P23819 (GRIA2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamate receptor 2 Short name=GluR-2 Alternative name(s): AMPA-selective glutamate receptor 2 GluR-B GluR-K2 Glutamate receptor ionotropic, AMPA 2 Short name=GluA2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 883 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate By similarity. |
| Subunit structure | Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. May interact with MPP4. Forms a ternary complex with GRIP1 and CSPG4. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIP1 and leads to AMPAR complex disassembly. Interacts with GRIP2. Isoform 1, but not isoform 3, interacts with PICK1/PRKCABP. Interacts with GRIA1 and SYNDIG1. Interacts with LRFN1 By similarity. Found in a complex with GRIA1, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with CACNG5 By similarity. Ref.5 Ref.7 Ref.8 Ref.11 Ref.13 Ref.14 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Note: Interaction with CACNG2, CNIH2 and CNIH3 promotes cell surface expression By similarity. Ref.10 Ref.11 |
| Tissue specificity | Detected in brain cortex, hippocampus and cerebellum (at protein level). Detected in hippocampus. Ref.10 Ref.11 |
| Developmental stage | Detected at low levels in newborns. Levels increase strongly and are highest in hippocampus from 7 day olds. Detected at low levels in hippocampus and olfactory bulb of 3 month olds (at protein level). Ref.10 |
| Post-translational modification | Palmitoylated. Depalmitoylated upon glutamate stimulation. ZDHHC3/GODZ specifically palmitoylates Cys-610, which leads to Golgi retention and decreased cell surface expression. In contrast, Cys-836 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis. Ref.9 N-glycosylated. Ref.10 |
| Miscellaneous | The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate. |
| Sequence similarities | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA2 subfamily. [View classification] |
| RNA editing | Edited at position 607. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P23819-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P23819-2) The sequence of this isoform differs from the canonical sequence as follows: 761-761: S → T 765-767: NAV → WVE 768-883: Missing. | ||||||
| Isoform 3 (identifier: P23819-3) The sequence of this isoform differs from the canonical sequence as follows: 802-802: K → KTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSK 848-883: VAKNAQNINP...NVYGIESVKI → MTLSAATRNK...GMNVSVTDLS | ||||||
| Isoform 4 (identifier: P23819-4) The sequence of this isoform differs from the canonical sequence as follows: 802-802: K → KTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||||
| Chain | 25 – 883 | 859 | Glutamate receptor 2 | PRO_0000011533 | |||||||
Regions | |||||||||||
| Topological domain | 25 – 543 | 519 | Extracellular By similarity | ||||||||
| Transmembrane | 544 – 564 | 21 | Helical; By similarity | ||||||||
| Topological domain | 565 – 591 | 27 | Cytoplasmic By similarity | ||||||||
| Intramembrane | 592 – 607 | 16 | Helical; Pore-forming; By similarity | ||||||||
| Intramembrane | 608 – 610 | 3 | By similarity | ||||||||
| Topological domain | 611 – 616 | 6 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 617 – 637 | 21 | Helical; By similarity | ||||||||
| Topological domain | 638 – 812 | 175 | Extracellular By similarity | ||||||||
| Transmembrane | 813 – 833 | 21 | Helical; By similarity | ||||||||
| Topological domain | 834 – 883 | 50 | Cytoplasmic By similarity | ||||||||
Sites | |||||||||||
| Binding site | 471 | 1 | Glutamate By similarity | ||||||||
| Binding site | 506 | 1 | Glutamate By similarity | ||||||||
| Binding site | 726 | 1 | Glutamate By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 683 | 1 | Phosphoserine; by PKC By similarity | ||||||||
| Modified residue | 717 | 1 | Phosphoserine; by PKG By similarity | ||||||||
| Modified residue | 869 | 1 | Phosphotyrosine Ref.12 | ||||||||
| Modified residue | 876 | 1 | Phosphotyrosine Ref.11 Ref.12 | ||||||||
| Modified residue | 880 | 1 | Phosphoserine Ref.6 | ||||||||
| Lipidation | 610 | 1 | S-palmitoyl cysteine Ref.9 | ||||||||
| Lipidation | 836 | 1 | S-palmitoyl cysteine Ref.9 | ||||||||
| Glycosylation | 256 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 370 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 406 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 413 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 78 ↔ 330 | By similarity | |||||||||
| Disulfide bond | 739 ↔ 794 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 761 | 1 | S → T in isoform 2. | VSP_000106 | |||||||
| Alternative sequence | 765 – 767 | 3 | NAV → WVE in isoform 2. | VSP_000107 | |||||||
| Alternative sequence | 768 – 883 | 116 | Missing in isoform 2. | VSP_000108 | |||||||
| Alternative sequence | 802 | 1 | K → KTPVNLAVLKLSEQGVLDKL KNKWWYDKGECGAKDSGSK in isoform 3 and isoform 4. | VSP_000109 | |||||||
| Alternative sequence | 848 – 883 | 36 | VAKNA…ESVKI → MTLSAATRNKARLSITGSTG ENGRVMTPEFPKAVHAVPYV SPGMGMNVSVTDLS in isoform 3. | VSP_000110 | |||||||
| Natural variant | 607 | 1 | Q → R in RNA edited version. | ||||||||
Experimental info | |||||||||||
| Mutagenesis | 869 | 1 | Y → F: No effect on tyrosine phosphorylation. Reduced tyrosine phosphorylation; when associated with F-873 and F-876. Ref.11 | ||||||||
| Mutagenesis | 873 | 1 | Y → F: No effect on tyrosine phosphorylation. Reduced tyrosine phosphorylation; when associated with F-869 and F-876. Ref.11 | ||||||||
| Mutagenesis | 876 | 1 | Y → F: Loss of tyrosine phosphorylation at the C-terminus. Reduced tyrosine phosphorylation; when associated with F-869 and F-873. Interferes with accumulation at synapses. Interferes with AMPA-mediated receptor internalization. Ref.11 | ||||||||
| Sequence conflict | 264 | 1 | D → V in CAA40735. Ref.1 | ||||||||
| Sequence conflict | 270 | 1 | V → A in CAA40735. Ref.1 | ||||||||
| Sequence conflict | 282 | 1 | E → G in CAA40735. Ref.1 | ||||||||
| Sequence conflict | 374 | 1 | N → H in BAB29316. Ref.3 | ||||||||
| Sequence conflict | 482 | 1 | N → K in BAC31557. Ref.3 | ||||||||
| Sequence conflict | 552 | 1 | F → L in BAB29316. Ref.3 | ||||||||
| Sequence conflict | 764 | 1 | G → R in AAC37653. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional expression from cloned cDNAs of glutamate receptor species responsive to kainate and quisqualate." Sakimura K., Bujo H., Kushiya E., Araki K., Yamazaki M., Yamazaki M., Meguro H., Warashina A., Numa S., Mishina M. FEBS Lett. 272:73-80(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The organization of the gene for the functionally dominant alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor subunit GluR-B." Koehler M., Kornau H.-C., Seeburg P.H. J. Biol. Chem. 269:17367-17370(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3 AND 4). Strain: BALB/c. Tissue: Liver. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Brain, Cerebellum, Medulla oblongata and Retina. |
| [4] | "RNA editing in brain controls a determinant of ion flow in glutamate-gated channels." Sommer B., Koehler M., Sprengel R., Seeburg P.H. Cell 67:11-19(1991) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING OF POSITION 607. |
| [5] | "rDLG6: a novel homolog of Drosophila DLG expressed in rat brain." Inagaki H., Maeda S., Lin K.H., Shimizu N., Saito T. Biochem. Biophys. Res. Commun. 265:462-468(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MPP4. |
| [6] | "Phosphorylation of serine-880 in GluR2 by protein kinase C prevents its C terminus from binding with glutamate receptor-interacting protein." Matsuda S., Mikawa S., Hirai H. J. Neurochem. 73:1765-1768(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-880. |
| [7] | "The protein kinase C alpha binding protein PICK1 interacts with short but not long form alternative splice variants of AMPA receptor subunits." Dev K.K., Nishimune A., Henley J.M., Nakanishi S. Neuropharmacology 38:635-644(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PRKCABP (ISOFORM 1). |
| [8] | "The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling." Stegmueller J., Werner H., Nave K.-A., Trotter J. J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GRIP1 AND CSPG4. |
| [9] | "Differential regulation of AMPA receptor subunit trafficking by palmitoylation of two distinct sites." Hayashi T., Rumbaugh G., Huganir R.L. Neuron 47:709-723(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PALMITOYLATION AT CYS-610 AND CYS-836. |
| [10] | "Glutamatergic plasticity by synaptic delivery of GluR-B(long)-containing AMPA receptors." Kolleker A., Zhu J.J., Schupp B.J., Qin Y., Mack V., Borchardt T., Koehr G., Malinow R., Seeburg P.H., Osten P. Neuron 40:1199-1212(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION OF ISOFORM 3, GLYCOSYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [11] | "Tyrosine phosphorylation and regulation of the AMPA receptor by SRC family tyrosine kinases." Hayashi T., Huganir R.L. J. Neurosci. 24:6152-6160(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-876, MUTAGENESIS OF TYR-869; TYR-873 AND TYR-876, SUBCELLULAR LOCATION, INTERACTION WITH GRIP1; GRIP2 AND PICK1, TISSUE SPECIFICITY. |
| [12] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-869 AND TYR-876, MASS SPECTROMETRY. Tissue: Brain. |
| [13] | "SynDIG1: an activity-regulated, AMPA- receptor-interacting transmembrane protein that regulates excitatory synapse development." Kalashnikova E., Lorca R.A., Kaur I., Barisone G.A., Li B., Ishimaru T., Trimmer J.S., Mohapatra D.P., Diaz E. Neuron 65:80-93(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GRIA1 AND SYNDIG1. |
| [14] | "The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior." Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L. Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATAD1 AND GRIP1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X57498 mRNA. Translation: CAA40735.1. L32204 L32191 Genomic DNA. Translation: AAC37653.1.L32372 L32204 Genomic DNA. Translation: AAC37654.1.AK014389 mRNA. Translation: BAB29316.1. AK043490 mRNA. Translation: BAC31557.1. AK044574 mRNA. Translation: BAC31986.1. AK046861 mRNA. Translation: BAC32899.1. |
| IPI | IPI00136967. IPI00466699. IPI00608015. IPI00845711. |
| PIR | I49695. I49696. |
| RefSeq | NP_001034284.1. NM_001039195.1. NP_001077275.1. NM_001083806.1. NP_038568.2. NM_013540.2. |
| UniGene | Mm.220224. |
3D structure databases | |
| ProteinModelPortal | P23819. |
| SMR | P23819. Positions 25-838. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P23819. 22 interactions. |
| MINT | MINT-1776844. |
| STRING | 10090.ENSMUSP00000103375. |
PTM databases | |
| PhosphoSite | P23819. |
Proteomic databases | |
| PaxDb | P23819. |
| PRIDE | P23819. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 14800. |
| KEGG | mmu:14800. |
| UCSC | uc008pnz.1. mouse. uc008pof.1. mouse. |
Organism-specific databases | |
| CTD | 2891. |
| MGI | MGI:95809. Gria2. |
Phylogenomic databases | |
| eggNOG | NOG316680. |
| HOGENOM | HOG000234372. |
| HOVERGEN | HBG051839. |
| KO | K05198. |
| OrthoDB | EOG4TB49K. |
Gene expression databases | |
| CleanEx | MM_GRIA2. |
| Genevestigator | P23819. |
| GermOnline | ENSMUSG00000033981. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001828. ANF_lig-bd_rcpt. IPR019594. Glu_rcpt_Glu/Gly-bd. IPR001320. Iontro_glu_rcpt. IPR001508. NMDA_rcpt. [Graphical view] |
| Pfam | PF01094. ANF_receptor. 1 hit. PF00060. Lig_chan. 1 hit. PF10613. Lig_chan-Glu_bd. 1 hit. [Graphical view] |
| PRINTS | PR00177. NMDARECEPTOR. |
| SMART | SM00918. Lig_chan-Glu_bd. 1 hit. SM00079. PBPe. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P23819. |
| ChEMBL | CHEMBL3205. |
| NextBio | 286957. |
| SOURCE | Search... |
Entry information
| Entry name | GRIA2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P23819 Secondary accession number(s): Q61604 Q9D6D3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
