Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain-derived neurotrophic factor

Gene

BDNF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.1 Publication

GO - Molecular functioni

  • growth factor activity Source: ProtInc
  • neurotrophin TRKB receptor binding Source: GO_Central

GO - Biological processi

  • axon guidance Source: BHF-UCL
  • brain-derived neurotrophic factor receptor signaling pathway Source: BHF-UCL
  • cell-cell signaling Source: GO_Central
  • collateral sprouting Source: BHF-UCL
  • negative regulation of neuron apoptotic process Source: GO_Central
  • nervous system development Source: ProtInc
  • positive regulation of brain-derived neurotrophic factor receptor signaling pathway Source: BHF-UCL
  • positive regulation of collateral sprouting Source: BHF-UCL
  • positive regulation of synapse assembly Source: BHF-UCL
  • synapse assembly Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000176697-MONOMER.
SignaLinkiP23560.
SIGNORiP23560.

Names & Taxonomyi

Protein namesi
Recommended name:
Brain-derived neurotrophic factor
Short name:
BDNF
Alternative name(s):
Abrineurin
Gene namesi
Name:BDNF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1033. BDNF.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Bulimia nervosa 2 (BULN2)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA psychiatric disorder characterized by eating an unusually large amount of food in a short period of time, followed by inappropriate acts (purging) to avert weight gain. Compensatory behavior includes self-induced vomiting, laxative abuse, and excessive exercise.
See also OMIM:610269
Congenital central hypoventilation syndrome (CCHS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionRare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.
See also OMIM:209880
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0182602T → I in CCHS. 1 PublicationCorresponds to variant rs8192466dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi54R → A: Abolishes processing by S1P. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi627.
MalaCardsiBDNF.
MIMi209880. phenotype.
610269. phenotype.
OpenTargetsiENSG00000176697.
Orphaneti893. WAGR syndrome.
PharmGKBiPA31891.

Polymorphism and mutation databases

BioMutaiBDNF.
DMDMi114900.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
PropeptideiPRO_000001963319 – 1281 PublicationAdd BLAST110
ChainiPRO_0000019634129 – 247Brain-derived neurotrophic factorAdd BLAST119

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi121N-linked (GlcNAc...)1
Disulfide bondi141 ↔ 208
Disulfide bondi186 ↔ 237
Disulfide bondi196 ↔ 239

Post-translational modificationi

The propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei57 – 58Cleavage; by S1P2

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP23560.
PeptideAtlasiP23560.
PRIDEiP23560.
TopDownProteomicsiP23560-2. [P23560-2]

PTM databases

iPTMnetiP23560.
PhosphoSitePlusiP23560.

Miscellaneous databases

PMAP-CutDBQ6YNR3.

Expressioni

Tissue specificityi

Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.1 Publication

Gene expression databases

BgeeiENSG00000176697.
CleanExiHS_BDNF.
ExpressionAtlasiP23560. baseline and differential.
GenevisibleiP23560. HS.

Organism-specific databases

HPAiCAB009564.

Interactioni

Subunit structurei

Monomers and homodimers. Binds to NTRK2/TRKB.

GO - Molecular functioni

  • growth factor activity Source: ProtInc
  • neurotrophin TRKB receptor binding Source: GO_Central

Protein-protein interaction databases

BioGridi107096. 10 interactors.
DIPiDIP-5719N.
IntActiP23560. 8 interactors.
MINTiMINT-1508504.
STRINGi9606.ENSP00000414303.

Structurei

Secondary structure

1247
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi138 – 141Combined sources4
Beta strandi143 – 149Combined sources7
Helixi150 – 153Combined sources4
Beta strandi155 – 158Combined sources4
Beta strandi163 – 166Combined sources4
Beta strandi168 – 171Combined sources4
Beta strandi173 – 178Combined sources6
Beta strandi180 – 186Combined sources7
Helixi191 – 193Combined sources3
Turni201 – 203Combined sources3
Beta strandi204 – 220Combined sources17
Beta strandi226 – 243Combined sources18

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B8MX-ray2.75A129-247[»]
1BNDX-ray2.30A129-247[»]
ProteinModelPortaliP23560.
SMRiP23560.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23560.

Family & Domainsi

Sequence similaritiesi

Belongs to the NGF-beta family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IH7X. Eukaryota.
ENOG410XRPH. LUCA.
GeneTreeiENSGT00390000007725.
HOVERGENiHBG006494.
InParanoidiP23560.
KOiK04355.
OMAiRVGWRFI.
OrthoDBiEOG091G0GHL.
PhylomeDBiP23560.
TreeFamiTF106463.

Family and domain databases

Gene3Di2.10.90.10. 1 hit.
InterProiIPR020430. Brain-der_neurotrophic_factor.
IPR029034. Cystine-knot_cytokine.
IPR020408. Nerve_growth_factor-like.
IPR002072. Nerve_growth_factor-rel.
IPR019846. Nerve_growth_factor_CS.
[Graphical view]
PANTHERiPTHR11589. PTHR11589. 1 hit.
PfamiPF00243. NGF. 1 hit.
[Graphical view]
PIRSFiPIRSF001789. NGF. 1 hit.
PRINTSiPR01912. BDNFACTOR.
PR00268. NGF.
ProDomiPD002052. Nerve_growth_factor-rel. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SMARTiSM00140. NGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
PROSITEiPS00248. NGF_1. 1 hit.
PS50270. NGF_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Note: 2 types of transcripts are produced: non-coding transcripts (antisense, opposite strand (OS), 8 exons) and coding transcripts (11 exons). Brain BDNF and anti-BDNF transcripts form dsRNA duplexes.
Isoform 1 (identifier: P23560-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTILFLTMVI SYFGCMKAAP MKEANIRGQG GLAYPGVRTH GTLESVNGPK
60 70 80 90 100
AGSRGLTSLA DTFEHVIEEL LDEDQKVRPN EENNKDADLY TSRVMLSSQV
110 120 130 140 150
PLEPPLLFLL EEYKNYLDAA NMSMRVRRHS DPARRGELSV CDSISEWVTA
160 170 180 190 200
ADKKTAVDMS GGTVTVLEKV PVSKGQLKQY FYETKCNPMG YTKEGCRGID
210 220 230 240
KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR
Length:247
Mass (Da):27,818
Last modified:November 1, 1991 - v1
Checksum:i0A60488254722A99
GO
Isoform 2 (identifier: P23560-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFHQVRRVM

Show »
Length:255
Mass (Da):28,872
Checksum:i0E3881F4944CA23C
GO
Isoform 3 (identifier: P23560-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQSREEEWFHQVRRVM

Show »
Length:262
Mass (Da):29,817
Checksum:i28DDC6F9E19BC727
GO
Isoform 4 (identifier: P23560-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCGATSFLHE...IKFHQVRRVM

Show »
Length:329
Mass (Da):37,120
Checksum:i5D19D9F2F62588FA
GO
Isoform 5 (identifier: P23560-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLCAISLCARVRKLRSAGRCGKFHQVRRVM

Show »
Length:276
Mass (Da):31,116
Checksum:iB7B42AA52E6C1A9C
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0182602T → I in CCHS. 1 PublicationCorresponds to variant rs8192466dbSNPEnsembl.1
Natural variantiVAR_00462666V → M Polymorphism; strongly associated with susceptibility to eating disorders such as anorexia nervosa and bulimia nervosa; associated with poorer episodic memory; may have a protective effect in obsessive-compulsive disorder; impairs localization to secretory granules or synapses. 7 PublicationsCorresponds to variant rs6265dbSNPEnsembl.1
Natural variantiVAR_01179775Q → H.Corresponds to variant rs1048218dbSNPEnsembl.1
Natural variantiVAR_011798125R → M.Corresponds to variant rs1048220dbSNPEnsembl.1
Natural variantiVAR_011799127R → L.Corresponds to variant rs1048221dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0379481M → MFHQVRRVM in isoform 2. 3 Publications1
Alternative sequenceiVSP_0380991M → MQSREEEWFHQVRRVM in isoform 3. 2 Publications1
Alternative sequenceiVSP_0381001M → MCGATSFLHECTRLILVTTQ NAEFLQKGLQVHTCFGVYPH ASVWHDCASQKKGCAVYLHV SVEFNKLIPENGFIKFHQVR RVM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0381011M → MLCAISLCARVRKLRSAGRC GKFHQVRRVM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37762 Genomic DNA. Translation: AAA51820.1.
M61176 mRNA. Translation: AAA69805.2.
M61181 Genomic DNA. Translation: AAA96140.1.
X60201 mRNA. Translation: CAA42761.1.
AY054392 mRNA. Translation: AAL23557.2.
AY054393 mRNA. Translation: AAL23558.1.
AY054394 mRNA. Translation: AAL23559.1.
AY054395 mRNA. Translation: AAL23560.1.
AY054396 mRNA. Translation: AAL23561.1.
AY054397 mRNA. Translation: AAL23562.1.
AY054398 mRNA. Translation: AAL23563.1.
AY054399 mRNA. Translation: AAL23564.1.
AY054400 mRNA. Translation: AAL23565.2.
AF411339 Genomic DNA. Translation: AAO15434.1.
EF674517 mRNA. Translation: ABS29021.1.
EF674518 mRNA. Translation: ABS29022.1.
EF674519 mRNA. Translation: ABS29023.1.
EF674520 mRNA. Translation: ABS29024.1.
EF674521 mRNA. Translation: ABS29025.1.
EF689009 mRNA. Translation: ABS32249.1.
EF689010 mRNA. Translation: ABS32250.1.
EF689011 mRNA. Translation: ABS32251.1.
EF689012 mRNA. Translation: ABS32252.1.
EF689013 mRNA. Translation: ABS32253.1.
EF689014 mRNA. Translation: ABS32254.1.
EF689015 mRNA. Translation: ABS32255.1.
EF689016 mRNA. Translation: ABS32256.1.
EF689017 mRNA. Translation: ABS32257.1.
EF689018 mRNA. Translation: ABS32258.1.
EF689019 mRNA. Translation: ABS32259.1.
EF689020 mRNA. Translation: ABS32260.1.
EF689021 mRNA. Translation: ABS32261.1.
X91251 mRNA. Translation: CAA62632.1.
AF400438 mRNA. Translation: AAK92487.1.
AY656701 mRNA. Translation: AAT74399.1.
AK289853 mRNA. Translation: BAF82542.1.
AK289763 mRNA. Translation: BAF82452.1.
AC104563 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68274.1.
CH471064 Genomic DNA. Translation: EAW68278.1.
CH471064 Genomic DNA. Translation: EAW68279.1.
CH471064 Genomic DNA. Translation: EAW68275.1.
CH471064 Genomic DNA. Translation: EAW68276.1.
CH471064 Genomic DNA. Translation: EAW68277.1.
BC029795 mRNA. Translation: AAH29795.1.
AY011481 Genomic DNA. Translation: AAG47514.1.
CCDSiCCDS41628.1. [P23560-3]
CCDS44558.1. [P23560-4]
CCDS7865.1. [P23560-2]
CCDS7866.1. [P23560-1]
PIRiB36208. A40304.
RefSeqiNP_001137277.1. NM_001143805.1. [P23560-1]
NP_001137278.1. NM_001143806.1. [P23560-1]
NP_001137279.1. NM_001143807.1. [P23560-1]
NP_001137280.1. NM_001143808.1. [P23560-1]
NP_001137281.1. NM_001143809.1. [P23560-5]
NP_001137282.1. NM_001143810.1. [P23560-4]
NP_001137283.1. NM_001143811.1. [P23560-1]
NP_001137284.1. NM_001143812.1. [P23560-1]
NP_001137285.1. NM_001143813.1. [P23560-1]
NP_001137286.1. NM_001143814.1. [P23560-1]
NP_001137288.1. NM_001143816.1. [P23560-1]
NP_001700.2. NM_001709.4. [P23560-1]
NP_733927.1. NM_170731.4. [P23560-2]
NP_733928.1. NM_170732.4. [P23560-1]
NP_733929.1. NM_170733.3. [P23560-1]
NP_733930.1. NM_170734.3. [P23560-3]
NP_733931.1. NM_170735.5. [P23560-1]
XP_011518582.1. XM_011520280.2. [P23560-4]
UniGeneiHs.502182.

Genome annotation databases

EnsembliENST00000314915; ENSP00000320002; ENSG00000176697. [P23560-2]
ENST00000356660; ENSP00000349084; ENSG00000176697. [P23560-1]
ENST00000395978; ENSP00000379302; ENSG00000176697. [P23560-1]
ENST00000395980; ENSP00000379304; ENSG00000176697. [P23560-1]
ENST00000395981; ENSP00000379305; ENSG00000176697. [P23560-1]
ENST00000395983; ENSP00000379307; ENSG00000176697. [P23560-1]
ENST00000395986; ENSP00000379309; ENSG00000176697. [P23560-3]
ENST00000418212; ENSP00000400502; ENSG00000176697. [P23560-1]
ENST00000420794; ENSP00000389564; ENSG00000176697. [P23560-1]
ENST00000438929; ENSP00000414303; ENSG00000176697. [P23560-4]
ENST00000439476; ENSP00000389345; ENSG00000176697. [P23560-1]
ENST00000525528; ENSP00000437138; ENSG00000176697. [P23560-1]
ENST00000525950; ENSP00000432035; ENSG00000176697. [P23560-1]
ENST00000530861; ENSP00000435564; ENSG00000176697. [P23560-1]
ENST00000532997; ENSP00000435805; ENSG00000176697. [P23560-1]
ENST00000533131; ENSP00000432727; ENSG00000176697. [P23560-1]
ENST00000533246; ENSP00000432376; ENSG00000176697. [P23560-1]
GeneIDi627.
KEGGihsa:627.
UCSCiuc001mrt.4. human. [P23560-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

BDNF entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37762 Genomic DNA. Translation: AAA51820.1.
M61176 mRNA. Translation: AAA69805.2.
M61181 Genomic DNA. Translation: AAA96140.1.
X60201 mRNA. Translation: CAA42761.1.
AY054392 mRNA. Translation: AAL23557.2.
AY054393 mRNA. Translation: AAL23558.1.
AY054394 mRNA. Translation: AAL23559.1.
AY054395 mRNA. Translation: AAL23560.1.
AY054396 mRNA. Translation: AAL23561.1.
AY054397 mRNA. Translation: AAL23562.1.
AY054398 mRNA. Translation: AAL23563.1.
AY054399 mRNA. Translation: AAL23564.1.
AY054400 mRNA. Translation: AAL23565.2.
AF411339 Genomic DNA. Translation: AAO15434.1.
EF674517 mRNA. Translation: ABS29021.1.
EF674518 mRNA. Translation: ABS29022.1.
EF674519 mRNA. Translation: ABS29023.1.
EF674520 mRNA. Translation: ABS29024.1.
EF674521 mRNA. Translation: ABS29025.1.
EF689009 mRNA. Translation: ABS32249.1.
EF689010 mRNA. Translation: ABS32250.1.
EF689011 mRNA. Translation: ABS32251.1.
EF689012 mRNA. Translation: ABS32252.1.
EF689013 mRNA. Translation: ABS32253.1.
EF689014 mRNA. Translation: ABS32254.1.
EF689015 mRNA. Translation: ABS32255.1.
EF689016 mRNA. Translation: ABS32256.1.
EF689017 mRNA. Translation: ABS32257.1.
EF689018 mRNA. Translation: ABS32258.1.
EF689019 mRNA. Translation: ABS32259.1.
EF689020 mRNA. Translation: ABS32260.1.
EF689021 mRNA. Translation: ABS32261.1.
X91251 mRNA. Translation: CAA62632.1.
AF400438 mRNA. Translation: AAK92487.1.
AY656701 mRNA. Translation: AAT74399.1.
AK289853 mRNA. Translation: BAF82542.1.
AK289763 mRNA. Translation: BAF82452.1.
AC104563 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68274.1.
CH471064 Genomic DNA. Translation: EAW68278.1.
CH471064 Genomic DNA. Translation: EAW68279.1.
CH471064 Genomic DNA. Translation: EAW68275.1.
CH471064 Genomic DNA. Translation: EAW68276.1.
CH471064 Genomic DNA. Translation: EAW68277.1.
BC029795 mRNA. Translation: AAH29795.1.
AY011481 Genomic DNA. Translation: AAG47514.1.
CCDSiCCDS41628.1. [P23560-3]
CCDS44558.1. [P23560-4]
CCDS7865.1. [P23560-2]
CCDS7866.1. [P23560-1]
PIRiB36208. A40304.
RefSeqiNP_001137277.1. NM_001143805.1. [P23560-1]
NP_001137278.1. NM_001143806.1. [P23560-1]
NP_001137279.1. NM_001143807.1. [P23560-1]
NP_001137280.1. NM_001143808.1. [P23560-1]
NP_001137281.1. NM_001143809.1. [P23560-5]
NP_001137282.1. NM_001143810.1. [P23560-4]
NP_001137283.1. NM_001143811.1. [P23560-1]
NP_001137284.1. NM_001143812.1. [P23560-1]
NP_001137285.1. NM_001143813.1. [P23560-1]
NP_001137286.1. NM_001143814.1. [P23560-1]
NP_001137288.1. NM_001143816.1. [P23560-1]
NP_001700.2. NM_001709.4. [P23560-1]
NP_733927.1. NM_170731.4. [P23560-2]
NP_733928.1. NM_170732.4. [P23560-1]
NP_733929.1. NM_170733.3. [P23560-1]
NP_733930.1. NM_170734.3. [P23560-3]
NP_733931.1. NM_170735.5. [P23560-1]
XP_011518582.1. XM_011520280.2. [P23560-4]
UniGeneiHs.502182.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B8MX-ray2.75A129-247[»]
1BNDX-ray2.30A129-247[»]
ProteinModelPortaliP23560.
SMRiP23560.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107096. 10 interactors.
DIPiDIP-5719N.
IntActiP23560. 8 interactors.
MINTiMINT-1508504.
STRINGi9606.ENSP00000414303.

PTM databases

iPTMnetiP23560.
PhosphoSitePlusiP23560.

Polymorphism and mutation databases

BioMutaiBDNF.
DMDMi114900.

Proteomic databases

PaxDbiP23560.
PeptideAtlasiP23560.
PRIDEiP23560.
TopDownProteomicsiP23560-2. [P23560-2]

Protocols and materials databases

DNASUi627.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314915; ENSP00000320002; ENSG00000176697. [P23560-2]
ENST00000356660; ENSP00000349084; ENSG00000176697. [P23560-1]
ENST00000395978; ENSP00000379302; ENSG00000176697. [P23560-1]
ENST00000395980; ENSP00000379304; ENSG00000176697. [P23560-1]
ENST00000395981; ENSP00000379305; ENSG00000176697. [P23560-1]
ENST00000395983; ENSP00000379307; ENSG00000176697. [P23560-1]
ENST00000395986; ENSP00000379309; ENSG00000176697. [P23560-3]
ENST00000418212; ENSP00000400502; ENSG00000176697. [P23560-1]
ENST00000420794; ENSP00000389564; ENSG00000176697. [P23560-1]
ENST00000438929; ENSP00000414303; ENSG00000176697. [P23560-4]
ENST00000439476; ENSP00000389345; ENSG00000176697. [P23560-1]
ENST00000525528; ENSP00000437138; ENSG00000176697. [P23560-1]
ENST00000525950; ENSP00000432035; ENSG00000176697. [P23560-1]
ENST00000530861; ENSP00000435564; ENSG00000176697. [P23560-1]
ENST00000532997; ENSP00000435805; ENSG00000176697. [P23560-1]
ENST00000533131; ENSP00000432727; ENSG00000176697. [P23560-1]
ENST00000533246; ENSP00000432376; ENSG00000176697. [P23560-1]
GeneIDi627.
KEGGihsa:627.
UCSCiuc001mrt.4. human. [P23560-1]

Organism-specific databases

CTDi627.
DisGeNETi627.
GeneCardsiBDNF.
H-InvDBHIX0035926.
HGNCiHGNC:1033. BDNF.
HPAiCAB009564.
MalaCardsiBDNF.
MIMi113505. gene.
209880. phenotype.
610269. phenotype.
neXtProtiNX_P23560.
OpenTargetsiENSG00000176697.
Orphaneti893. WAGR syndrome.
PharmGKBiPA31891.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IH7X. Eukaryota.
ENOG410XRPH. LUCA.
GeneTreeiENSGT00390000007725.
HOVERGENiHBG006494.
InParanoidiP23560.
KOiK04355.
OMAiRVGWRFI.
OrthoDBiEOG091G0GHL.
PhylomeDBiP23560.
TreeFamiTF106463.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000176697-MONOMER.
SignaLinkiP23560.
SIGNORiP23560.

Miscellaneous databases

EvolutionaryTraceiP23560.
GeneWikiiBrain-derived_neurotrophic_factor.
GenomeRNAii627.
PMAP-CutDBQ6YNR3.
PROiP23560.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000176697.
CleanExiHS_BDNF.
ExpressionAtlasiP23560. baseline and differential.
GenevisibleiP23560. HS.

Family and domain databases

Gene3Di2.10.90.10. 1 hit.
InterProiIPR020430. Brain-der_neurotrophic_factor.
IPR029034. Cystine-knot_cytokine.
IPR020408. Nerve_growth_factor-like.
IPR002072. Nerve_growth_factor-rel.
IPR019846. Nerve_growth_factor_CS.
[Graphical view]
PANTHERiPTHR11589. PTHR11589. 1 hit.
PfamiPF00243. NGF. 1 hit.
[Graphical view]
PIRSFiPIRSF001789. NGF. 1 hit.
PRINTSiPR01912. BDNFACTOR.
PR00268. NGF.
ProDomiPD002052. Nerve_growth_factor-rel. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SMARTiSM00140. NGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
PROSITEiPS00248. NGF_1. 1 hit.
PS50270. NGF_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBDNF_HUMAN
AccessioniPrimary (citable) accession number: P23560
Secondary accession number(s): A7LA85
, A7LA92, D3DQZ2, Q598Q1, Q6DN19, Q6YNR2, Q6YNR3, Q9BYY7, Q9UC24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: November 30, 2016
This is version 181 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.