MaxQBiP24462.
    PaxDbiP24462.
    PRIDEiP24462.

    PTM databases

    PhosphoSiteiP24462.

    Expressioni

    Inductioni

    P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

    Gene expression databases

    BgeeiP24462.
    CleanExiHS_CYP3A7.
    GenevestigatoriP24462.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000337450.

    Structurei

    3D structure databases

    ProteinModelPortaliP24462.
    SMRiP24462. Positions 29-497.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Phylogenomic databases

    eggNOGiCOG2124.
    HOGENOMiHOG000039127.
    HOVERGENiHBG108567.
    KOiK17691.
    OMAiRAEDEEW.
    OrthoDBiEOG744TBS.
    PhylomeDBiP24462.
    TreeFamiTF105087.

    Family and domain databases

    Gene3Di1.10.630.10. 1 hit.
    InterProiIPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR008072. Cyt_P450_E_CYP3A.
    IPR002402. Cyt_P450_E_grp-II.
    [Graphical view]
    PfamiPF00067. p450. 1 hit.
    [Graphical view]
    PRINTSiPR00464. EP450II.
    PR01689. EP450IICYP3A.
    PR00385. P450.
    SUPFAMiSSF48264. SSF48264. 1 hit.
    PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P24462-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA    50
    LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS 100
    VFTNRRPFGP VGFMKNAISI AEDEEWKRIR SLLSPTFTSG KLKEMVPIIA 150
    QYGDVLVRNL RREAETGKPV TLKHVFGAYS MDVITSTSFG VSIDSLNNPQ 200
    DPFVENTKKL LRFNPLDPFV LSIKVFPFLT PILEALNITV FPRKVISFLT 250
    KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI 300
    IFIFAGYETT SSVLSFIIYE LATHPDVQQK VQKEIDTVLP NKAPPTYDTV 350
    LQLEYLDMVV NETLRLFPVA MRLERVCKKD VEINGMFIPK GVVVMIPSYV 400
    LHHDPKYWRE PEKFLPERFS KKNKDNIDPY IYTPFGSGPR NCIGMRFALV 450
    NMKLALVRVL QNFSFKPCKE TQIPLKLRFG GLLLTEKPIV LKAESRDETV 500
    SGA 503
    Length:503
    Mass (Da):57,526
    Last modified:March 21, 2006 - v2
    Checksum:i0D869148640C372A
    GO
    Isoform 2 (identifier: P24462-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         500-503: VSGA → FVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR

    Show »
    Length:535
    Mass (Da):61,547
    Checksum:iD18210E5236E15B4
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti71 – 711V → A.
    Corresponds to variant rs45580339 [ dbSNP | Ensembl ].
    VAR_055564
    Natural varianti409 – 4091R → T.7 Publications
    Corresponds to variant rs2257401 [ dbSNP | Ensembl ].
    VAR_020124

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei500 – 5034VSGA → FVDMEPIHMDFLRSLAFQGP HLCFFWELLCPTIRSR in isoform 2. 1 PublicationVSP_055577

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D00408 mRNA. Translation: BAA00310.1.
    AF315325 mRNA. Translation: AAG48618.1.
    AF280107 Genomic DNA. Translation: AAG32289.1.
    CH236956 Genomic DNA. Translation: EAL23867.1.
    CH471091 Genomic DNA. Translation: EAW76637.1.
    BC067436 mRNA. Translation: AAH67436.1.
    CCDSiCCDS5673.1.
    PIRiJX0062.
    RefSeqiNP_000756.3. NM_000765.4.
    UniGeneiHs.111944.

    Genome annotation databases

    EnsembliENST00000336374; ENSP00000337450; ENSG00000160870. [P24462-1]
    GeneIDi1551.
    KEGGihsa:1551.
    UCSCiuc003uru.3. human.

    Polymorphism databases

    DMDMi90110014.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Cytochrome P450 Allele Nomenclature Committee

    CYP3A7 alleles

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D00408 mRNA. Translation: BAA00310.1 .
    AF315325 mRNA. Translation: AAG48618.1 .
    AF280107 Genomic DNA. Translation: AAG32289.1 .
    CH236956 Genomic DNA. Translation: EAL23867.1 .
    CH471091 Genomic DNA. Translation: EAW76637.1 .
    BC067436 mRNA. Translation: AAH67436.1 .
    CCDSi CCDS5673.1.
    PIRi JX0062.
    RefSeqi NP_000756.3. NM_000765.4.
    UniGenei Hs.111944.

    3D structure databases

    ProteinModelPortali P24462.
    SMRi P24462. Positions 29-497.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000337450.

    Chemistry

    ChEMBLi CHEMBL2364675.

    PTM databases

    PhosphoSitei P24462.

    Polymorphism databases

    DMDMi 90110014.

    Proteomic databases

    MaxQBi P24462.
    PaxDbi P24462.
    PRIDEi P24462.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000336374 ; ENSP00000337450 ; ENSG00000160870 . [P24462-1 ]
    GeneIDi 1551.
    KEGGi hsa:1551.
    UCSCi uc003uru.3. human.

    Organism-specific databases

    CTDi 100861540.
    1551.
    GeneCardsi GC07M099293.
    HGNCi HGNC:2640. CYP3A7.
    MIMi 605340. gene.
    neXtProti NX_P24462.
    PharmGKBi PA122.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOGENOMi HOG000039127.
    HOVERGENi HBG108567.
    KOi K17691.
    OMAi RAEDEEW.
    OrthoDBi EOG744TBS.
    PhylomeDBi P24462.
    TreeFami TF105087.

    Enzyme and pathway databases

    Reactomei REACT_13543. Xenobiotics.

    Miscellaneous databases

    GeneWikii CYP3A7.
    GenomeRNAii 1551.
    NextBioi 6413.
    PROi P24462.
    SOURCEi Search...

    Gene expression databases

    Bgeei P24462.
    CleanExi HS_CYP3A7.
    Genevestigatori P24462.

    Family and domain databases

    Gene3Di 1.10.630.10. 1 hit.
    InterProi IPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR008072. Cyt_P450_E_CYP3A.
    IPR002402. Cyt_P450_E_grp-II.
    [Graphical view ]
    Pfami PF00067. p450. 1 hit.
    [Graphical view ]
    PRINTSi PR00464. EP450II.
    PR01689. EP450IICYP3A.
    PR00385. P450.
    SUPFAMi SSF48264. SSF48264. 1 hit.
    PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and sequence analysis of cDNA containing the entire coding region for human fetal liver cytochrome P-450."
      Komori M., Nishio K., Ohi H., Kitada M., Kamataki T.
      J. Biochem. 105:161-163(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-409.
      Tissue: Fetal liver.
    2. "The human cytochrome P450 3A locus. Gene evolution by capture of downstream exons."
      Finta C., Zaphiropoulos P.G.
      Gene 260:13-23(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT THR-409.
    3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-409.
    4. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-409.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-409.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-409.
    7. "Isolation and characterization of human fetal liver cytochrome P450HLp2: a third member of the P450III gene family."
      Wrighton S.A., Vandenbranden M.
      Arch. Biochem. Biophys. 268:144-151(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 1-30.
      Tissue: Fetal liver.
    8. "Isolation of a new human fetal liver cytochrome P450 cDNA clone: evidence for expression of a limited number of forms of cytochrome P450 in human fetal livers."
      Komori M., Nishio K., Fujitani T., Ohi H., Kitada M., Mima S., Itahashi K., Kamataki T.
      Arch. Biochem. Biophys. 272:219-225(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 282-503 (ISOFORM 1), VARIANT THR-409.
      Tissue: Fetal liver.

    Entry informationi

    Entry nameiCP3A7_HUMAN
    AccessioniPrimary (citable) accession number: P24462
    Secondary accession number(s): A4D288, Q9H241
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 1992
    Last sequence update: March 21, 2006
    Last modified: October 1, 2014
    This is version 139 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3