Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Follicle-stimulating hormone receptor

Gene

FSHR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and SRC-ERK1/2 signaling pathways.1 Publication

GO - Molecular functioni

  • follicle-stimulating hormone receptor activity Source: ProtInc
  • G-protein coupled peptide receptor activity Source: GO_Central

GO - Biological processi

  • activation of adenylate cyclase activity Source: GO_Central
  • adenylate cyclase-activating G-protein coupled receptor signaling pathway Source: GO_Central
  • female gamete generation Source: ProtInc
  • female gonad development Source: ProtInc
  • gonad development Source: ProtInc
  • G-protein coupled receptor signaling pathway Source: ProtInc
  • hormone-mediated signaling pathway Source: GO_Central
  • male gonad development Source: UniProtKB
  • positive regulation of ERK1 and ERK2 cascade Source: UniProtKB
  • positive regulation of phosphatidylinositol 3-kinase signaling Source: UniProtKB
  • primary ovarian follicle growth Source: GO_Central
  • regulation of osteoclast differentiation Source: GO_Central
  • regulation of protein kinase A signaling Source: UniProtKB
  • spermatogenesis Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170820-MONOMER.
ReactomeiR-HSA-375281. Hormone ligand-binding receptors.
R-HSA-418555. G alpha (s) signalling events.
SignaLinkiP23945.

Protein family/group databases

TCDBi9.A.14.1.5. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Follicle-stimulating hormone receptor
Short name:
FSH-R
Alternative name(s):
Follitropin receptor
Gene namesi
Name:FSHR
Synonyms:LGR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:3969. FSHR.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 366ExtracellularSequence analysisAdd BLAST349
Transmembranei367 – 387Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini388 – 398CytoplasmicSequence analysisAdd BLAST11
Transmembranei399 – 421Helical; Name=2Sequence analysisAdd BLAST23
Topological domaini422 – 443ExtracellularSequence analysisAdd BLAST22
Transmembranei444 – 465Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini466 – 485CytoplasmicSequence analysisAdd BLAST20
Transmembranei486 – 508Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini509 – 528ExtracellularSequence analysisAdd BLAST20
Transmembranei529 – 550Helical; Name=5Sequence analysisAdd BLAST22
Topological domaini551 – 573CytoplasmicSequence analysisAdd BLAST23
Transmembranei574 – 597Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini598 – 608ExtracellularSequence analysisAdd BLAST11
Transmembranei609 – 630Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini631 – 695CytoplasmicSequence analysisAdd BLAST65

GO - Cellular componenti

  • integral component of membrane Source: ProtInc
  • integral component of plasma membrane Source: GO_Central
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Ovarian dysgenesis 1 (ODG1)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, poorly developed streak ovaries, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).
See also OMIM:233300
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Ovarian hyperstimulation syndrome (OHSS)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionDisorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis.
See also OMIM:608115
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant rs28928870dbSNPEnsembl.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant rs28928871dbSNPEnsembl.1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi2492.
MalaCardsiFSHR.
MIMi233300. phenotype.
608115. phenotype.
Orphaneti243. 46,XX gonadal dysgenesis.
64739. Ovarian hyperstimulation syndrome.
619. Primary ovarian failure.
PharmGKBiPA28386.

Chemistry databases

ChEMBLiCHEMBL2024.
DrugBankiDB00097. Choriogonadotropin alfa.
DB00066. Follitropin beta.
DB00032. Menotropins.
DB04786. Suramin.
DB00094. Urofollitropin.
GuidetoPHARMACOLOGYi253.

Polymorphism and mutation databases

BioMutaiFSHR.
DMDMi311033420.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 17Sequence analysisAdd BLAST17
ChainiPRO_000001277118 – 695Follicle-stimulating hormone receptorAdd BLAST678

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi18 ↔ 25PROSITE-ProRule annotation1 Publication
Disulfide bondi23 ↔ 32PROSITE-ProRule annotation1 Publication
Glycosylationi191N-linked (GlcNAc...)1 Publication1
Glycosylationi199N-linked (GlcNAc...)Sequence analysis1
Glycosylationi293N-linked (GlcNAc...)By similarity1
Glycosylationi318N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi442 ↔ 517PROSITE-ProRule annotation

Post-translational modificationi

N-glycosylated; indirectly required for FSH-binding, possibly via a conformational change that allows high affinity binding of hormone.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP23945.
PeptideAtlasiP23945.
PRIDEiP23945.

PTM databases

iPTMnetiP23945.
PhosphoSitePlusiP23945.

Expressioni

Tissue specificityi

Sertoli cells and ovarian granulosa cells.

Gene expression databases

BgeeiENSG00000170820.
CleanExiHS_FSHR.
ExpressionAtlasiP23945. baseline and differential.
GenevisibleiP23945. HS.

Interactioni

Subunit structurei

Interacts with ARRB2.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAQP273484EBI-848239,EBI-359854

Protein-protein interaction databases

BioGridi108770. 32 interactors.
DIPiDIP-35605N.
IntActiP23945. 2 interactors.
MINTiMINT-1177926.
STRINGi9606.ENSP00000384708.

Chemistry databases

BindingDBiP23945.

Structurei

Secondary structure

1695
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi21 – 26Combined sources6
Beta strandi29 – 34Combined sources6
Beta strandi49 – 55Combined sources7
Beta strandi59 – 61Combined sources3
Turni63 – 68Combined sources6
Beta strandi74 – 78Combined sources5
Turni88 – 90Combined sources3
Beta strandi99 – 105Combined sources7
Beta strandi115 – 117Combined sources3
Beta strandi124 – 130Combined sources7
Beta strandi143 – 145Combined sources3
Beta strandi147 – 153Combined sources7
Beta strandi168 – 171Combined sources4
Beta strandi173 – 176Combined sources4
Turni187 – 192Combined sources6
Beta strandi193 – 199Combined sources7
Turni211 – 216Combined sources6
Beta strandi221 – 224Combined sources4
Beta strandi235 – 237Combined sources3
Beta strandi243 – 245Combined sources3
Turni258 – 260Combined sources3
Beta strandi266 – 268Combined sources3
Helixi272 – 280Combined sources9
Beta strandi345 – 348Combined sources4
Beta strandi351 – 353Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XUNmodel-A49-228[»]
1XWDX-ray2.92C/F17-268[»]
4AY9X-ray2.50X/Y/Z17-366[»]
4MQWX-ray2.90X/Y/Z16-366[»]
ProteinModelPortaliP23945.
SMRiP23945.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23945.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 46LRRNTAdd BLAST29
Repeati49 – 72LRR 1Add BLAST24
Repeati73 – 97LRR 2Add BLAST25
Repeati98 – 118LRR 3Add BLAST21
Repeati119 – 143LRR 4Add BLAST25
Repeati144 – 169LRR 5Add BLAST26
Repeati170 – 192LRR 6Add BLAST23
Repeati193 – 216LRR 7Add BLAST24
Repeati217 – 240LRR 8Add BLAST24
Repeati241 – 259LRR 9Add BLAST19

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.PROSITE-ProRule annotation
Contains 9 LRR (leucine-rich) repeats.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2087. Eukaryota.
ENOG410XR1T. LUCA.
HOGENOMiHOG000045902.
HOVERGENiHBG003521.
InParanoidiP23945.
KOiK04247.
OMAiFILLSKC.
OrthoDBiEOG091G02BV.
PhylomeDBiP23945.
TreeFamiTF316814.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR002272. FSH_rcpt.
IPR024635. GnHR_TM.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR002131. Gphrmn_rcpt_fam.
IPR032675. L_dom-like.
IPR026906. LRR_5.
IPR000372. LRRNT.
[Graphical view]
PANTHERiPTHR24372. PTHR24372. 1 hit.
PTHR24372:SF5. PTHR24372:SF5. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
PF12369. GnHR_trans. 1 hit.
PF13306. LRR_5. 2 hits.
PF01462. LRRNT. 1 hit.
[Graphical view]
PRINTSiPR01143. FSHRECEPTOR.
PR00373. GLYCHORMONER.
PR00237. GPCRRHODOPSN.
SMARTiSM00013. LRRNT. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: P23945-1) [UniParc]FASTAAdd to basket
Also known as: R1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALLLVSLLA FLSLGSGCHH RICHCSNRVF LCQESKVTEI PSDLPRNAIE
60 70 80 90 100
LRFVLTKLRV IQKGAFSGFG DLEKIEISQN DVLEVIEADV FSNLPKLHEI
110 120 130 140 150
RIEKANNLLY INPEAFQNLP NLQYLLISNT GIKHLPDVHK IHSLQKVLLD
160 170 180 190 200
IQDNINIHTI ERNSFVGLSF ESVILWLNKN GIQEIHNCAF NGTQLDELNL
210 220 230 240 250
SDNNNLEELP NDVFHGASGP VILDISRTRI HSLPSYGLEN LKKLRARSTY
260 270 280 290 300
NLKKLPTLEK LVALMEASLT YPSHCCAFAN WRRQISELHP ICNKSILRQE
310 320 330 340 350
VDYMTQARGQ RSSLAEDNES SYSRGFDMTY TEFDYDLCNE VVDVTCSPKP
360 370 380 390 400
DAFNPCEDIM GYNILRVLIW FISILAITGN IIVLVILTTS QYKLTVPRFL
410 420 430 440 450
MCNLAFADLC IGIYLLLIAS VDIHTKSQYH NYAIDWQTGA GCDAAGFFTV
460 470 480 490 500
FASELSVYTL TAITLERWHT ITHAMQLDCK VQLRHAASVM VMGWIFAFAA
510 520 530 540 550
ALFPIFGISS YMKVSICLPM DIDSPLSQLY VMSLLVLNVL AFVVICGCYI
560 570 580 590 600
HIYLTVRNPN IVSSSSDTRI AKRMAMLIFT DFLCMAPISF FAISASLKVP
610 620 630 640 650
LITVSKAKIL LVLFHPINSC ANPFLYAIFT KNFRRDFFIL LSKCGCYEMQ
660 670 680 690
AQIYRTETSS TVHNTHPRNG HCSSAPRVTN GSTYILVPLS HLAQN
Length:695
Mass (Da):78,265
Last modified:November 2, 2010 - v3
Checksum:i766BC421014CD5A4
GO
Isoform Short (identifier: P23945-2) [UniParc]FASTAAdd to basket
Also known as: E9Del

The sequence of this isoform differs from the canonical sequence as follows:
     224-285: Missing.

Show »
Length:633
Mass (Da):71,079
Checksum:iAEB5E6DE7905AD41
GO
Isoform 3 (identifier: P23945-3) [UniParc]FASTAAdd to basket
Also known as: E6Del

The sequence of this isoform differs from the canonical sequence as follows:
     149-174: Missing.

Show »
Length:669
Mass (Da):75,309
Checksum:i13EBEE0CB4E1EEB9
GO
Isoform 4 (identifier: P23945-4) [UniParc]FASTAAdd to basket
Also known as: E8'Inc

The sequence of this isoform differs from the canonical sequence as follows:
     223-223: L → LNRRTRTPTEPNVLLAKYPSGQGVLEEPESLSSSI

Show »
Length:729
Mass (Da):81,974
Checksum:i4C3BE97328EE2E34
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti13S → R in CAA48179 (PubMed:1359889).Curated1
Sequence conflicti112N → T in AAA52477 (PubMed:1709010).Curated1
Sequence conflicti197 – 198EL → AV in AAA52477 (PubMed:1709010).Curated2
Sequence conflicti295S → P in CAA48179 (PubMed:1359889).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039279128S → Y in OHSS; displays increase in affinity and sensitivity toward hCG and does not show any constitutive activity nor promiscuous activation by TSH. 1 Publication1
Natural variantiVAR_018045160I → T in ODG1; impairs cell surface expression. 1 Publication1
Natural variantiVAR_018046189A → V in ODG1; very frequent in the Finnish population. 2 Publications1
Natural variantiVAR_039280224D → V in ODG1; FSH binding is barely detectable; impaired targeting to the cell membrane; adenylate cyclase stimulation by FSH is 4 +-2% residual activity. 1 Publication1
Natural variantiVAR_013903307A → T.9 PublicationsCorresponds to variant rs6165dbSNPEnsembl.1
Natural variantiVAR_039281348P → R in ODG1. 1 Publication1
Natural variantiVAR_018047419A → T in ODG1. 1 Publication1
Natural variantiVAR_039282449T → A in OHSS; increase of receptor sensitivity to both hCG and TSH together with an increase in basal activity. 1 Publication1
Natural variantiVAR_017244449T → I in OHSS. 1 PublicationCorresponds to variant rs28928870dbSNPEnsembl.1
Natural variantiVAR_074535512M → I in OHSS; inhibits activation of PI3K/AKT signaling pathway; reduces cAMP production; no effect on ERK1/2 signaling pathway activation. 1 Publication1
Natural variantiVAR_074536514V → A in OHSS; increases cell surface expression; no effect on hormone binding; increases signaling activity. 1 Publication1
Natural variantiVAR_039283519P → T in ODG1; totally impairs adenylate cyclase stimulation in vitro; alters the cell surface targeting of the receptor which remains trapped intracellularly. 1 Publication1
Natural variantiVAR_013904524S → R.1 PublicationCorresponds to variant rs6167dbSNPEnsembl.1
Natural variantiVAR_039284545I → T in OHSS; displays promiscuous activation by both hCG and TSH together with detectable constitutive activity. 1 Publication1
Natural variantiVAR_039285567D → G Activating mutation resulting in 1.5-fold increase in basal cAMP production compared to the wild-type receptor. 1 Publication1
Natural variantiVAR_017245567D → N in OHSS. 1 PublicationCorresponds to variant rs28928871dbSNPEnsembl.1
Natural variantiVAR_018048573R → C in ODG1; alters signal transduction of the receptor; adenylate cyclase stimulation by FSH is 24 +-4% residual activity. 2 Publications1
Natural variantiVAR_074537575A → V in OHSS; decreases cell surface expression; no effect on hormone binding; increases levels of internalized hormone receptor complex; cAMP levels are similar to basal levels even at high doses of FSH stimulation indicating reduced signaling. 1 Publication1
Natural variantiVAR_018049591F → S in ovarian sex cord tumor; loss of function. 1 Publication1
Natural variantiVAR_039286601L → V in ODG1; binds FSH with a similar affinity than the wild-type receptor; adenylate cyclase stimulation by FSH is 12 +-3% residual activity. 1 Publication1
Natural variantiVAR_013905680N → S Associated with longer menstrual cycles. 7 PublicationsCorresponds to variant rs6166dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043181149 – 174Missing in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_053411223L → LNRRTRTPTEPNVLLAKYPS GQGVLEEPESLSSSI in isoform 4. Curated1
Alternative sequenceiVSP_001953224 – 285Missing in isoform Short. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65085 mRNA. Translation: AAA52477.1.
M95489 mRNA. Translation: AAA52478.1.
S59900 mRNA. Translation: AAB26480.1.
JN003607 mRNA. Translation: AEI86722.1.
AY429104 mRNA. Translation: AAR07899.1.
AK292562 mRNA. Translation: BAF85251.1.
AC007189 Genomic DNA. No translation available.
AC079394 Genomic DNA. No translation available.
AC092533 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00188.1.
CH471053 Genomic DNA. Translation: EAX00189.1.
BC096831 mRNA. Translation: AAH96831.1.
BC118548 mRNA. Translation: AAI18549.1.
BC125270 mRNA. Translation: AAI25271.1.
X68044 mRNA. Translation: CAA48179.1.
S73199 Genomic DNA. Translation: AAB32071.1.
S73526 Genomic DNA. Translation: AAB32225.1.
CCDSiCCDS1843.1. [P23945-1]
CCDS1844.2. [P23945-3]
PIRiI57661. QRHUFT.
RefSeqiNP_000136.2. NM_000145.3.
NP_852111.2. NM_181446.2.
UniGeneiHs.1428.

Genome annotation databases

EnsembliENST00000304421; ENSP00000306780; ENSG00000170820.
GeneIDi2492.
KEGGihsa:2492.
UCSCiuc002rww.4. human.
uc010fbn.4. human. [P23945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Sequence-structure-function-analysis of glycoprotein hormone receptors

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M65085 mRNA. Translation: AAA52477.1.
M95489 mRNA. Translation: AAA52478.1.
S59900 mRNA. Translation: AAB26480.1.
JN003607 mRNA. Translation: AEI86722.1.
AY429104 mRNA. Translation: AAR07899.1.
AK292562 mRNA. Translation: BAF85251.1.
AC007189 Genomic DNA. No translation available.
AC079394 Genomic DNA. No translation available.
AC092533 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00188.1.
CH471053 Genomic DNA. Translation: EAX00189.1.
BC096831 mRNA. Translation: AAH96831.1.
BC118548 mRNA. Translation: AAI18549.1.
BC125270 mRNA. Translation: AAI25271.1.
X68044 mRNA. Translation: CAA48179.1.
S73199 Genomic DNA. Translation: AAB32071.1.
S73526 Genomic DNA. Translation: AAB32225.1.
CCDSiCCDS1843.1. [P23945-1]
CCDS1844.2. [P23945-3]
PIRiI57661. QRHUFT.
RefSeqiNP_000136.2. NM_000145.3.
NP_852111.2. NM_181446.2.
UniGeneiHs.1428.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XUNmodel-A49-228[»]
1XWDX-ray2.92C/F17-268[»]
4AY9X-ray2.50X/Y/Z17-366[»]
4MQWX-ray2.90X/Y/Z16-366[»]
ProteinModelPortaliP23945.
SMRiP23945.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108770. 32 interactors.
DIPiDIP-35605N.
IntActiP23945. 2 interactors.
MINTiMINT-1177926.
STRINGi9606.ENSP00000384708.

Chemistry databases

BindingDBiP23945.
ChEMBLiCHEMBL2024.
DrugBankiDB00097. Choriogonadotropin alfa.
DB00066. Follitropin beta.
DB00032. Menotropins.
DB04786. Suramin.
DB00094. Urofollitropin.
GuidetoPHARMACOLOGYi253.

Protein family/group databases

TCDBi9.A.14.1.5. the g-protein-coupled receptor (gpcr) family.
GPCRDBiSearch...

PTM databases

iPTMnetiP23945.
PhosphoSitePlusiP23945.

Polymorphism and mutation databases

BioMutaiFSHR.
DMDMi311033420.

Proteomic databases

PaxDbiP23945.
PeptideAtlasiP23945.
PRIDEiP23945.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304421; ENSP00000306780; ENSG00000170820.
GeneIDi2492.
KEGGihsa:2492.
UCSCiuc002rww.4. human.
uc010fbn.4. human. [P23945-1]

Organism-specific databases

CTDi2492.
DisGeNETi2492.
GeneCardsiFSHR.
H-InvDBHIX0029905.
HGNCiHGNC:3969. FSHR.
MalaCardsiFSHR.
MIMi136435. gene.
233300. phenotype.
608115. phenotype.
neXtProtiNX_P23945.
Orphaneti243. 46,XX gonadal dysgenesis.
64739. Ovarian hyperstimulation syndrome.
619. Primary ovarian failure.
PharmGKBiPA28386.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2087. Eukaryota.
ENOG410XR1T. LUCA.
HOGENOMiHOG000045902.
HOVERGENiHBG003521.
InParanoidiP23945.
KOiK04247.
OMAiFILLSKC.
OrthoDBiEOG091G02BV.
PhylomeDBiP23945.
TreeFamiTF316814.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170820-MONOMER.
ReactomeiR-HSA-375281. Hormone ligand-binding receptors.
R-HSA-418555. G alpha (s) signalling events.
SignaLinkiP23945.

Miscellaneous databases

ChiTaRSiFSHR. human.
EvolutionaryTraceiP23945.
GeneWikiiFollicle-stimulating_hormone_receptor.
GenomeRNAii2492.
PROiP23945.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170820.
CleanExiHS_FSHR.
ExpressionAtlasiP23945. baseline and differential.
GenevisibleiP23945. HS.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR002272. FSH_rcpt.
IPR024635. GnHR_TM.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR002131. Gphrmn_rcpt_fam.
IPR032675. L_dom-like.
IPR026906. LRR_5.
IPR000372. LRRNT.
[Graphical view]
PANTHERiPTHR24372. PTHR24372. 1 hit.
PTHR24372:SF5. PTHR24372:SF5. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
PF12369. GnHR_trans. 1 hit.
PF13306. LRR_5. 2 hits.
PF01462. LRRNT. 1 hit.
[Graphical view]
PRINTSiPR01143. FSHRECEPTOR.
PR00373. GLYCHORMONER.
PR00237. GPCRRHODOPSN.
SMARTiSM00013. LRRNT. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFSHR_HUMAN
AccessioniPrimary (citable) accession number: P23945
Secondary accession number(s): A0A0A0MSC5
, A8K947, G5CBS7, G5E967, J3KQ00, Q05AH0, Q16225, Q4QRJ3, Q4ZFZ2, Q53RW2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 1992
Last sequence update: November 2, 2010
Last modified: November 2, 2016
This is version 192 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.