P23634 (AT2B4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 142.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Plasma membrane calcium-transporting ATPase 4 Short name=PMCA4 EC=3.6.3.8 Alternative name(s): Matrix-remodeling-associated protein 1 Plasma membrane calcium ATPase isoform 4 Plasma membrane calcium pump isoform 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1241 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell. |
| Catalytic activity | ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2). |
| Subcellular location | |
| Tissue specificity | Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | ATP-binding Calcium Calmodulin-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | blood coagulation Traceable author statement. Source: Reactome |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW calcium-transporting ATPase activityTraceable author statement Ref.1. Source: ProtInc metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Dlg2 | Q63622 | 2 | EBI-1174437,EBI-396947 | From a different organism. |
| Dlg3 | Q62936 | 2 | EBI-1174437,EBI-349596 | From a different organism. |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: There is a combination of two alternatively spliced domains at N-terminal site A (X and Z) and at C-terminal site B/C (A, B, D and K). The splice sites have mostly been studied independently. Full isoforms so far detected are isoform XA and isoform XB. Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform XD (identifier: P23634-1) Also known as: AIICIV; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform XA (identifier: P23634-2) Also known as: AIICII; The sequence of this isoform differs from the canonical sequence as follows: 1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP | ||||||
| Isoform ZA (identifier: P23634-3) Also known as: AICII; The sequence of this isoform differs from the canonical sequence as follows: 301-312: Missing. 1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP | ||||||
| Isoform XK (identifier: P23634-4) Also known as: XG; The sequence of this isoform differs from the canonical sequence as follows: 1009-1044: Missing. 1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP | ||||||
| Isoform ZK (identifier: P23634-5) Also known as: ZG; The sequence of this isoform differs from the canonical sequence as follows: 301-312: Missing. 1009-1044: Missing. 1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP | ||||||
| Isoform XB (identifier: P23634-6) Also known as: AIICI; The sequence of this isoform differs from the canonical sequence as follows: 1104-1139: Missing. | ||||||
| Isoform ZB (identifier: P23634-7) Also known as: AICI; The sequence of this isoform differs from the canonical sequence as follows: 301-312: Missing. 1104-1139: Missing. | ||||||
| Isoform ZD (identifier: P23634-8) Also known as: AICIV; The sequence of this isoform differs from the canonical sequence as follows: 301-312: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1241 | 1241 | Plasma membrane calcium-transporting ATPase 4 | PRO_0000046220 | |||||||||
Regions | |||||||||||||
| Topological domain | 1 – 92 | 92 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 93 – 113 | 21 | Helical; Potential | ||||||||||
| Topological domain | 114 – 150 | 37 | Extracellular Potential | ||||||||||
| Transmembrane | 151 – 171 | 21 | Helical; Potential | ||||||||||
| Topological domain | 172 – 356 | 185 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 357 – 376 | 20 | Helical; Potential | ||||||||||
| Topological domain | 377 – 409 | 33 | Extracellular Potential | ||||||||||
| Transmembrane | 410 – 427 | 18 | Helical; Potential | ||||||||||
| Topological domain | 428 – 840 | 413 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 841 – 860 | 20 | Helical; Potential | ||||||||||
| Topological domain | 861 – 870 | 10 | Extracellular Potential | ||||||||||
| Transmembrane | 871 – 891 | 21 | Helical; Potential | ||||||||||
| Topological domain | 892 – 911 | 20 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 912 – 934 | 23 | Helical; Potential | ||||||||||
| Topological domain | 935 – 952 | 18 | Extracellular Potential | ||||||||||
| Transmembrane | 953 – 974 | 22 | Helical; Potential | ||||||||||
| Topological domain | 975 – 993 | 19 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 994 – 1015 | 22 | Helical; Potential | ||||||||||
| Topological domain | 1016 – 1025 | 10 | Extracellular Potential | ||||||||||
| Transmembrane | 1026 – 1047 | 22 | Helical; Potential | ||||||||||
| Topological domain | 1048 – 1241 | 194 | Cytoplasmic Potential | ||||||||||
| Region | 1086 – 1103 | 18 | Calmodulin-binding subdomain A | ||||||||||
| Region | 1104 – 1113 | 10 | Calmodulin-binding subdomain B By similarity | ||||||||||
| Compositional bias | 297 – 303 | 7 | Poly-Lys | ||||||||||
| Compositional bias | 1186 – 1190 | 5 | Poly-Glu | ||||||||||
Sites | |||||||||||||
| Active site | 465 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||||||
| Metal binding | 785 | 1 | Magnesium By similarity | ||||||||||
| Metal binding | 789 | 1 | Magnesium By similarity | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 1102 | 1 | Phosphothreonine; by PKC By similarity | ||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 301 – 312 | 12 | Missing in isoform ZA, isoform ZK, isoform ZB and isoform ZD. | VSP_000402 | |||||||||
| Alternative sequence | 1009 – 1044 | 36 | Missing in isoform XK and isoform ZK. | VSP_000403 | |||||||||
| Alternative sequence | 1104 – 1139 | 36 | Missing in isoform XB and isoform ZB. | VSP_000404 | |||||||||
| Alternative sequence | 1140 – 1241 | 102 | IKVVK…LETSV → VAVAPVKSSPTTSVPAVSSP PMGNQSGQSVP in isoform XA, isoform XK, isoform ZA and isoform ZK. | VSP_000405 | |||||||||
Experimental info | |||||||||||||
| Sequence conflict | 492 | 1 | S → C in CAD97686. Ref.3 | ||||||||||
| Sequence conflict | 1144 | 1 | K → N AA sequence Ref.8 | ||||||||||
| Sequence conflict | 1147 | 1 | H → S AA sequence Ref.8 | ||||||||||
| Sequence conflict | 1153 | 1 | S → F AA sequence Ref.8 | ||||||||||
| Sequence conflict | 1178 | 1 | L → Q AA sequence Ref.9 | ||||||||||
| Sequence conflict | 1187 | 1 | E → Q AA sequence Ref.9 | ||||||||||
| Sequence conflict | 1190 | 1 | E → G in CAD97686. Ref.3 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Turn | 1087 – 1089 | 3 | |||||||||||
| Turn | 1090 – 1092 | 3 | |||||||||||
| Helix | 1093 – 1102 | 10 | |||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Peptide sequence analysis and molecular cloning reveal two calcium pump isoforms in the human erythrocyte membrane." Strehler E.E., James P., Fischer R., Heim R., Vorherr T.E., Filoteo A.G., Penniston J.T., Carafoli E. J. Biol. Chem. 265:2835-2842(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM XB), PARTIAL PROTEIN SEQUENCE. Tissue: Erythrocyte. |
| [2] | "Analysis of the tissue-specific distribution of mRNAs encoding the plasma membrane calcium-pumping ATPases and characterization of an alternately spliced form of PMCA4 at the cDNA and genomic levels." Brandt P., Neve R.L., Kammesheidt A., Rhoads R.E., Vanaman T.C. J. Biol. Chem. 267:4376-4385(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM XA). Tissue: Fetal brain. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM XB). Tissue: Fetal kidney. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM XA). Tissue: Brain. |
| [7] | "Analysis of mRNA expression and cloning of a novel plasma membrane Ca(2+)-ATPase splice variant in human heart." Santiago-Garcia J., Mas-Oliva J., Saavedra D., Zarain-Herzberg A. Mol. Cell. Biochem. 155:173-182(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS XA; XB; XK; ZA; ZB AND ZK). Tissue: Heart muscle. |
| [8] | "Identification and primary structure of a calmodulin binding domain of the Ca2+ pump of human erythrocytes." James P., Maeda M., Fischer R., Verma A.K., Krebs J., Penniston J.T., Carafoli E. J. Biol. Chem. 263:2905-2910(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1085-1153 (ISOFORMS XB/ZB), CALMODULIN-BINDING SUBDOMAIN A. |
| [9] | "A C-terminal, calmodulin-like regulatory domain from the plasma membrane Ca2+-pumping ATPase." Brandt P., Zurini M., Neve R.L., Rhoads R.E., Vanaman T.C. Proc. Natl. Acad. Sci. U.S.A. 85:2914-2918(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1177-1190. |
| [10] | "Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes." Stauffer T.P., Hilfiker H., Carafoli E., Strehler E.E. J. Biol. Chem. 268:25993-26003(1993) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS X AND Z). Tissue: Heart. |
| [11] | Erratum Stauffer T.P., Hilfiker H., Carafoli E., Strehler E.E. J. Biol. Chem. 269:32022-32022(1994) [PubMed] [Europe PMC] [Abstract] |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "NMR solution structure of a complex of calmodulin with a binding peptide of the Ca(2+) pump." Elshorst B., Hennig M., Foersterling H., Diener A., Maurer M., Schulte P., Schwalbe H., Griesinger C., Krebs J., Schmid H., Vorherr T.E., Carafoli E. Biochemistry 38:12320-12332(1999) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1086-1104 IN COMPLEX WITH CALMODULIN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M25874 mRNA. Translation: AAA50819.1. M83363 mRNA. Translation: AAA36455.1. BX537444 mRNA. Translation: CAD97686.1. U42026 mRNA. Translation: AAB17577.1. U42061 mRNA. Translation: AAB17578.1. U42062 mRNA. Translation: AAB17579.1. U42378 mRNA. Translation: AAB17580.1. AL513343, AC114402 Genomic DNA. Translation: CAI17025.1. AL513343, AC114402 Genomic DNA. Translation: CAI17026.1. CH471067 Genomic DNA. Translation: EAW91483.1. CH471067 Genomic DNA. Translation: EAW91486.1. BC140774 mRNA. Translation: AAI40775.1. | ||||||||||||||||||
| IPI | IPI00012490. IPI00217164. IPI00217165. IPI00217166. IPI00217168. IPI00217169. IPI00217170. IPI00217171. | ||||||||||||||||||
| PIR | A35547. | ||||||||||||||||||
| RefSeq | NP_001001396.1. NM_001001396.2. NP_001675.3. NM_001684.4. | ||||||||||||||||||
| UniGene | Hs.343522. Hs.733333. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P23634. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-6128N. | ||||||||||||||||||
| IntAct | P23634. 5 interactions. | ||||||||||||||||||
| MINT | MINT-219327. | ||||||||||||||||||
| STRING | 9606.ENSP00000350310. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| TCDB | 3.A.3.2.1. P-type ATPase (P-ATPase) superfamily. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P23634. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 14286105. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P23634. | ||||||||||||||||||
| PRIDE | P23634. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 493. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000341360; ENSP00000340930; ENSG00000058668. ENST00000357681; ENSP00000350310; ENSG00000058668. ENST00000367218; ENSP00000356187; ENSG00000058668. ENST00000367219; ENSP00000356188; ENSG00000058668. ENST00000391954; ENSP00000375816; ENSG00000058668. | ||||||||||||||||||
| GeneID | 493. | ||||||||||||||||||
| KEGG | hsa:493. | ||||||||||||||||||
| UCSC | uc001gzw.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 493. | ||||||||||||||||||
| GeneCards | GC01P203595. | ||||||||||||||||||
| HGNC | HGNC:817. ATP2B4. | ||||||||||||||||||
| HPA | CAB016118. | ||||||||||||||||||
| MIM | 108732. gene. | ||||||||||||||||||
| neXtProt | NX_P23634. | ||||||||||||||||||
| PharmGKB | PA25110. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0474. | ||||||||||||||||||
| HOVERGEN | HBG061286. | ||||||||||||||||||
| InParanoid | P23634. | ||||||||||||||||||
| KO | K05850. | ||||||||||||||||||
| OMA | RDDMVRT. | ||||||||||||||||||
| OrthoDB | EOG4KPT93. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_604. Hemostasis. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P23634. | ||||||||||||||||||
| Bgee | P23634. | ||||||||||||||||||
| CleanEx | HS_ATP2B2. HS_ATP2B4. | ||||||||||||||||||
| Genevestigator | P23634. | ||||||||||||||||||
| GermOnline | ENSG00000058668. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.20.1110.10. 3 hits. | ||||||||||||||||||
| InterPro | IPR022141. ATP_Ca_trans_C. IPR006408. ATPase_P-typ_Ca-transp_plasma. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023299. ATPase_P-typ_cyto_domN. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR24093. PTHR24093. 1 hit. | ||||||||||||||||||
| Pfam | PF12424. ATP_Ca_trans_C. 2 hits. PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00119. CATATPASE. | ||||||||||||||||||
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. | ||||||||||||||||||
| TIGRFAMs | TIGR01517. ATPase-IIB_Ca. 1 hit. TIGR01494. ATPase_P-type. 3 hits. | ||||||||||||||||||
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | ATP2B4. human. | ||||||||||||||||||
| EvolutionaryTrace | P23634. | ||||||||||||||||||
| GenomeRNAi | 493. | ||||||||||||||||||
| NextBio | 2071. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | AT2B4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P23634 Secondary accession number(s): B1APW5 Q7Z3S1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
