Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 3A7

Gene

CYP3A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Catalytic activityi

RH + [reduced NADPH--hemoprotein reductase] + O2 = ROH + [oxidized NADPH--hemoprotein reductase] + H2O.

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi442Iron (heme axial ligand)By similarity1

GO - Molecular functioni

  • aromatase activity Source: UniProtKB-EC
  • estrogen 16-alpha-hydroxylase activity Source: BHF-UCL
  • heme binding Source: InterPro
  • iron ion binding Source: InterPro
  • monooxygenase activity Source: UniProtKB
  • oxygen binding Source: Reactome
  • steroid hydroxylase activity Source: BHF-UCL

GO - Biological processi

  • lipid hydroxylation Source: BHF-UCL
  • steroid metabolic process Source: BHF-UCL
  • xenobiotic metabolic process Source: Reactome

Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BRENDAi1.14.14.1. 2681.
ReactomeiR-HSA-211981. Xenobiotics.

Chemistry databases

SwissLipidsiSLP:000001324.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 3A7 (EC:1.14.14.1)
Alternative name(s):
CYPIIIA7
Cytochrome P450-HFLA
Gene namesi
Name:CYP3A7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000160870.12.
HostDB:ENSG00000282301.1.
HGNCiHGNC:2640. CYP3A7.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi100861540.
1551.
PharmGKBiPA122.

Chemistry databases

ChEMBLiCHEMBL3341582.
DrugBankiDB00802. Alfentanil.
DB00404. Alprazolam.
DB01424. Aminophenazone.
DB01118. Amiodarone.
DB00381. Amlodipine.
DB00673. Aprepitant.
DB01238. Aripiprazole.
DB00637. Astemizole.
DB01076. Atorvastatin.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB00201. Caffeine.
DB00564. Carbamazepine.
DB00439. Cerivastatin.
DB00446. Chloramphenicol.
DB01114. Chlorphenamine.
DB01166. Cilostazol.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00604. Cisapride.
DB01211. Clarithromycin.
DB00257. Clotrimazole.
DB05239. Cobimetinib.
DB00907. Cocaine.
DB00318. Codeine.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB09102. Daclatasvir.
DB00250. Dapsone.
DB05804. dehydroepiandrosterone sulfate.
DB00705. Delavirdine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00647. Dextropropoxyphene.
DB00829. Diazepam.
DB00343. Diltiazem.
DB01248. Docetaxel.
DB08930. Dolutegravir.
DB01184. Domperidone.
DB00700. Eplerenone.
DB00199. Erythromycin.
DB00783. Estradiol.
DB00593. Ethosuximide.
DB01466. Ethylmorphine.
DB01023. Felodipine.
DB00813. Fentanyl.
DB01216. Finasteride.
DB00196. Fluconazole.
DB00588. Fluticasone Propionate.
DB00176. Fluvoxamine.
DB06730. Gestodene.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01181. Ifosfamide.
DB04946. Iloperidone.
DB00619. Imatinib.
DB00458. Imipramine.
DB00224. Indinavir.
DB00762. Irinotecan.
DB01167. Itraconazole.
DB01026. Ketoconazole.
DB00528. Lercanidipine.
DB01227. Levomethadyl Acetate.
DB00281. Lidocaine.
DB00227. Lovastatin.
DB00333. Methadone.
DB01388. Mibefradil.
DB00683. Midazolam.
DB00834. Mifepristone.
DB00731. Nateglinide.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01115. Nifedipine.
DB00401. Nisoldipine.
DB01054. Nitrendipine.
DB00717. Norethisterone.
DB01059. Norfloxacin.
DB00904. Ondansetron.
DB00842. Oxazepam.
DB00497. Oxycodone.
DB01229. Paclitaxel.
DB00780. Phenelzine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB01708. Prasterone.
DB01058. Praziquantel.
DB00396. Progesterone.
DB09396. Propoxyphene napsylate.
DB00571. Propranolol.
DB01224. Quetiapine.
DB00908. Quinidine.
DB00468. Quinine.
DB01045. Rifampicin.
DB01201. Rifapentine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB00938. Salmeterol.
DB01232. Saquinavir.
DB06731. Seproxetine.
DB00203. Sildenafil.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB00398. Sorafenib.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB00976. Telithromycin.
DB06287. Temsirolimus.
DB00342. Terfenadine.
DB00624. Testosterone.
DB00656. Trazodone.
DB00755. Tretinoin.
DB00897. Triazolam.
DB00197. Troglitazone.
DB00661. Verapamil.
DB00541. Vincristine.
DB00582. Voriconazole.
DB00943. Zalcitabine.
DB00962. Zaleplon.
DB00246. Ziprasidone.
DB00425. Zolpidem.

Polymorphism and mutation databases

BioMutaiCYP3A7.
DMDMi90110014.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000517901 – 503Cytochrome P450 3A7Add BLAST503

Proteomic databases

MaxQBiP24462.
PaxDbiP24462.
PeptideAtlasiP24462.
PRIDEiP24462.

PTM databases

iPTMnetiP24462.
PhosphoSitePlusiP24462.

Expressioni

Inductioni

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Gene expression databases

BgeeiENSG00000160870.
CleanExiHS_CYP3A7.
GenevisibleiP24462. HS.

Organism-specific databases

HPAiHPA072245.

Interactioni

Protein-protein interaction databases

BioGridi107930. 4 interactors.
STRINGi9606.ENSP00000337450.

Chemistry databases

BindingDBiP24462.

Structurei

3D structure databases

ProteinModelPortaliP24462.
SMRiP24462.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiKOG0158. Eukaryota.
COG2124. LUCA.
HOGENOMiHOG000039127.
HOVERGENiHBG108567.
InParanoidiP24462.
KOiK17691.
OrthoDBiEOG091G0JNC.
PhylomeDBiP24462.
TreeFamiTF105087.

Family and domain databases

InterProiView protein in InterPro
IPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
PfamiView protein in Pfam
PF00067. p450. 1 hit.
PRINTSiPR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiView protein in PROSITE
PS00086. CYTOCHROME_P450. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P24462-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA
60 70 80 90 100
LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS
110 120 130 140 150
VFTNRRPFGP VGFMKNAISI AEDEEWKRIR SLLSPTFTSG KLKEMVPIIA
160 170 180 190 200
QYGDVLVRNL RREAETGKPV TLKHVFGAYS MDVITSTSFG VSIDSLNNPQ
210 220 230 240 250
DPFVENTKKL LRFNPLDPFV LSIKVFPFLT PILEALNITV FPRKVISFLT
260 270 280 290 300
KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI
310 320 330 340 350
IFIFAGYETT SSVLSFIIYE LATHPDVQQK VQKEIDTVLP NKAPPTYDTV
360 370 380 390 400
LQLEYLDMVV NETLRLFPVA MRLERVCKKD VEINGMFIPK GVVVMIPSYV
410 420 430 440 450
LHHDPKYWRE PEKFLPERFS KKNKDNIDPY IYTPFGSGPR NCIGMRFALV
460 470 480 490 500
NMKLALVRVL QNFSFKPCKE TQIPLKLRFG GLLLTEKPIV LKAESRDETV

SGA
Length:503
Mass (Da):57,526
Last modified:March 21, 2006 - v2
Checksum:i0D869148640C372A
GO
Isoform 2 (identifier: P24462-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-503: VSGA → FVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR

Show »
Length:535
Mass (Da):61,547
Checksum:iD18210E5236E15B4
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05556471V → A. Corresponds to variant dbSNP:rs45580339Ensembl.1
Natural variantiVAR_020124409R → T7 PublicationsCorresponds to variant dbSNP:rs2257401Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055577500 – 503VSGA → FVDMEPIHMDFLRSLAFQGP HLCFFWELLCPTIRSR in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D00408 mRNA. Translation: BAA00310.1.
AF315325 mRNA. Translation: AAG48618.1.
AF280107 Genomic DNA. Translation: AAG32289.1.
CH236956 Genomic DNA. Translation: EAL23867.1.
CH471091 Genomic DNA. Translation: EAW76637.1.
BC067436 mRNA. Translation: AAH67436.1.
CCDSiCCDS5673.1. [P24462-1]
PIRiJX0062.
RefSeqiNP_000756.3. NM_000765.4.
NP_001243426.2. NM_001256497.2.
UniGeneiHs.111944.

Genome annotation databases

EnsembliENST00000336374; ENSP00000337450; ENSG00000160870.
ENST00000611620; ENSP00000480571; ENSG00000160870.
GeneIDi100861540.
1551.
KEGGihsa:100861540.
hsa:1551.
UCSCiuc003uru.4. human. [P24462-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCP3A7_HUMAN
AccessioniPrimary (citable) accession number: P24462
Secondary accession number(s): A4D288, Q9H241
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: March 21, 2006
Last modified: September 27, 2017
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families