Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P23634

- AT2B4_HUMAN

UniProt

P23634 - AT2B4_HUMAN

Protein

Plasma membrane calcium-transporting ATPase 4

Gene

ATP2B4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 2 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei465 – 46514-aspartylphosphate intermediateBy similarity
    Metal bindingi785 – 7851MagnesiumBy similarity
    Metal bindingi789 – 7891MagnesiumBy similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. calcium-transporting ATPase activity Source: ProtInc
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: IntAct
    5. scaffold protein binding Source: BHF-UCL

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. ion transmembrane transport Source: Reactome
    3. negative regulation of peptidyl-cysteine S-nitrosylation Source: BHF-UCL
    4. regulation of sodium ion transmembrane transport Source: BHF-UCL
    5. transmembrane transport Source: Reactome
    6. transport Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_23765. Reduction of cytosolic Ca++ levels.
    REACT_25149. Ion transport by P-type ATPases.

    Protein family/group databases

    TCDBi3.A.3.2.1. the p-type atpase (p-atpase) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Plasma membrane calcium-transporting ATPase 4 (EC:3.6.3.8)
    Short name:
    PMCA4
    Alternative name(s):
    Matrix-remodeling-associated protein 1
    Plasma membrane calcium ATPase isoform 4
    Plasma membrane calcium pump isoform 4
    Gene namesi
    Name:ATP2B4
    Synonyms:ATP2B2, MXRA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:817. ATP2B4.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: UniProtKB
    3. plasma membrane Source: HPA
    4. protein complex Source: BHF-UCL

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25110.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12411241Plasma membrane calcium-transporting ATPase 4PRO_0000046220Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1102 – 11021Phosphothreonine; by PKCBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP23634.
    PaxDbiP23634.
    PRIDEiP23634.

    PTM databases

    PhosphoSiteiP23634.

    Expressioni

    Tissue specificityi

    Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.

    Gene expression databases

    ArrayExpressiP23634.
    BgeeiP23634.
    CleanExiHS_ATP2B2.
    HS_ATP2B4.
    GenevestigatoriP23634.

    Organism-specific databases

    HPAiCAB016118.
    HPA040431.

    Interactioni

    Subunit structurei

    Interacts with PDZD11. Interacts with SLC35G1 and STIM1.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CALCAP012582EBI-1174388,EBI-1018474
    Dlg2Q636222EBI-1174437,EBI-396947From a different organism.
    Dlg3Q629362EBI-1174437,EBI-349596From a different organism.

    Protein-protein interaction databases

    BioGridi106983. 11 interactions.
    DIPiDIP-6128N.
    IntActiP23634. 10 interactions.
    MINTiMINT-219327.
    STRINGi9606.ENSP00000350310.

    Structurei

    Secondary structure

    1
    1241
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni1087 – 10893
    Turni1090 – 10923
    Helixi1093 – 110210
    Helixi1141 – 11477

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1CFFNMR-B1086-1104[»]
    2KNENMR-B1086-1149[»]
    ProteinModelPortaliP23634.
    SMRiP23634. Positions 47-945.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP23634.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 9292CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini114 – 15037ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini172 – 356185CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini377 – 40933ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini428 – 840413CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini861 – 87010ExtracellularSequence Analysis
    Topological domaini892 – 91120CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini935 – 95218ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini975 – 99319CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1016 – 102510ExtracellularSequence Analysis
    Topological domaini1048 – 1241194CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei93 – 11321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei151 – 17121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei357 – 37620HelicalSequence AnalysisAdd
    BLAST
    Transmembranei410 – 42718HelicalSequence AnalysisAdd
    BLAST
    Transmembranei841 – 86020HelicalSequence AnalysisAdd
    BLAST
    Transmembranei871 – 89121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei912 – 93423HelicalSequence AnalysisAdd
    BLAST
    Transmembranei953 – 97422HelicalSequence AnalysisAdd
    BLAST
    Transmembranei994 – 101522HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1026 – 104722HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1086 – 110318Calmodulin-binding subdomain AAdd
    BLAST
    Regioni1104 – 111310Calmodulin-binding subdomain BBy similarity

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi297 – 3037Poly-Lys
    Compositional biasi1186 – 11905Poly-Glu

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOVERGENiHBG061286.
    InParanoidiP23634.
    KOiK05850.
    OMAiNFVIHRR.
    OrthoDBiEOG7SN8BN.
    PhylomeDBiP23634.
    TreeFamiTF300330.

    Family and domain databases

    Gene3Di1.20.1110.10. 3 hits.
    InterProiIPR022141. ATP_Ca_trans_C.
    IPR006408. ATPase_P-typ_Ca-transp_plasma.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF12424. ATP_Ca_trans_C. 2 hits.
    PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 2 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Note: There is a combination of two alternatively spliced domains at N-terminal site A (X and Z) and at C-terminal site B/C (A, B, D and K). The splice sites have mostly been studied independently. Full isoforms so far detected are isoform XA and isoform XB. Experimental confirmation may be lacking for some isoforms.

    Isoform XD (identifier: P23634-1) [UniParc]FASTAAdd to Basket

    Also known as: AIICIV

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTNPSDRVLP ANSMAESREG DFGCTVMELR KLMELRSRDA LTQINVHYGG     50
    VQNLCSRLKT SPVEGLSGNP ADLEKRRQVF GHNVIPPKKP KTFLELVWEA 100
    LQDVTLIILE IAAIISLVLS FYRPAGEENE LCGQVATTPE DENEAQAGWI 150
    EGAAILFSVI IVVLVTAFND WSKEKQFRGL QCRIEQEQKF SIIRNGQLIQ 200
    LPVAEIVVGD IAQVKYGDLL PADGILIQGN DLKIDESSLT GESDHVKKSL 250
    DKDPMLLSGT HVMEGSGRMV VTAVGVNSQT GIILTLLGVN EDDEGEKKKK 300
    GKKQGVPENR NKAKTQDGVA LEIQPLNSQE GIDNEEKDKK AVKVPKKEKS 350
    VLQGKLTRLA VQIGKAGLLM SALTVFILIL YFVIDNFVIN RRPWLPECTP 400
    IYIQYFVKFF IIGITVLVVA VPEGLPLAVT ISLAYSVKKM MKDNNLVRHL 450
    DACETMGNAT AICSDKTGTL TMNRMTVVQA YIGGIHYRQI PSPDVFLPKV 500
    LDLIVNGISI NSAYTSKILP PEKEGGLPRQ VGNKTECALL GFVTDLKQDY 550
    QAVRNEVPEE KLYKVYTFNS VRKSMSTVIR NPNGGFRMYS KGASEIILRK 600
    CNRILDRKGE AVPFKNKDRD DMVRTVIEPM ACDGLRTICI AYRDFDDTEP 650
    SWDNENEILT ELTCIAVVGI EDPVRPEVPD AIAKCKQAGI TVRMVTGDNI 700
    NTARAIATKC GILTPGDDFL CLEGKEFNRL IRNEKGEVEQ EKLDKIWPKL 750
    RVLARSSPTD KHTLVKGIID STVGEHRQVV AVTGDGTNDG PALKKADVGF 800
    AMGIAGTDVA KEASDIILTD DNFTSIVKAV MWGRNVYDSI SKFLQFQLTV 850
    NVVAVIVAFT GACITQDSPL KAVQMLWVNL IMDTFASLAL ATEPPTESLL 900
    KRRPYGRNKP LISRTMMKNI LGHAFYQLIV IFILVFAGEK FFDIDSGRKA 950
    PLHSPPSQHY TIVFNTFVLM QLFNEINSRK IHGEKNVFSG IYRNIIFCSV 1000
    VLGTFICQIF IVEFGGKPFS CTSLSLSQWL WCLFIGIGEL LWGQFISAIP 1050
    TRSLKFLKEA GHGTTKEEIT KDAEGLDEID HAEMELRRGQ ILWFRGLNRI 1100
    QTQIDVINTF QTGASFKGVL RRQNMGQHLD VKLVPSSSYI KVVKAFHSSL 1150
    HESIQKPYNQ KSIHSFMTHP EFAIEEELPR TPLLDEEEEE NPDKASKFGT 1200
    RVLLLDGEVT PYANTNNNAV DCNQVQLPQS DSSLQSLETS V 1241
    Length:1,241
    Mass (Da):137,920
    Last modified:June 1, 2001 - v2
    Checksum:i568544103CD5F494
    GO
    Isoform XA (identifier: P23634-2) [UniParc]FASTAAdd to Basket

    Also known as: AIICII

    The sequence of this isoform differs from the canonical sequence as follows:
         1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

    Show »
    Length:1,170
    Mass (Da):129,403
    Checksum:iC4ED2E2EFE1BB043
    GO
    Isoform ZA (identifier: P23634-3) [UniParc]FASTAAdd to Basket

    Also known as: AICII

    The sequence of this isoform differs from the canonical sequence as follows:
         301-312: Missing.
         1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

    Show »
    Length:1,158
    Mass (Da):128,066
    Checksum:iE7AA8CC9C25E0727
    GO
    Isoform XK (identifier: P23634-4) [UniParc]FASTAAdd to Basket

    Also known as: XG

    The sequence of this isoform differs from the canonical sequence as follows:
         1009-1044: Missing.
         1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

    Show »
    Length:1,134
    Mass (Da):125,344
    Checksum:i088F8CB994D46238
    GO
    Isoform ZK (identifier: P23634-5) [UniParc]FASTAAdd to Basket

    Also known as: ZG

    The sequence of this isoform differs from the canonical sequence as follows:
         301-312: Missing.
         1009-1044: Missing.
         1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

    Show »
    Length:1,122
    Mass (Da):124,007
    Checksum:i4AD4378ED226853B
    GO
    Isoform XB (identifier: P23634-6) [UniParc]FASTAAdd to Basket

    Also known as: AIICI

    The sequence of this isoform differs from the canonical sequence as follows:
         1104-1139: Missing.

    Show »
    Length:1,205
    Mass (Da):133,931
    Checksum:i76CE806974035974
    GO
    Isoform ZB (identifier: P23634-7) [UniParc]FASTAAdd to Basket

    Also known as: AICI

    The sequence of this isoform differs from the canonical sequence as follows:
         301-312: Missing.
         1104-1139: Missing.

    Show »
    Length:1,193
    Mass (Da):132,594
    Checksum:i6AA34BD1850CADB7
    GO
    Isoform ZD (identifier: P23634-8) [UniParc]FASTAAdd to Basket

    Also known as: AICIV

    The sequence of this isoform differs from the canonical sequence as follows:
         301-312: Missing.

    Show »
    Length:1,229
    Mass (Da):136,584
    Checksum:i5E9E48B86464E926
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti492 – 4921S → C in CAD97686. (PubMed:17974005)Curated
    Sequence conflicti1144 – 11441K → N AA sequence (PubMed:2963820)Curated
    Sequence conflicti1147 – 11471H → S AA sequence (PubMed:2963820)Curated
    Sequence conflicti1153 – 11531S → F AA sequence (PubMed:2963820)Curated
    Sequence conflicti1178 – 11781L → Q AA sequence (PubMed:2966397)Curated
    Sequence conflicti1187 – 11871E → Q AA sequence (PubMed:2966397)Curated
    Sequence conflicti1190 – 11901E → G in CAD97686. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei301 – 31212Missing in isoform ZA, isoform ZK, isoform ZB and isoform ZD. CuratedVSP_000402Add
    BLAST
    Alternative sequencei1009 – 104436Missing in isoform XK and isoform ZK. CuratedVSP_000403Add
    BLAST
    Alternative sequencei1104 – 113936Missing in isoform XB and isoform ZB. 2 PublicationsVSP_000404Add
    BLAST
    Alternative sequencei1140 – 1241102IKVVK…LETSV → VAVAPVKSSPTTSVPAVSSP PMGNQSGQSVP in isoform XA, isoform XK, isoform ZA and isoform ZK. 2 PublicationsVSP_000405Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M25874 mRNA. Translation: AAA50819.1.
    M83363 mRNA. Translation: AAA36455.1.
    BX537444 mRNA. Translation: CAD97686.1.
    U42026 mRNA. Translation: AAB17577.1.
    U42061 mRNA. Translation: AAB17578.1.
    U42062 mRNA. Translation: AAB17579.1.
    U42378 mRNA. Translation: AAB17580.1.
    AL513343, AC114402 Genomic DNA. Translation: CAI17025.1.
    AL513343, AC114402 Genomic DNA. Translation: CAI17026.1.
    CH471067 Genomic DNA. Translation: EAW91483.1.
    CH471067 Genomic DNA. Translation: EAW91486.1.
    BC140774 mRNA. Translation: AAI40775.1.
    CCDSiCCDS1440.1. [P23634-6]
    CCDS30977.1. [P23634-2]
    PIRiA35547.
    RefSeqiNP_001001396.1. NM_001001396.2. [P23634-2]
    NP_001675.3. NM_001684.4. [P23634-6]
    UniGeneiHs.343522.
    Hs.733333.

    Genome annotation databases

    EnsembliENST00000341360; ENSP00000340930; ENSG00000058668. [P23634-2]
    ENST00000357681; ENSP00000350310; ENSG00000058668. [P23634-6]
    ENST00000367218; ENSP00000356187; ENSG00000058668. [P23634-2]
    GeneIDi493.
    KEGGihsa:493.
    UCSCiuc001gzv.3. human. [P23634-2]
    uc001gzw.3. human. [P23634-6]

    Polymorphism databases

    DMDMi14286105.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M25874 mRNA. Translation: AAA50819.1 .
    M83363 mRNA. Translation: AAA36455.1 .
    BX537444 mRNA. Translation: CAD97686.1 .
    U42026 mRNA. Translation: AAB17577.1 .
    U42061 mRNA. Translation: AAB17578.1 .
    U42062 mRNA. Translation: AAB17579.1 .
    U42378 mRNA. Translation: AAB17580.1 .
    AL513343 , AC114402 Genomic DNA. Translation: CAI17025.1 .
    AL513343 , AC114402 Genomic DNA. Translation: CAI17026.1 .
    CH471067 Genomic DNA. Translation: EAW91483.1 .
    CH471067 Genomic DNA. Translation: EAW91486.1 .
    BC140774 mRNA. Translation: AAI40775.1 .
    CCDSi CCDS1440.1. [P23634-6 ]
    CCDS30977.1. [P23634-2 ]
    PIRi A35547.
    RefSeqi NP_001001396.1. NM_001001396.2. [P23634-2 ]
    NP_001675.3. NM_001684.4. [P23634-6 ]
    UniGenei Hs.343522.
    Hs.733333.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1CFF NMR - B 1086-1104 [» ]
    2KNE NMR - B 1086-1149 [» ]
    ProteinModelPortali P23634.
    SMRi P23634. Positions 47-945.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106983. 11 interactions.
    DIPi DIP-6128N.
    IntActi P23634. 10 interactions.
    MINTi MINT-219327.
    STRINGi 9606.ENSP00000350310.

    Protein family/group databases

    TCDBi 3.A.3.2.1. the p-type atpase (p-atpase) superfamily.

    PTM databases

    PhosphoSitei P23634.

    Polymorphism databases

    DMDMi 14286105.

    Proteomic databases

    MaxQBi P23634.
    PaxDbi P23634.
    PRIDEi P23634.

    Protocols and materials databases

    DNASUi 493.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000341360 ; ENSP00000340930 ; ENSG00000058668 . [P23634-2 ]
    ENST00000357681 ; ENSP00000350310 ; ENSG00000058668 . [P23634-6 ]
    ENST00000367218 ; ENSP00000356187 ; ENSG00000058668 . [P23634-2 ]
    GeneIDi 493.
    KEGGi hsa:493.
    UCSCi uc001gzv.3. human. [P23634-2 ]
    uc001gzw.3. human. [P23634-6 ]

    Organism-specific databases

    CTDi 493.
    GeneCardsi GC01P203595.
    HGNCi HGNC:817. ATP2B4.
    HPAi CAB016118.
    HPA040431.
    MIMi 108732. gene.
    neXtProti NX_P23634.
    PharmGKBi PA25110.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0474.
    HOVERGENi HBG061286.
    InParanoidi P23634.
    KOi K05850.
    OMAi NFVIHRR.
    OrthoDBi EOG7SN8BN.
    PhylomeDBi P23634.
    TreeFami TF300330.

    Enzyme and pathway databases

    Reactomei REACT_23765. Reduction of cytosolic Ca++ levels.
    REACT_25149. Ion transport by P-type ATPases.

    Miscellaneous databases

    ChiTaRSi ATP2B4. human.
    EvolutionaryTracei P23634.
    GeneWikii ATP2B4.
    GenomeRNAii 493.
    NextBioi 2071.
    PROi P23634.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P23634.
    Bgeei P23634.
    CleanExi HS_ATP2B2.
    HS_ATP2B4.
    Genevestigatori P23634.

    Family and domain databases

    Gene3Di 1.20.1110.10. 3 hits.
    InterProi IPR022141. ATP_Ca_trans_C.
    IPR006408. ATPase_P-typ_Ca-transp_plasma.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF12424. ATP_Ca_trans_C. 2 hits.
    PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 2 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01517. ATPase-IIB_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Peptide sequence analysis and molecular cloning reveal two calcium pump isoforms in the human erythrocyte membrane."
      Strehler E.E., James P., Fischer R., Heim R., Vorherr T.E., Filoteo A.G., Penniston J.T., Carafoli E.
      J. Biol. Chem. 265:2835-2842(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM XB), PARTIAL PROTEIN SEQUENCE.
      Tissue: Erythrocyte.
    2. "Analysis of the tissue-specific distribution of mRNAs encoding the plasma membrane calcium-pumping ATPases and characterization of an alternately spliced form of PMCA4 at the cDNA and genomic levels."
      Brandt P., Neve R.L., Kammesheidt A., Rhoads R.E., Vanaman T.C.
      J. Biol. Chem. 267:4376-4385(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM XA).
      Tissue: Fetal brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM XB).
      Tissue: Fetal kidney.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM XA).
      Tissue: Brain.
    7. "Analysis of mRNA expression and cloning of a novel plasma membrane Ca(2+)-ATPase splice variant in human heart."
      Santiago-Garcia J., Mas-Oliva J., Saavedra D., Zarain-Herzberg A.
      Mol. Cell. Biochem. 155:173-182(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS XA; XB; XK; ZA; ZB AND ZK).
      Tissue: Heart muscle.
    8. "Identification and primary structure of a calmodulin binding domain of the Ca2+ pump of human erythrocytes."
      James P., Maeda M., Fischer R., Verma A.K., Krebs J., Penniston J.T., Carafoli E.
      J. Biol. Chem. 263:2905-2910(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 1085-1153 (ISOFORMS XB/ZB), CALMODULIN-BINDING SUBDOMAIN A.
    9. "A C-terminal, calmodulin-like regulatory domain from the plasma membrane Ca2+-pumping ATPase."
      Brandt P., Zurini M., Neve R.L., Rhoads R.E., Vanaman T.C.
      Proc. Natl. Acad. Sci. U.S.A. 85:2914-2918(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 1177-1190.
    10. "Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes."
      Stauffer T.P., Hilfiker H., Carafoli E., Strehler E.E.
      J. Biol. Chem. 268:25993-26003(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORMS X AND Z).
      Tissue: Heart.
    11. Erratum
      Stauffer T.P., Hilfiker H., Carafoli E., Strehler E.E.
      J. Biol. Chem. 269:32022-32022(1994) [PubMed] [Europe PMC] [Abstract]
    12. "Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants."
      Goellner G.M., DeMarco S.J., Strehler E.E.
      Ann. N. Y. Acad. Sci. 986:461-471(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PDZD11.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters."
      Krapivinsky G., Krapivinsky L., Stotz S.C., Manasian Y., Clapham D.E.
      Proc. Natl. Acad. Sci. U.S.A. 108:19234-19239(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SLC35G1 AND STIM1.
    15. "NMR solution structure of a complex of calmodulin with a binding peptide of the Ca(2+) pump."
      Elshorst B., Hennig M., Foersterling H., Diener A., Maurer M., Schulte P., Schwalbe H., Griesinger C., Krebs J., Schmid H., Vorherr T.E., Carafoli E.
      Biochemistry 38:12320-12332(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 1086-1104 IN COMPLEX WITH CALMODULIN.

    Entry informationi

    Entry nameiAT2B4_HUMAN
    AccessioniPrimary (citable) accession number: P23634
    Secondary accession number(s): B1APW5
    , B1APW6, Q13450, Q13452, Q13455, Q16817, Q7Z3S1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1991
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 158 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3