Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein unc-104

Gene

unc-104

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Motor protein involved in microtubule-associated anterograde transport (PubMed:1846075). Regulates the transport of synaptic vesicle precursors in the axon of DA motor neurons (PubMed:20510931). Essential for the transport of synaptic components during the synaptic remodeling of the DD motor neuron, probably downstream of cdk-5 and/or pct-1/cyy-1 complex (PubMed:21609829). Involved in necrotic cell death (PubMed:22157748).4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi93 – 100ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent microtubule motor activity, plus-end-directed Source: WormBase
  • microtubule binding Source: WormBase
  • phosphatidylinositol-4,5-bisphosphate binding Source: WormBase
  • phosphatidylinositol-4-phosphate binding Source: WormBase
  • tau protein binding Source: WormBase

GO - Biological processi

  • anterograde axonal transport Source: WormBase
  • anterograde synaptic vesicle transport Source: WormBase
  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • defecation Source: WormBase
  • feeding behavior Source: WormBase
  • microtubule-based movement Source: WormBase
  • molting cycle, collagen and cuticulin-based cuticle Source: WormBase
  • negative regulation of dense core granule transport Source: UniProtKB
  • nematode larval development Source: WormBase
  • neuron-neuron synaptic transmission Source: WormBase
  • neuron remodeling Source: UniProtKB
  • positive regulation of growth rate Source: WormBase
  • positive regulation of multicellular organism growth Source: WormBase
  • positive regulation of necrotic cell death Source: WormBase
  • positive regulation of pharyngeal pumping Source: WormBase
  • positive regulation of synapse assembly Source: UniProtKB
  • positive regulation of synaptic growth at neuromuscular junction Source: WormBase
  • receptor clustering Source: WormBase
  • regulated exocytosis Source: WormBase
  • regulation of axon extension Source: WormBase
  • regulation of protein localization to synapse Source: UniProtKB
  • regulation of striated muscle contraction Source: WormBase
  • reproduction Source: WormBase
  • synaptic transmission, cholinergic Source: WormBase
  • vesicle-mediated transport Source: WormBase
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Cell cycle, Cell division, Necrosis, Neurogenesis, Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein unc-104
Alternative name(s):
Uncoordinated protein 104
Gene namesi
Name:unc-104
ORF Names:C52E12.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome II

Organism-specific databases

WormBaseiC52E12.2a; CE48050; WBGene00006831; unc-104.
C52E12.2b; CE47855; WBGene00006831; unc-104.

Subcellular locationi

GO - Cellular componenti

  • axon Source: WormBase
  • axon cytoplasm Source: GOC
  • dendrite Source: WormBase
  • kinesin complex Source: GO_Central
  • microtubule Source: UniProtKB-KW
  • neuronal cell body Source: WormBase
  • plasma membrane Source: GOC
  • presynapse Source: WormBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Disruption phenotypei

Worms exhibit uncoordinated and slow movement.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1497D → N in e1265; increased survival in response to hypoxia induced by sodium azide. Reduced number of neuron cell corpses in a hyperactive mec-4 or deg-3 mutant background. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254131 – 1584Kinesin-like protein unc-104Add BLAST1584

Proteomic databases

EPDiP23678.
PaxDbiP23678.
PeptideAtlasiP23678.
PRIDEiP23678.

PTM databases

iPTMnetiP23678.

Expressioni

Gene expression databases

BgeeiWBGene00006831.

Interactioni

GO - Molecular functioni

  • microtubule binding Source: WormBase
  • tau protein binding Source: WormBase

Protein-protein interaction databases

BioGridi39482. 2 interactors.
DIPiDIP-49010N.
STRINGi6239.C52E12.2b.

Structurei

3D structure databases

ProteinModelPortaliP23678.
SMRiP23678.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 347Kinesin motorPROSITE-ProRule annotationAdd BLAST345
Domaini1460 – 1558PHPROSITE-ProRule annotationAdd BLAST99

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni183 – 335Microtubule-bindingAdd BLAST153

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili425 – 445Sequence analysisAdd BLAST21
Coiled coili598 – 652Sequence analysisAdd BLAST55
Coiled coili777 – 797Sequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi957 – 1052Arg/Lys-rich (basic)Add BLAST96
Compositional biasi1203 – 1584Arg/Lys-rich (basic)Add BLAST382

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
InParanoidiP23678.
KOiK10392.
OMAiRRIKITI.
OrthoDBiEOG091G009V.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF12473. DUF3694. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 2 hits.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: P23678-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSVKVAVRV RPFNQREISN TSKCVLQVNG NTTTINGHSI NKENFSFNFD
60 70 80 90 100
HSYWSFARND PHFITQKQVY EELGVEMLEH AFEGYNVCIF AYGQTGSGKS
110 120 130 140 150
YTMMGKANDP DEMGIIPRLC NDLFARIDNN NDKDVQYSVE VSYMEIYCER
160 170 180 190 200
VKDLLNPNSG GNLRVREHPL LGPYVDDLTK MAVCSYHDIC NLMDEGNKAR
210 220 230 240 250
TVAATNMNST SSRSHAVFTI VLTQKRHCAD SNLDTEKHSK ISLVDLAGSE
260 270 280 290 300
RANSTGAEGQ RLKEGANINK SLTTLGLVIS KLAEESTKKK KSNKGVIPYR
310 320 330 340 350
DSVLTWLLRE NLGGNSKTAM LAALSPADIN FDETLSTLRY ADRAKQIVCQ
360 370 380 390 400
AVVNEDPNAK LIRELNEEVI KLRHILKDKG IDVTDVQETP GKHKKGPKLP
410 420 430 440 450
AHVHEQLEKL QESEKLMAEI GKTWEQKLIH TEEIRKQREE ELRDMGLACA
460 470 480 490 500
EDGTTLGVFS PKKLPHLVNL NEDPLMSECL IYYLKEGVTS VGRPEAEHRP
510 520 530 540 550
DILLSGEAIL ELHCEFINED GNVTLTMKPN ASCYINGKQV TTPTVLHTGS
560 570 580 590 600
RVILGEHHVF RYNDPQEARQ SRHNLAAIAE QPIDWKYAQQ ELLDKQGIDL
610 620 630 640 650
KADMEKKMLE MESQYRREKV ELEQKMYHQT REYESMIENL QKQVDLAQSY
660 670 680 690 700
ISGGGSIWEG ERMLTSSLLE FPEELKWTSD QKRVVLKAAI KWRYHQFTSV
710 720 730 740 750
RDDLWGNAIF VKEANAISVE LKKKVQFQFA LLTDTMYSPL PPDLLPPGED
760 770 780 790 800
LTLRPYPKTV VAIQVQDLKN GATHYWSIEK LKQRLEAMRD MYETDAEMSP
810 820 830 840 850
ADGDPMMDAL MGTDPFYDRF PWFRMVGRAF VYLNNLLHNV PLIHKVAVVN
860 870 880 890 900
EKGEVKGYLK VAIEPVQKDE VINQKKGVRQ TAKLHFRKED FLKSHKNGET
910 920 930 940 950
SDSDALAFPE HMQEEVEFCF RVVVLQAIDV ADTYSDVFCQ FNFLHRHDEA
960 970 980 990 1000
FSTEPMKNSK SPLTFEHTQN LHIKMSKTFL HYLHHFPIIF EVFGHFQPKS
1010 1020 1030 1040 1050
EQFNFERQNS ALGRRLSTKL TFQQPSLVIS TPVKSKKANA PIQNNNASVK
1060 1070 1080 1090 1100
SKHDLLVWFE ICELANNGEY VPTIVDHAQG LPTHGIFLLH QGIQRRIKIT
1110 1120 1130 1140 1150
ICHEKGELKW KDCQELVVGR IRAGPEWAGG DDVDVLSLGL FPGTFMEFSM
1160 1170 1180 1190 1200
DDRTFFQFEA AWDSSLHNSP LLNRVSNYGD QIYMTLSAYM ELDGCAQPAV
1210 1220 1230 1240 1250
VTKDLCLLIY ARDSKISAAS RFCRSLVGGI SKSPEMNRVP GVYQLCLKDG
1260 1270 1280 1290 1300
SDSGSPGAIR RQRRVLDTSS AYVRGEENLG QWRPRGDSLI FEHQWELEKL
1310 1320 1330 1340 1350
TRLQQVERVR LFLRLRDRLK GKKNKGEART PVSPCDPVCA IPESIKLDEK
1360 1370 1380 1390 1400
DKGIVGKVLG LIRRKIPMNK DPPTGNKAQE LSDESGSNSI TSPVSDKSLI
1410 1420 1430 1440 1450
KSSRSSDLLC RQKSKSDQNL ASNDDIVDNL GGMKRSLSGS RILQLNILVP
1460 1470 1480 1490 1500
EVLEERVGVV VSKKGYMNFL EEKTQGWTRR WVIVRRPYIL LFRDDRDLVI
1510 1520 1530 1540 1550
RGIINLANAR IEHSEDQQAM VKVPNTFSVC TNQRGFLMQM MPGDEMYDWL
1560 1570 1580
YAINPLMAGQ MKLHGNQNGT TLKSPTSSSS IAAS
Length:1,584
Mass (Da):179,652
Last modified:July 24, 2013 - v4
Checksum:iD558DD367545544B
GO
Isoform b (identifier: P23678-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     786-786: E → EDMRIFYNSELSVAGTPVDVPYPPVAEGWLAALNRNSARLIPDRQRLE
     1255-1257: Missing.

Note: No experimental confirmation available.
Show »
Length:1,628
Mass (Da):184,692
Checksum:i50715D9E8C3DDD4D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti905A → R in AAA03517 (PubMed:1846075).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti598I → T.1
Natural varianti930V → M.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011760786E → EDMRIFYNSELSVAGTPVDV PYPPVAEGWLAALNRNSARL IPDRQRLE in isoform b. Curated1
Alternative sequenceiVSP_0117611255 – 1257Missing in isoform b. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58582 mRNA. Translation: AAA03517.1.
FO080554 Genomic DNA. Translation: CCD64622.2.
FO080554 Genomic DNA. Translation: CCD64623.2.
PIRiJN0114.
RefSeqiNP_001022041.2. NM_001026870.5. [P23678-2]
NP_741019.3. NM_171017.8. [P23678-1]

Genome annotation databases

EnsemblMetazoaiC52E12.2a; C52E12.2a; WBGene00006831. [P23678-1]
GeneIDi174144.
KEGGicel:CELE_C52E12.2.
UCSCiC52E12.2a. c. elegans. [P23678-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58582 mRNA. Translation: AAA03517.1.
FO080554 Genomic DNA. Translation: CCD64622.2.
FO080554 Genomic DNA. Translation: CCD64623.2.
PIRiJN0114.
RefSeqiNP_001022041.2. NM_001026870.5. [P23678-2]
NP_741019.3. NM_171017.8. [P23678-1]

3D structure databases

ProteinModelPortaliP23678.
SMRiP23678.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi39482. 2 interactors.
DIPiDIP-49010N.
STRINGi6239.C52E12.2b.

PTM databases

iPTMnetiP23678.

Proteomic databases

EPDiP23678.
PaxDbiP23678.
PeptideAtlasiP23678.
PRIDEiP23678.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC52E12.2a; C52E12.2a; WBGene00006831. [P23678-1]
GeneIDi174144.
KEGGicel:CELE_C52E12.2.
UCSCiC52E12.2a. c. elegans. [P23678-1]

Organism-specific databases

CTDi36876.
WormBaseiC52E12.2a; CE48050; WBGene00006831; unc-104.
C52E12.2b; CE47855; WBGene00006831; unc-104.

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
InParanoidiP23678.
KOiK10392.
OMAiRRIKITI.
OrthoDBiEOG091G009V.

Miscellaneous databases

PROiP23678.

Gene expression databases

BgeeiWBGene00006831.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF12473. DUF3694. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 2 hits.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUN104_CAEEL
AccessioniPrimary (citable) accession number: P23678
Secondary accession number(s): Q8MQ97, Q8MQ98
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: July 24, 2013
Last modified: November 30, 2016
This is version 143 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.