P23760 (PAX3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 154.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Paired box protein Pax-3 Alternative name(s): HuP2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 479 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor that may regulate cell proliferation, migration and apoptosis. Involved in neural development and myogenesis. Ref.16 |
| Subunit structure | Can bind to DNA as a homodimer or a heterodimer with PAX7. Interacts with PAXBP1; the interaction links PAX3 to a WDR5-containing histone methyltransferase complex By similarity. Interacts with DAXX. Ref.14 Ref.18 |
| Subcellular location | |
| Involvement in disease | Waardenburg syndrome 1 (WS1) [MIM:193500]: WS1 is an autosomal dominant disorder characterized by non-progressive sensorineural deafness, pigmentary disturbances such as frontal white blaze of hair, heterochromia of irides, white eyelashes, leukoderma, and wide bridge of nose owing to lateral displacement of the inner canthus of each eye (dystopia canthorum). WS1 shows variable clinical expression and some affected individuals do not manifest hearing impairment or iris pigmentation disturbances. Dystopia canthorum is the most consistent sign and is found in 98% of the patients. Waardenburg syndrome 3 (WS3) [MIM:148820]: WS3 is an autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, dystopia canthorum and limb anomalies such as hypoplasia of the musculoskeletal system, flexion contractures, fusion of the carpal bones, syndactylies. Craniofacial-deafness-hand syndrome (CDHS) [MIM:122880]: Thought to be an autosomal dominant disease which comprises absence or hypoplasia of the nasal bones, hypoplastic maxilla, small and short nose with thin nares, limited movement of the wrist, short palpebral fissures, ulnar deviation of the fingers, hypertelorism and profound sensory-neural deafness. Rhabdomyosarcoma 2 (RMS2) [MIM:268220]: A form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchimal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. A chromosomal aberration involving PAX3 is a cause of rhabdomyosarcoma. Translocation t(2;2)(q35;p23) with NCOA1 generates the NCOA1-PAX3 oncogene consisting of the N-terminus part of PAX3 and the C-terminus part of NCOA1. The fusion protein acts as a transcriptional activator. Rhabdomyosarcoma is the most common soft tissue carcinoma in childhood, representing 5-8% of all malignancies in children. |
| Sequence similarities | Belongs to the paired homeobox family. Contains 1 homeobox DNA-binding domain. Contains 1 paired domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| POU3F2 | P20265 | 2 | EBI-1167564,EBI-1167176 | |
| SOX10 | P56693 | 2 | EBI-1167564,EBI-1167533 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Pax3 (identifier: P23760-1) Also known as: Pax3C; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Pax3A (identifier: P23760-2) The sequence of this isoform differs from the canonical sequence as follows: 196-215: ASAPQSDEGSDIDSEPDLPL → GKRWRLGRRTCWVTWRASAS 216-479: Missing. | ||||||
| Isoform Pax3B (identifier: P23760-3) The sequence of this isoform differs from the canonical sequence as follows: 196-206: ASAPQSDEGSD → GKALVSGVSSH 207-479: Missing. | ||||||
| Isoform Pax3G (identifier: P23760-4) The sequence of this isoform differs from the canonical sequence as follows: 393-479: MGLLTNHGGV...QYGQSKPWTF → PFIISSQISRK | ||||||
| Isoform Pax3H (identifier: P23760-5) The sequence of this isoform differs from the canonical sequence as follows: 393-479: MGLLTNHGGV...QYGQSKPWTF → PFIISSQISLGFKSF | ||||||
| Isoform 6 (identifier: P23760-6) The sequence of this isoform differs from the canonical sequence as follows: 108-108: Missing. 475-479: KPWTF → AFHYLKPDIA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: P23760-7) The sequence of this isoform differs from the canonical sequence as follows: 475-479: KPWTF → AFHYLKPDIA | ||||||
| Isoform Pax3E (identifier: P23760-8) The sequence of this isoform differs from the canonical sequence as follows: 475-479: KPWTF → AFHYLKPDIAWFQILLNTFDKSSGEEEDLEQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 479 | 479 | Paired box protein Pax-3 | PRO_0000050178 | |||||||||||
Regions | |||||||||||||||
| Domain | 34 – 161 | 128 | Paired | ||||||||||||
| DNA binding | 219 – 278 | 60 | Homeobox | ||||||||||||
Sites | |||||||||||||||
| Site | 319 – 320 | 2 | Breakpoint for translocation to form PAX3-NCOA1 oncogene | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 201 | 1 | Phosphoserine Ref.17 | ||||||||||||
| Modified residue | 205 | 1 | Phosphoserine Ref.17 | ||||||||||||
| Modified residue | 209 | 1 | Phosphoserine Ref.17 | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 108 | 1 | Missing in isoform 6. | VSP_043634 | |||||||||||
| Alternative sequence | 196 – 215 | 20 | ASAPQ…PDLPL → GKRWRLGRRTCWVTWRASAS in isoform Pax3A. | VSP_002355 | |||||||||||
| Alternative sequence | 196 – 206 | 11 | ASAPQSDEGSD → GKALVSGVSSH in isoform Pax3B. | VSP_002357 | |||||||||||
| Alternative sequence | 207 – 479 | 273 | Missing in isoform Pax3B. | VSP_002358 | |||||||||||
| Alternative sequence | 216 – 479 | 264 | Missing in isoform Pax3A. | VSP_002356 | |||||||||||
| Alternative sequence | 393 – 479 | 87 | MGLLT…KPWTF → PFIISSQISRK in isoform Pax3G. | VSP_042004 | |||||||||||
| Alternative sequence | 393 – 479 | 87 | MGLLT…KPWTF → PFIISSQISLGFKSF in isoform Pax3H. | VSP_042005 | |||||||||||
| Alternative sequence | 475 – 479 | 5 | KPWTF → AFHYLKPDIA in isoform 6 and isoform 7. | VSP_043635 | |||||||||||
| Alternative sequence | 475 – 479 | 5 | KPWTF → AFHYLKPDIAWFQILLNTFD KSSGEEEDLEQ in isoform Pax3E. | VSP_044915 | |||||||||||
| Natural variant | 45 | 1 | F → L in WS1. Ref.8 | VAR_003790 | |||||||||||
| Natural variant | 47 | 1 | N → H in WS3. Ref.21 | VAR_003791 | |||||||||||
| Natural variant | 47 | 1 | N → K in CDHS. Ref.28 | VAR_003792 | |||||||||||
| Natural variant | 48 | 1 | G → R in WS1. Ref.27 | VAR_017533 | |||||||||||
| Natural variant | 50 | 1 | P → L in WS1; important hearing loss. Ref.19 | VAR_003793 | |||||||||||
| Natural variant | 56 | 1 | R → L in WS1; associated with meningomyelocele. Ref.21 | VAR_003794 | |||||||||||
| Natural variant | 59 | 1 | I → F in WS1. Ref.30 | VAR_003795 | |||||||||||
| Natural variant | 59 | 1 | I → N in WS1. Ref.34 | VAR_003796 | |||||||||||
| Natural variant | 60 | 1 | V → M in WS1. Ref.25 Ref.37 | VAR_003797 | |||||||||||
| Natural variant | 62 | 1 | M → V in WS1. Ref.22 Ref.31 | VAR_003798 | |||||||||||
| Natural variant | 63 – 67 | 5 | Missing in WS1. | VAR_003799 | |||||||||||
| Natural variant | 73 | 1 | S → L in WS1. Ref.36 | VAR_013640 | |||||||||||
| Natural variant | 78 | 1 | V → M in WS1. Ref.26 | VAR_017534 | |||||||||||
| Natural variant | 81 | 1 | G → A in WS1; originally classified as Waardenburg syndrome type 2. Ref.20 Ref.26 | VAR_003800 | |||||||||||
| Natural variant | 84 | 1 | S → F in WS3. Ref.24 | VAR_003801 | |||||||||||
| Natural variant | 85 | 1 | K → E in WS1. Ref.25 | VAR_003802 | |||||||||||
| Natural variant | 90 | 1 | Y → H in WS3. Ref.37 Corresponds to variant rs28939096 [ dbSNP | Ensembl ]. | VAR_017535 | |||||||||||
| Natural variant | 99 | 1 | G → D in WS1. Ref.8 Ref.26 | VAR_003803 | |||||||||||
| Natural variant | 238 | 1 | F → S in WS1. Ref.25 | VAR_003804 | |||||||||||
| Natural variant | 265 | 1 | V → F in WS1. Ref.23 | VAR_003805 | |||||||||||
| Natural variant | 266 | 1 | W → C in WS1. Ref.26 | VAR_017536 | |||||||||||
| Natural variant | 270 | 1 | R → C in WS1 and WS3. Ref.26 Ref.27 Ref.35 | VAR_013619 | |||||||||||
| Natural variant | 271 | 1 | R → C in WS1. Ref.26 | VAR_017537 | |||||||||||
| Natural variant | 271 | 1 | R → G in WS1. Ref.23 | VAR_003806 | |||||||||||
| Natural variant | 271 | 1 | R → H in WS1; associated with Lys-273 in one family. Ref.26 Ref.27 | VAR_017538 | |||||||||||
| Natural variant | 273 | 1 | R → K Associated with His-271 in one Waardenburg syndrome type I family. Ref.27 | VAR_017539 | |||||||||||
| Natural variant | 315 | 1 | T → K. Ref.26 Ref.27 Ref.29 Ref.33 Corresponds to variant rs2234675 [ dbSNP | Ensembl ]. | VAR_003807 | |||||||||||
| Natural variant | 391 | 1 | Q → H in WS1. Ref.32 | VAR_013641 | |||||||||||
Experimental info | |||||||||||||||
| Sequence conflict | 358 | 1 | S → R in AAP13872. Ref.1 | ||||||||||||
| Sequence conflict | 358 | 1 | S → R in AAP13873. Ref.1 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 228 – 240 | 13 | |||||||||||||
| Helix | 246 – 256 | 11 | |||||||||||||
| Helix | 260 – 276 | 17 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of PAX 3 alternatively spliced transcripts and identification of two new isoforms in human tumors of neural crest origin." Parker C.J., Shawcross S.G., Li H., Wang Q.-Y., Herrington C.S., Kumar S., MacKie R.M., Prime W., Renne I.G., Sisley K., Kumar P. Int. J. Cancer 108:314-320(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PAX3G AND PAX3H), ALTERNATIVE SPLICING. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PAX3B; 6 AND 7). Tissue: Skin. |
| [6] | "Genomic organization of the human PAX3 gene: DNA sequence analysis of the region disrupted in alveolar rhabdomyosarcoma." Macina R.A., Barr F.G., Galili N., Riethman H.C. Genomics 26:1-8(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-29 AND 197-479. |
| [7] | "Conservation of the paired domain in metazoans and its structure in three isolated human genes." Burri M., Tromvoukis Y., Bopp D., Frigerio G., Noll M. EMBO J. 8:1183-1190(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 30-195. |
| [8] | "PAX3 gene structure and mutations: close analogies between Waardenburg syndrome and the Splotch mouse." Tassabehji M., Newton V.E., Leverton K., Turnbull K., Seemanova E., Kunze J., Sperling K., Strachan T., Read A.P. Hum. Mol. Genet. 3:1069-1074(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 196-392, VARIANTS WS1 LEU-45 AND ASP-99. |
| [9] | "Isolation of two isoforms of the PAX3 gene transcripts and their tissue-specific alternative expression in human adult tissues." Tsukamoto K., Nakamura Y., Niikawa N. Hum. Genet. 93:270-274(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (PAX3A AND PAX3B). |
| [10] | "Gene expression signatures identify rhabdomyosarcoma subtypes and detect a novel t(2;2)(q35;p23) translocation fusing PAX3 to NCOA1." Wachtel M., Dettling M., Koscielniak E., Stegmaier S., Treuner J., Simon-Klingenstein K., Buehlmann P., Niggli F.K., Schaefer B.W. Cancer Res. 64:5539-5545(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1-319 (ISOFORM 6/7), CHROMOSOMAL TRANSLOCATION WITH NCOA1. |
| [11] | "Waardenburg's syndrome patients have mutations in the human homologue of the Pax-3 paired box gene." Tassabehji M., Read A.P., Newton V.E., Harris R., Balling R., Gruss P., Strachan T. Nature 355:635-636(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 56-74, VARIANT WS1 63-ALA--ILE-67 DEL. |
| [12] | Lalwani A.K., Ploplis B., Fex J., Grundfast K.M., San Agustin T.B., Wilcox E.R. Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE OF 265-319. |
| [13] | "Fusion of a fork head domain gene to PAX3 in the solid tumour alveolar rhabdomyosarcoma." Galili N., Davis R.J., Fredericks W.J., Mukhopadhyay S., Rauscher F.J. III, Emanuel B.S., Rovera G., Barr F.G. Nat. Genet. 5:230-235(1993) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FOXO1. |
| [14] | "The Pax3-FKHR oncoprotein is unresponsive to the Pax3-associated repressor hDaxx." Hollenbach A.D., Sublett J.E., McPherson C.J., Grosveld G. EMBO J. 18:3702-3711(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DAXX. |
| [15] | "A frameshift mutation in the HuP2 paired domain of the probable human homolog of murine Pax-3 is responsible for Waardenburg syndrome type 1 in an Indonesian family." Morell R., Friedman T.B., Moeljopawiro S., Hartono S., Asher J.H. Jr. Hum. Mol. Genet. 1:243-247(1992) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN WS1. |
| [16] | "Functional analysis of alternative isoforms of the transcription factor PAX3 in melanocytes in vitro." Wang Q., Kumar S., Slevin M., Kumar P. Cancer Res. 66:8574-8580(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, FUNCTION. |
| [17] | "Identification of serines 201 and 209 as sites of Pax3 phosphorylation and the altered phosphorylation status of Pax3-FOXO1 during early myogenic differentiation." Dietz K.N., Miller P.J., Iyengar A.S., Loupe J.M., Hollenbach A.D. Int. J. Biochem. Cell Biol. 43:936-945(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-201; SER-205 AND SER-209. |
| [18] | "Structural basis for DNA recognition by the human PAX3 homeodomain." Birrane G., Soni A., Ladias J.A. Biochemistry 48:1148-1155(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 219-278 IN COMPLEX WITH DNA, SUBUNIT. |
| [19] | "An exonic mutation in the HuP2 paired domain gene causes Waardenburg's syndrome." Baldwin C.T., Hoth C.F., Amos J.A., Da-Silva E.O., Milunsky A. Nature 355:637-638(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 LEU-50. |
| [20] | "Mutations in the PAX3 gene causing Waardenburg syndrome type 1 and type 2." Tassabehji M., Read A.P., Newton V.E., Patton M., Gruss P., Harris R., Strachan T. Nat. Genet. 3:26-30(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 ALA-81. |
| [21] | "Mutations in the paired domain of the human PAX3 gene cause Klein-Waardenburg syndrome (WS-III) as well as Waardenburg syndrome type I (WS-I)." Hoth C.F., Milunsky A., Lipsky N., Sheffer R., Clarren S.K., Baldwin C.T. Am. J. Hum. Genet. 52:455-462(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS WS3 HIS-47 AND WS1 LEU-56. |
| [22] | "A single base pair substitution within the paired box of PAX3 in an individual with Waardenburg syndrome type 1 (WS1)." Pierpont J.W., Doolan L.D., Amann K., Snead G.R., Erickson R.P. Hum. Mutat. 4:227-228(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 VAL-62. |
| [23] | "Further elucidation of the genomic structure of PAX3, and identification of two different point mutations within the PAX3 homeobox that cause Waardenburg syndrome type 1 in two families." Lalwani A.K., Brister J.R., Fex J., Grundfast K.M., Ploplis B., San Agustin T.B., Wilcox E.R. Am. J. Hum. Genet. 56:75-83(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS WS1 PHE-265 AND GLY-271. |
| [24] | "Homozygosity for Waardenburg syndrome." Zlotogora J., Lerer I., Bar-David S., Ergaz Z., Abeliovich D. Am. J. Hum. Genet. 56:1173-1178(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS3 PHE-84. |
| [25] | "Mutations in PAX3 that cause Waardenburg syndrome type I: ten new mutations and review of the literature." Baldwin C.T., Hoth C.F., Macina R.A., Milunsky A. Am. J. Med. Genet. 58:115-122(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS WS1 MET-60; GLU-85 AND SER-238. |
| [26] | "The mutational spectrum in Waardenburg syndrome." Tassabehji M., Newton V.E., Liu X.-Z., Brady A., Donnai D., Krajewska-Walasek M., Murday V., Norman A., Obersztyn E., Reardon W., Rice J.C., Trembath R., Wieacker P., Whiteford M., Winter R., Read A.P. Hum. Mol. Genet. 4:2131-2137(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS WS1 MET-78; ALA-81; ASP-99; CYS-266; CYS-270; CYS-271 AND HIS-271, VARIANT LYS-315. |
| [27] | "Phenotypic variation in Waardenburg syndrome: mutational heterogeneity, modifier genes or polygenic background?" Pandya A., Xia X.-J., Landa B.L., Arnos K.S., Israel J., Lloyd J., James A.L., Diehl S.R., Blanton S.H., Nance W.E. Hum. Mol. Genet. 5:497-502(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS WS1 ARG-48; CYS-270 AND HIS-271, VARIANTS LYS-273 AND LYS-315. |
| [28] | "Missense mutation in the paired domain of PAX3 causes craniofacial-deafness-hand syndrome." Asher J.H. Jr., Sommer A., Morell R., Friedman T.B. Hum. Mutat. 7:30-35(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CDHS LYS-47. |
| [29] | "PAX genes and human neural tube defects: an amino acid substitution in PAX1 in a patient with spina bifida." Hol F.A., Geurds M.P.A., Chatkupt S., Shugart Y.Y., Balling R., Schrander-Stumpel C.T.R.M., Johnson W.G., Hamel B.C.J., Mariman E.C.M. J. Med. Genet. 33:655-660(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LYS-315. |
| [30] | "Three novel PAX3 mutations observed in patients with Waardenburg syndrome type 1." Soejima H., Fujimoto M., Tsukamoto K., Matsumoto N., Yoshiura K., Fukushima Y., Jinno Y., Niikawa N. Hum. Mutat. 9:177-180(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 PHE-59. |
| [31] | "Identification of two PAX3 mutations causing Waardenburg syndrome, one within the paired domain (M62V) and the other downstream of the homeodomain (Q282X)." Hol F.A., Geurds M.P.A., Cremers C.W.R.J., Hamel B.C.J., Mariman E.C.M. Hum. Mutat. Suppl. 1:S145-S147(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 VAL-62. |
| [32] | "Septo-optic dysplasia and WS1 in the proband of a WS1 family segregating for a novel mutation in PAX3 exon 7." Carey M.L., Friedman T.B., Asher J.H. Jr., Innis J.W. J. Med. Genet. 35:248-250(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 HIS-391. |
| [33] | "A PAX3 polymorphism (T315K) in a family exhibiting Waardenburg syndrome type 2." Wang C., Kim E., Attaie A., Smith T.N., Wilcox E.R., Lalwani A.K. Mol. Cell. Probes 12:55-57(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LYS-315. |
| [34] | "A novel missense mutation Ile59Asn in the PAX3 gene in a family with Waardenburg syndrome type I." Markova T.G., Shevtsov S.P., Moskolenko L.N., Lantsov A.A., Schwartz E.I. Hum. Mutat. 13:85-85(1999) Cited for: VARIANT WS1 ASN-59. |
| [35] | Bottani A., Antonarakis S.E., Blouin J.-L. Submitted (MAY-1999) to UniProtKB Cited for: VARIANT WS3 CYS-270. |
| [36] | "Identification of a novel mutation in the paired domain of PAX3 in an Iranian family with Waardenburg syndrome type I." Sotirova V.N., Rezaie T.M., Khoshsorour M.M., Sarfarazi M. Ophthalmic Genet. 21:25-28(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 LEU-73. |
| [37] | "Homozygous and heterozygous inheritance of PAX3 mutations causes different types of Waardenburg syndrome." Wollnik B., Tukel T., Uyguner O., Ghanbari A., Kayserili H., Emiroglu M., Yuksel-Apak M. Am. J. Med. Genet. A 122:42-45(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS1 MET-60, VARIANT WS3 HIS-90. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY251279 mRNA. Translation: AAP13872.1. AY251280 mRNA. Translation: AAP13873.1. AK291278 mRNA. Translation: BAF83967.1. AC010980 Genomic DNA. Translation: AAY14900.1. AC012591 Genomic DNA. No translation available. CH471063 Genomic DNA. Translation: EAW70789.1. CH471063 Genomic DNA. Translation: EAW70791.1. CH471063 Genomic DNA. Translation: EAW70794.1. CH471063 Genomic DNA. Translation: EAW70796.1. BC063547 mRNA. Translation: AAH63547.1. BC101299 mRNA. Translation: AAI01300.1. BC101300 mRNA. Translation: AAI01301.1. BC101301 mRNA. Translation: AAI01302.1. BC101302 mRNA. Translation: AAI01303.1. BC114363 mRNA. Translation: AAI14364.1. U12263 Genomic DNA. Translation: AAA80573.1. U12259 U12262 Genomic DNA. Translation: AAA80574.1.X15043, X15252, X15253 Genomic DNA. Translation: CAA33145.1. Z29972 Genomic DNA. No translation available. Z29973 Genomic DNA. No translation available. Z29974 Genomic DNA. No translation available. S69369 mRNA. Translation: AAB30167.1. S69370 mRNA. Translation: AAB30168.1. AY633656 mRNA. Translation: AAT47737.1. S83614 Genomic DNA. Translation: AAB21476.1. L10614 Genomic DNA. Translation: AAA91849.1. | ||||||||||||
| IPI | IPI00012896. IPI00219092. IPI00219093. IPI00375387. IPI00895878. | ||||||||||||
| PIR | I54276. I68547. S06960. | ||||||||||||
| RefSeq | NP_000429.2. NM_000438.5. NP_001120838.1. NM_001127366.2. NP_039230.1. NM_013942.4. NP_852122.1. NM_181457.3. NP_852123.1. NM_181458.3. NP_852124.1. NM_181459.3. NP_852125.1. NM_181460.3. NP_852126.1. NM_181461.3. | ||||||||||||
| UniGene | Hs.42146. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P23760. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P23760. 7 interactions. | ||||||||||||
| MINT | MINT-202884. | ||||||||||||
| STRING | 9606.ENSP00000375921. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P23760. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 1172022. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P23760. | ||||||||||||
| PRIDE | P23760. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5077. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000258387; ENSP00000258387; ENSG00000135903. ENST00000336840; ENSP00000338767; ENSG00000135903. ENST00000344493; ENSP00000342092; ENSG00000135903. ENST00000350526; ENSP00000343052; ENSG00000135903. ENST00000392069; ENSP00000375921; ENSG00000135903. ENST00000392070; ENSP00000375922; ENSG00000135903. ENST00000409551; ENSP00000386750; ENSG00000135903. ENST00000409828; ENSP00000386817; ENSG00000135903. | ||||||||||||
| GeneID | 5077. | ||||||||||||
| KEGG | hsa:5077. | ||||||||||||
| UCSC | uc002vmw.2. human. uc002vmz.2. human. uc002vna.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5077. | ||||||||||||
| GeneCards | GC02M223064. | ||||||||||||
| HGNC | HGNC:8617. PAX3. | ||||||||||||
| HPA | CAB013466. | ||||||||||||
| MIM | 122880. phenotype. 148820. phenotype. 193500. phenotype. 268220. phenotype. 606597. gene. | ||||||||||||
| neXtProt | NX_P23760. | ||||||||||||
| Orphanet | 99756. Alveolar rhabdomyosarcoma. 1529. Craniofacial-deafness-hand syndrome. 894. Waardenburg syndrome type 1. 896. Waardenburg syndrome type 3. | ||||||||||||
| PharmGKB | PA32957. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG326044. | ||||||||||||
| HOGENOM | HOG000230939. | ||||||||||||
| HOVERGEN | HBG009115. | ||||||||||||
| KO | K09381. | ||||||||||||
| OMA | VHQSTLP. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P23760. | ||||||||||||
| Bgee | P23760. | ||||||||||||
| CleanEx | HS_PAX3. | ||||||||||||
| Genevestigator | P23760. | ||||||||||||
| GermOnline | ENSG00000135903. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.10.10. 2 hits. 1.10.10.60. 1 hit. | ||||||||||||
| InterPro | IPR017970. Homeobox_CS. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR001523. Paired_dom. IPR022106. Pax7. IPR011991. WHTH_DNA-bd_dom. [Graphical view] | ||||||||||||
| Pfam | PF00046. Homeobox. 1 hit. PF00292. PAX. 1 hit. PF12360. Pax7. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00027. PAIREDBOX. | ||||||||||||
| SMART | SM00389. HOX. 1 hit. SM00351. PAX. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. | ||||||||||||
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS00034. PAIRED_1. 1 hit. PS51057. PAIRED_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PAX3. human. | ||||||||||||
| EvolutionaryTrace | P23760. | ||||||||||||
| GenomeRNAi | 5077. | ||||||||||||
| NextBio | 19572. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PAX3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P23760 Secondary accession number(s): G5E9C1 Q86UQ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
