Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plasma membrane calcium-transporting ATPase 4

Gene

ATP2B4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium/calmodulin-regulated and magnesium-dependent enzyme that catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell (PubMed:8530416). By regulating sperm cell calcium homeostasis, may play a role in sperm motility (By similarity).By similarity1 Publication

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).1 Publication

Enzyme regulationi

Activated by calcium/calmodulin.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4654-aspartylphosphate intermediateBy similarity1
Metal bindingi785MagnesiumBy similarity1
Metal bindingi789MagnesiumBy similarity1

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • calcium-transporting ATPase activity Source: BHF-UCL
  • calmodulin binding Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • nitric-oxide synthase binding Source: BHF-UCL
  • nitric-oxide synthase inhibitor activity Source: BHF-UCL
  • PDZ domain binding Source: GO_Central
  • protein phosphatase 2B binding Source: BHF-UCL
  • scaffold protein binding Source: BHF-UCL

GO - Biological processi

  • calcium ion export Source: Ensembl
  • calcium ion import across plasma membrane Source: BHF-UCL
  • calcium ion transmembrane import into cytosol Source: BHF-UCL
  • calcium ion transmembrane transport Source: BHF-UCL
  • cellular calcium ion homeostasis Source: UniProtKB
  • cellular response to epinephrine stimulus Source: BHF-UCL
  • flagellated sperm motility Source: UniProtKB
  • hippocampus development Source: Ensembl
  • ion transmembrane transport Source: Reactome
  • negative regulation of adrenergic receptor signaling pathway involved in heart process Source: BHF-UCL
  • negative regulation of arginine catabolic process Source: BHF-UCL
  • negative regulation of calcineurin-NFAT signaling cascade Source: BHF-UCL
  • negative regulation of cardiac muscle hypertrophy in response to stress Source: BHF-UCL
  • negative regulation of citrulline biosynthetic process Source: BHF-UCL
  • negative regulation of nitric oxide biosynthetic process Source: BHF-UCL
  • negative regulation of nitric oxide mediated signal transduction Source: BHF-UCL
  • negative regulation of nitric-oxide synthase activity Source: BHF-UCL
  • negative regulation of peptidyl-cysteine S-nitrosylation Source: BHF-UCL
  • negative regulation of the force of heart contraction Source: BHF-UCL
  • neural retina development Source: Ensembl
  • positive regulation of cAMP-dependent protein kinase activity Source: BHF-UCL
  • positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  • regulation of cardiac conduction Source: Reactome
  • regulation of cell cycle G1/S phase transition Source: CACAO
  • regulation of sodium ion transmembrane transport Source: BHF-UCL
  • regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • response to hydrostatic pressure Source: BHF-UCL
  • spermatogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS00723-MONOMER.
ReactomeiR-HSA-418359. Reduction of cytosolic Ca++ levels.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Protein family/group databases

TCDBi3.A.3.2.1. the p-type atpase (p-atpase) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 4Curated (EC:3.6.3.81 Publication)
Short name:
PMCA41 PublicationImported
Alternative name(s):
Matrix-remodeling-associated protein 1
Plasma membrane calcium ATPase isoform 4
Plasma membrane calcium pump isoform 4
Gene namesi
Name:ATP2B4Imported
Synonyms:ATP2B2, MXRA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:817. ATP2B4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 92CytoplasmicSequence analysisAdd BLAST92
Transmembranei93 – 113HelicalSequence analysisAdd BLAST21
Topological domaini114 – 150ExtracellularSequence analysisAdd BLAST37
Transmembranei151 – 171HelicalSequence analysisAdd BLAST21
Topological domaini172 – 356CytoplasmicSequence analysisAdd BLAST185
Transmembranei357 – 376HelicalSequence analysisAdd BLAST20
Topological domaini377 – 409ExtracellularSequence analysisAdd BLAST33
Transmembranei410 – 427HelicalSequence analysisAdd BLAST18
Topological domaini428 – 840CytoplasmicSequence analysisAdd BLAST413
Transmembranei841 – 860HelicalSequence analysisAdd BLAST20
Topological domaini861 – 870ExtracellularSequence analysis10
Transmembranei871 – 891HelicalSequence analysisAdd BLAST21
Topological domaini892 – 911CytoplasmicSequence analysisAdd BLAST20
Transmembranei912 – 934HelicalSequence analysisAdd BLAST23
Topological domaini935 – 952ExtracellularSequence analysisAdd BLAST18
Transmembranei953 – 974HelicalSequence analysisAdd BLAST22
Topological domaini975 – 993CytoplasmicSequence analysisAdd BLAST19
Transmembranei994 – 1015HelicalSequence analysisAdd BLAST22
Topological domaini1016 – 1025ExtracellularSequence analysis10
Transmembranei1026 – 1047HelicalSequence analysisAdd BLAST22
Topological domaini1048 – 1241CytoplasmicSequence analysisAdd BLAST194

GO - Cellular componenti

  • basolateral plasma membrane Source: Ensembl
  • caveola Source: BHF-UCL
  • integral component of plasma membrane Source: ProtInc
  • intracellular membrane-bounded organelle Source: GO_Central
  • membrane Source: UniProtKB
  • neuron projection Source: Ensembl
  • plasma membrane Source: HPA
  • protein complex Source: BHF-UCL
  • sperm flagellum Source: UniProtKB
  • sperm principal piece Source: Ensembl
  • T-tubule Source: BHF-UCL
  • Z disc Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi672D → Q: Strongly decreased calcium transport activity. Slowed decomposition of the phosphorylated intermediate. 1 Publication1
Mutagenesisi674V → P: Decreased calcium transport activity. 1 Publication1
Mutagenesisi675R → K, D or L: Decreased calcium transport activity. 1 Publication1
Mutagenesisi686K → L: Decreased calcium transport activity. 1 Publication1
Mutagenesisi693R → I: Mildly decreased calcium transport activity. 1 Publication1

Organism-specific databases

DisGeNETi493.
OpenTargetsiENSG00000058668.
PharmGKBiPA25110.

Polymorphism and mutation databases

BioMutaiATP2B4.
DMDMi14286105.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462201 – 1241Plasma membrane calcium-transporting ATPase 4Add BLAST1241

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei1102Phosphothreonine; by PKCBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP23634.
MaxQBiP23634.
PaxDbiP23634.
PeptideAtlasiP23634.
PRIDEiP23634.

PTM databases

iPTMnetiP23634.
PhosphoSitePlusiP23634.
SwissPalmiP23634.

Expressioni

Tissue specificityi

Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.1 Publication

Gene expression databases

BgeeiENSG00000058668.
CleanExiHS_ATP2B2.
HS_ATP2B4.
ExpressionAtlasiP23634. baseline and differential.
GenevisibleiP23634. HS.

Organism-specific databases

HPAiCAB016118.
HPA040431.

Interactioni

Subunit structurei

Interacts with PDZD11 (PubMed:12763866). Interacts with SLC35G1 and STIM1 (PubMed:22084111). Interacts with calmodulin (PubMed:2963820, PubMed:10493800).4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CALCAP012582EBI-1174388,EBI-1018474
Dlg2Q636222EBI-1174437,EBI-396947From a different organism.
Dlg3Q629362EBI-1174437,EBI-349596From a different organism.

GO - Molecular functioni

  • calmodulin binding Source: BHF-UCL
  • nitric-oxide synthase binding Source: BHF-UCL
  • PDZ domain binding Source: GO_Central
  • protein phosphatase 2B binding Source: BHF-UCL
  • scaffold protein binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi106983. 49 interactors.
DIPiDIP-6128N.
IntActiP23634. 22 interactors.
MINTiMINT-219327.
STRINGi9606.ENSP00000350310.

Structurei

Secondary structure

11241
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni1087 – 1089Combined sources3
Turni1090 – 1092Combined sources3
Helixi1093 – 1102Combined sources10
Helixi1141 – 1147Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CFFNMR-B1086-1104[»]
2KNENMR-B1086-1149[»]
ProteinModelPortaliP23634.
SMRiP23634.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23634.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1086 – 1103Calmodulin-binding subdomain A1 PublicationAdd BLAST18
Regioni1104 – 1113Calmodulin-binding subdomain BBy similarity10

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0204. Eukaryota.
ENOG410XNNC. LUCA.
GeneTreeiENSGT00510000046331.
HOVERGENiHBG061286.
InParanoidiP23634.
KOiK05850.
OMAiLNNNVFI.
PhylomeDBiP23634.
TreeFamiTF300330.

Family and domain databases

Gene3Di1.20.1110.10. 3 hits.
InterProiIPR030319. ATP2B1/4.
IPR022141. ATP_Ca_trans_C.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006408. P-type_ATPase_IIB.
IPR001757. P_typ_ATPase.
[Graphical view]
PANTHERiPTHR24093:SF276. PTHR24093:SF276. 2 hits.
PfamiPF12424. ATP_Ca_trans_C. 2 hits.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 2 hits.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Note: There is a combination of two alternatively spliced domains at N-terminal site A (X and Z) and at C-terminal site B/C (A, B, D and K). The splice sites have mostly been studied independently. Full isoforms so far detected are isoform XA and isoform XB. Experimental confirmation may be lacking for some isoforms.
Isoform XD (identifier: P23634-1) [UniParc]FASTAAdd to basket
Also known as: AIICIV

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTNPSDRVLP ANSMAESREG DFGCTVMELR KLMELRSRDA LTQINVHYGG
60 70 80 90 100
VQNLCSRLKT SPVEGLSGNP ADLEKRRQVF GHNVIPPKKP KTFLELVWEA
110 120 130 140 150
LQDVTLIILE IAAIISLVLS FYRPAGEENE LCGQVATTPE DENEAQAGWI
160 170 180 190 200
EGAAILFSVI IVVLVTAFND WSKEKQFRGL QCRIEQEQKF SIIRNGQLIQ
210 220 230 240 250
LPVAEIVVGD IAQVKYGDLL PADGILIQGN DLKIDESSLT GESDHVKKSL
260 270 280 290 300
DKDPMLLSGT HVMEGSGRMV VTAVGVNSQT GIILTLLGVN EDDEGEKKKK
310 320 330 340 350
GKKQGVPENR NKAKTQDGVA LEIQPLNSQE GIDNEEKDKK AVKVPKKEKS
360 370 380 390 400
VLQGKLTRLA VQIGKAGLLM SALTVFILIL YFVIDNFVIN RRPWLPECTP
410 420 430 440 450
IYIQYFVKFF IIGITVLVVA VPEGLPLAVT ISLAYSVKKM MKDNNLVRHL
460 470 480 490 500
DACETMGNAT AICSDKTGTL TMNRMTVVQA YIGGIHYRQI PSPDVFLPKV
510 520 530 540 550
LDLIVNGISI NSAYTSKILP PEKEGGLPRQ VGNKTECALL GFVTDLKQDY
560 570 580 590 600
QAVRNEVPEE KLYKVYTFNS VRKSMSTVIR NPNGGFRMYS KGASEIILRK
610 620 630 640 650
CNRILDRKGE AVPFKNKDRD DMVRTVIEPM ACDGLRTICI AYRDFDDTEP
660 670 680 690 700
SWDNENEILT ELTCIAVVGI EDPVRPEVPD AIAKCKQAGI TVRMVTGDNI
710 720 730 740 750
NTARAIATKC GILTPGDDFL CLEGKEFNRL IRNEKGEVEQ EKLDKIWPKL
760 770 780 790 800
RVLARSSPTD KHTLVKGIID STVGEHRQVV AVTGDGTNDG PALKKADVGF
810 820 830 840 850
AMGIAGTDVA KEASDIILTD DNFTSIVKAV MWGRNVYDSI SKFLQFQLTV
860 870 880 890 900
NVVAVIVAFT GACITQDSPL KAVQMLWVNL IMDTFASLAL ATEPPTESLL
910 920 930 940 950
KRRPYGRNKP LISRTMMKNI LGHAFYQLIV IFILVFAGEK FFDIDSGRKA
960 970 980 990 1000
PLHSPPSQHY TIVFNTFVLM QLFNEINSRK IHGEKNVFSG IYRNIIFCSV
1010 1020 1030 1040 1050
VLGTFICQIF IVEFGGKPFS CTSLSLSQWL WCLFIGIGEL LWGQFISAIP
1060 1070 1080 1090 1100
TRSLKFLKEA GHGTTKEEIT KDAEGLDEID HAEMELRRGQ ILWFRGLNRI
1110 1120 1130 1140 1150
QTQIDVINTF QTGASFKGVL RRQNMGQHLD VKLVPSSSYI KVVKAFHSSL
1160 1170 1180 1190 1200
HESIQKPYNQ KSIHSFMTHP EFAIEEELPR TPLLDEEEEE NPDKASKFGT
1210 1220 1230 1240
RVLLLDGEVT PYANTNNNAV DCNQVQLPQS DSSLQSLETS V
Length:1,241
Mass (Da):137,920
Last modified:June 1, 2001 - v2
Checksum:i568544103CD5F494
GO
Isoform XA (identifier: P23634-2) [UniParc]FASTAAdd to basket
Also known as: AIICII

The sequence of this isoform differs from the canonical sequence as follows:
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,170
Mass (Da):129,403
Checksum:iC4ED2E2EFE1BB043
GO
Isoform ZA (identifier: P23634-3) [UniParc]FASTAAdd to basket
Also known as: AICII

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,158
Mass (Da):128,066
Checksum:iE7AA8CC9C25E0727
GO
Isoform XK (identifier: P23634-4) [UniParc]FASTAAdd to basket
Also known as: XG

The sequence of this isoform differs from the canonical sequence as follows:
     1009-1044: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,134
Mass (Da):125,344
Checksum:i088F8CB994D46238
GO
Isoform ZK (identifier: P23634-5) [UniParc]FASTAAdd to basket
Also known as: ZG

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1009-1044: Missing.
     1140-1241: IKVVKAFHSS...SSLQSLETSV → VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP

Show »
Length:1,122
Mass (Da):124,007
Checksum:i4AD4378ED226853B
GO
Isoform XB (identifier: P23634-6) [UniParc]FASTAAdd to basket
Also known as: AIICI, hPMCA4b

The sequence of this isoform differs from the canonical sequence as follows:
     1104-1139: Missing.

Show »
Length:1,205
Mass (Da):133,931
Checksum:i76CE806974035974
GO
Isoform ZB (identifier: P23634-7) [UniParc]FASTAAdd to basket
Also known as: AICI

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.
     1104-1139: Missing.

Show »
Length:1,193
Mass (Da):132,594
Checksum:i6AA34BD1850CADB7
GO
Isoform ZD (identifier: P23634-8) [UniParc]FASTAAdd to basket
Also known as: AICIV

The sequence of this isoform differs from the canonical sequence as follows:
     301-312: Missing.

Show »
Length:1,229
Mass (Da):136,584
Checksum:i5E9E48B86464E926
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti492S → C in CAD97686 (PubMed:17974005).Curated1
Sequence conflicti1144K → N AA sequence (PubMed:2963820).Curated1
Sequence conflicti1147H → S AA sequence (PubMed:2963820).Curated1
Sequence conflicti1153S → F AA sequence (PubMed:2963820).Curated1
Sequence conflicti1178L → Q AA sequence (PubMed:2966397).Curated1
Sequence conflicti1187E → Q AA sequence (PubMed:2966397).Curated1
Sequence conflicti1190E → G in CAD97686 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000402301 – 312Missing in isoform ZA, isoform ZK, isoform ZB and isoform ZD. CuratedAdd BLAST12
Alternative sequenceiVSP_0004031009 – 1044Missing in isoform XK and isoform ZK. CuratedAdd BLAST36
Alternative sequenceiVSP_0004041104 – 1139Missing in isoform XB and isoform ZB. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_0004051140 – 1241IKVVK…LETSV → VAVAPVKSSPTTSVPAVSSP PMGNQSGQSVP in isoform XA, isoform XK, isoform ZA and isoform ZK. 2 PublicationsAdd BLAST102

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25874 mRNA. Translation: AAA50819.1.
M83363 mRNA. Translation: AAA36455.1.
BX537444 mRNA. Translation: CAD97686.1.
U42026 mRNA. Translation: AAB17577.1.
U42061 mRNA. Translation: AAB17578.1.
U42062 mRNA. Translation: AAB17579.1.
U42378 mRNA. Translation: AAB17580.1.
AL513343, AC114402 Genomic DNA. Translation: CAI17025.1.
AL513343, AC114402 Genomic DNA. Translation: CAI17026.1.
CH471067 Genomic DNA. Translation: EAW91483.1.
CH471067 Genomic DNA. Translation: EAW91486.1.
BC140774 mRNA. Translation: AAI40775.1.
CCDSiCCDS1440.1. [P23634-6]
CCDS30977.1. [P23634-2]
PIRiA35547.
RefSeqiNP_001001396.1. NM_001001396.2. [P23634-2]
NP_001675.3. NM_001684.4. [P23634-6]
UniGeneiHs.343522.
Hs.733333.

Genome annotation databases

EnsembliENST00000341360; ENSP00000340930; ENSG00000058668. [P23634-2]
ENST00000357681; ENSP00000350310; ENSG00000058668. [P23634-6]
ENST00000367218; ENSP00000356187; ENSG00000058668. [P23634-2]
GeneIDi493.
KEGGihsa:493.
UCSCiuc001gzv.4. human. [P23634-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25874 mRNA. Translation: AAA50819.1.
M83363 mRNA. Translation: AAA36455.1.
BX537444 mRNA. Translation: CAD97686.1.
U42026 mRNA. Translation: AAB17577.1.
U42061 mRNA. Translation: AAB17578.1.
U42062 mRNA. Translation: AAB17579.1.
U42378 mRNA. Translation: AAB17580.1.
AL513343, AC114402 Genomic DNA. Translation: CAI17025.1.
AL513343, AC114402 Genomic DNA. Translation: CAI17026.1.
CH471067 Genomic DNA. Translation: EAW91483.1.
CH471067 Genomic DNA. Translation: EAW91486.1.
BC140774 mRNA. Translation: AAI40775.1.
CCDSiCCDS1440.1. [P23634-6]
CCDS30977.1. [P23634-2]
PIRiA35547.
RefSeqiNP_001001396.1. NM_001001396.2. [P23634-2]
NP_001675.3. NM_001684.4. [P23634-6]
UniGeneiHs.343522.
Hs.733333.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CFFNMR-B1086-1104[»]
2KNENMR-B1086-1149[»]
ProteinModelPortaliP23634.
SMRiP23634.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106983. 49 interactors.
DIPiDIP-6128N.
IntActiP23634. 22 interactors.
MINTiMINT-219327.
STRINGi9606.ENSP00000350310.

Protein family/group databases

TCDBi3.A.3.2.1. the p-type atpase (p-atpase) superfamily.

PTM databases

iPTMnetiP23634.
PhosphoSitePlusiP23634.
SwissPalmiP23634.

Polymorphism and mutation databases

BioMutaiATP2B4.
DMDMi14286105.

Proteomic databases

EPDiP23634.
MaxQBiP23634.
PaxDbiP23634.
PeptideAtlasiP23634.
PRIDEiP23634.

Protocols and materials databases

DNASUi493.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341360; ENSP00000340930; ENSG00000058668. [P23634-2]
ENST00000357681; ENSP00000350310; ENSG00000058668. [P23634-6]
ENST00000367218; ENSP00000356187; ENSG00000058668. [P23634-2]
GeneIDi493.
KEGGihsa:493.
UCSCiuc001gzv.4. human. [P23634-1]

Organism-specific databases

CTDi493.
DisGeNETi493.
GeneCardsiATP2B4.
HGNCiHGNC:817. ATP2B4.
HPAiCAB016118.
HPA040431.
MIMi108732. gene.
neXtProtiNX_P23634.
OpenTargetsiENSG00000058668.
PharmGKBiPA25110.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0204. Eukaryota.
ENOG410XNNC. LUCA.
GeneTreeiENSGT00510000046331.
HOVERGENiHBG061286.
InParanoidiP23634.
KOiK05850.
OMAiLNNNVFI.
PhylomeDBiP23634.
TreeFamiTF300330.

Enzyme and pathway databases

BioCyciZFISH:HS00723-MONOMER.
ReactomeiR-HSA-418359. Reduction of cytosolic Ca++ levels.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSiATP2B4. human.
EvolutionaryTraceiP23634.
GeneWikiiATP2B4.
GenomeRNAii493.
PROiP23634.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000058668.
CleanExiHS_ATP2B2.
HS_ATP2B4.
ExpressionAtlasiP23634. baseline and differential.
GenevisibleiP23634. HS.

Family and domain databases

Gene3Di1.20.1110.10. 3 hits.
InterProiIPR030319. ATP2B1/4.
IPR022141. ATP_Ca_trans_C.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006408. P-type_ATPase_IIB.
IPR001757. P_typ_ATPase.
[Graphical view]
PANTHERiPTHR24093:SF276. PTHR24093:SF276. 2 hits.
PfamiPF12424. ATP_Ca_trans_C. 2 hits.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 2 hits.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAT2B4_HUMAN
AccessioniPrimary (citable) accession number: P23634
Secondary accession number(s): B1APW5
, B1APW6, Q13450, Q13452, Q13455, Q16817, Q7Z3S1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 179 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.