Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P24462

- CP3A7_HUMAN

UniProt

P24462 - CP3A7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytochrome P450 3A7

Gene

CYP3A7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Catalytic activityi

RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

Cofactori

Heme group.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi442 – 4421Iron (heme axial ligand)By similarity

GO - Molecular functioni

  1. aromatase activity Source: UniProtKB-EC
  2. heme binding Source: InterPro
  3. iron ion binding Source: InterPro
  4. monooxygenase activity Source: UniProtKB
  5. oxygen binding Source: ProtInc

GO - Biological processi

  1. small molecule metabolic process Source: Reactome
  2. xenobiotic metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_13543. Xenobiotics.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 3A7 (EC:1.14.14.1)
Alternative name(s):
CYPIIIA7
Cytochrome P450-HFLA
Gene namesi
Name:CYP3A7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:2640. CYP3A7.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA122.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 503503Cytochrome P450 3A7PRO_0000051790Add
BLAST

Proteomic databases

MaxQBiP24462.
PaxDbiP24462.
PRIDEiP24462.

PTM databases

PhosphoSiteiP24462.

Expressioni

Inductioni

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Gene expression databases

BgeeiP24462.
CleanExiHS_CYP3A7.
ExpressionAtlasiP24462. baseline and differential.
GenevestigatoriP24462.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000337450.

Structurei

3D structure databases

ProteinModelPortaliP24462.
SMRiP24462. Positions 29-497.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiCOG2124.
GeneTreeiENSGT00760000118816.
HOGENOMiHOG000039127.
HOVERGENiHBG108567.
InParanoidiP24462.
KOiK17691.
OMAiRAEDEEW.
OrthoDBiEOG744TBS.
PhylomeDBiP24462.
TreeFamiTF105087.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P24462) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA
60 70 80 90 100
LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS
110 120 130 140 150
VFTNRRPFGP VGFMKNAISI AEDEEWKRIR SLLSPTFTSG KLKEMVPIIA
160 170 180 190 200
QYGDVLVRNL RREAETGKPV TLKHVFGAYS MDVITSTSFG VSIDSLNNPQ
210 220 230 240 250
DPFVENTKKL LRFNPLDPFV LSIKVFPFLT PILEALNITV FPRKVISFLT
260 270 280 290 300
KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI
310 320 330 340 350
IFIFAGYETT SSVLSFIIYE LATHPDVQQK VQKEIDTVLP NKAPPTYDTV
360 370 380 390 400
LQLEYLDMVV NETLRLFPVA MRLERVCKKD VEINGMFIPK GVVVMIPSYV
410 420 430 440 450
LHHDPKYWRE PEKFLPERFS KKNKDNIDPY IYTPFGSGPR NCIGMRFALV
460 470 480 490 500
NMKLALVRVL QNFSFKPCKE TQIPLKLRFG GLLLTEKPIV LKAESRDETV

SGA
Length:503
Mass (Da):57,526
Last modified:March 21, 2006 - v2
Checksum:i0D869148640C372A
GO
Isoform 2 (identifier: P24462-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-503: VSGA → FVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR

Show »
Length:535
Mass (Da):61,547
Checksum:iD18210E5236E15B4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti71 – 711V → A.
Corresponds to variant rs45580339 [ dbSNP | Ensembl ].
VAR_055564
Natural varianti409 – 4091R → T.7 Publications
Corresponds to variant rs2257401 [ dbSNP | Ensembl ].
VAR_020124

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei500 – 5034VSGA → FVDMEPIHMDFLRSLAFQGP HLCFFWELLCPTIRSR in isoform 2. 1 PublicationVSP_055577

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D00408 mRNA. Translation: BAA00310.1.
AF315325 mRNA. Translation: AAG48618.1.
AF280107 Genomic DNA. Translation: AAG32289.1.
CH236956 Genomic DNA. Translation: EAL23867.1.
CH471091 Genomic DNA. Translation: EAW76637.1.
BC067436 mRNA. Translation: AAH67436.1.
CCDSiCCDS5673.1. [P24462-1]
PIRiJX0062.
RefSeqiNP_000756.3. NM_000765.4.
NP_001243426.2. NM_001256497.2.
UniGeneiHs.111944.

Genome annotation databases

EnsembliENST00000336374; ENSP00000337450; ENSG00000160870.
ENST00000611620; ENSP00000480571; ENSG00000160870.
GeneIDi100861540.
1551.
KEGGihsa:100861540.
hsa:1551.
UCSCiuc003uru.3. human. [P24462-1]

Polymorphism databases

DMDMi90110014.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP3A7 alleles

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D00408 mRNA. Translation: BAA00310.1 .
AF315325 mRNA. Translation: AAG48618.1 .
AF280107 Genomic DNA. Translation: AAG32289.1 .
CH236956 Genomic DNA. Translation: EAL23867.1 .
CH471091 Genomic DNA. Translation: EAW76637.1 .
BC067436 mRNA. Translation: AAH67436.1 .
CCDSi CCDS5673.1. [P24462-1 ]
PIRi JX0062.
RefSeqi NP_000756.3. NM_000765.4.
NP_001243426.2. NM_001256497.2.
UniGenei Hs.111944.

3D structure databases

ProteinModelPortali P24462.
SMRi P24462. Positions 29-497.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000337450.

Chemistry

ChEMBLi CHEMBL2364675.
DrugBanki DB00802. Alfentanil.
DB00404. Alprazolam.
DB01424. Aminophenazone.
DB01118. Amiodarone.
DB00381. Amlodipine.
DB00673. Aprepitant.
DB01238. Aripiprazole.
DB00637. Astemizole.
DB01076. Atorvastatin.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB00201. Caffeine.
DB00564. Carbamazepine.
DB00446. Chloramphenicol.
DB01114. Chlorphenamine.
DB01166. Cilostazol.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00604. Cisapride.
DB01211. Clarithromycin.
DB00257. Clotrimazole.
DB00907. Cocaine.
DB00318. Codeine.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB00250. Dapsone.
DB00705. Delavirdine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00647. Dextropropoxyphene.
DB00829. Diazepam.
DB00343. Diltiazem.
DB01248. Docetaxel.
DB08930. Dolutegravir.
DB01184. Domperidone.
DB00700. Eplerenone.
DB00199. Erythromycin.
DB00783. Estradiol.
DB00593. Ethosuximide.
DB01466. Ethylmorphine.
DB01023. Felodipine.
DB00813. Fentanyl.
DB01216. Finasteride.
DB00196. Fluconazole.
DB00588. Fluticasone Propionate.
DB00176. Fluvoxamine.
DB06730. Gestodene.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01181. Ifosfamide.
DB04946. Iloperidone.
DB00619. Imatinib.
DB00458. Imipramine.
DB00224. Indinavir.
DB00762. Irinotecan.
DB01167. Itraconazole.
DB01026. Ketoconazole.
DB00528. Lercanidipine.
DB01227. Levomethadyl Acetate.
DB00281. Lidocaine.
DB00227. Lovastatin.
DB00333. Methadone.
DB00683. Midazolam.
DB00834. Mifepristone.
DB00731. Nateglinide.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01115. Nifedipine.
DB00401. Nisoldipine.
DB01054. Nitrendipine.
DB00717. Norethindrone.
DB01059. Norfloxacin.
DB00904. Ondansetron.
DB00842. Oxazepam.
DB00497. Oxycodone.
DB01229. Paclitaxel.
DB00780. Phenelzine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB01058. Praziquantel.
DB00396. Progesterone.
DB00571. Propranolol.
DB01224. Quetiapine.
DB00908. Quinidine.
DB00468. Quinine.
DB01045. Rifampicin.
DB01201. Rifapentine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB00938. Salmeterol.
DB01232. Saquinavir.
DB00203. Sildenafil.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB00398. Sorafenib.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB00976. Telithromycin.
DB06287. Temsirolimus.
DB00624. Testosterone.
DB00656. Trazodone.
DB00755. Tretinoin.
DB00897. Triazolam.
DB00661. Verapamil.
DB00541. Vincristine.
DB00582. Voriconazole.
DB00943. Zalcitabine.
DB00962. Zaleplon.
DB00246. Ziprasidone.
DB00425. Zolpidem.

PTM databases

PhosphoSitei P24462.

Polymorphism databases

DMDMi 90110014.

Proteomic databases

MaxQBi P24462.
PaxDbi P24462.
PRIDEi P24462.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000336374 ; ENSP00000337450 ; ENSG00000160870 .
ENST00000611620 ; ENSP00000480571 ; ENSG00000160870 .
GeneIDi 100861540.
1551.
KEGGi hsa:100861540.
hsa:1551.
UCSCi uc003uru.3. human. [P24462-1 ]

Organism-specific databases

CTDi 100861540.
1551.
GeneCardsi GC07M099293.
HGNCi HGNC:2640. CYP3A7.
MIMi 605340. gene.
neXtProti NX_P24462.
PharmGKBi PA122.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2124.
GeneTreei ENSGT00760000118816.
HOGENOMi HOG000039127.
HOVERGENi HBG108567.
InParanoidi P24462.
KOi K17691.
OMAi RAEDEEW.
OrthoDBi EOG744TBS.
PhylomeDBi P24462.
TreeFami TF105087.

Enzyme and pathway databases

Reactomei REACT_13543. Xenobiotics.

Miscellaneous databases

GeneWikii CYP3A7.
GenomeRNAii 1551.
NextBioi 6413.
PROi P24462.
SOURCEi Search...

Gene expression databases

Bgeei P24462.
CleanExi HS_CYP3A7.
ExpressionAtlasi P24462. baseline and differential.
Genevestigatori P24462.

Family and domain databases

Gene3Di 1.10.630.10. 1 hit.
InterProi IPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
[Graphical view ]
Pfami PF00067. p450. 1 hit.
[Graphical view ]
PRINTSi PR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMi SSF48264. SSF48264. 1 hit.
PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and sequence analysis of cDNA containing the entire coding region for human fetal liver cytochrome P-450."
    Komori M., Nishio K., Ohi H., Kitada M., Kamataki T.
    J. Biochem. 105:161-163(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-409.
    Tissue: Fetal liver.
  2. "The human cytochrome P450 3A locus. Gene evolution by capture of downstream exons."
    Finta C., Zaphiropoulos P.G.
    Gene 260:13-23(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT THR-409.
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-409.
  4. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-409.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-409.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-409.
  7. "Isolation and characterization of human fetal liver cytochrome P450HLp2: a third member of the P450III gene family."
    Wrighton S.A., Vandenbranden M.
    Arch. Biochem. Biophys. 268:144-151(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 1-30.
    Tissue: Fetal liver.
  8. "Isolation of a new human fetal liver cytochrome P450 cDNA clone: evidence for expression of a limited number of forms of cytochrome P450 in human fetal livers."
    Komori M., Nishio K., Fujitani T., Ohi H., Kitada M., Mima S., Itahashi K., Kamataki T.
    Arch. Biochem. Biophys. 272:219-225(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 282-503 (ISOFORM 1), VARIANT THR-409.
    Tissue: Fetal liver.

Entry informationi

Entry nameiCP3A7_HUMAN
AccessioniPrimary (citable) accession number: P24462
Secondary accession number(s): A4D288, Q9H241
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: March 21, 2006
Last modified: October 29, 2014
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3