P23560 (BDNF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Brain-derived neurotrophic factor Short name=BDNF Alternative name(s): Abrineurin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 247 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. Ref.26 |
| Subunit structure | Monomers and homodimers. Binds to NTRK2/TRKB. |
| Subcellular location | |
| Tissue specificity | Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. Ref.5 |
| Post-translational modification | The propeptide is N-glycosylated and glycosulfated. Converted into mature BDNF by plasmin (PLG) By similarity. |
| Polymorphism | Variations in BDNF are associated with susceptibility to bulimia nervosa 2 (BULN2) [MIM:610269]. Several genes with an essential role in the regulation of eating behavior and body weight are considered candidates involved in the etiology of eating disorders (ED), but no relevant susceptibility genes with a major effect on anorexia nervosa (AN) or bulimia nervosa (BN) have been identified. BDNF has been implicated in the regulation of food intake and body weight in rodents. A strong association has been reported of the Met-66 allele of the Val-66-Met BDNF variant with restricting AN (ANR) and low minimum body mass index in Spanish patients. Met-66 variant is strongly associated to all ED subtypes (AN, ANR, binge-eating/purging AN and BN) in European patients. Another single nucleotide polymorphism located in the promoter region of the BDNF gene showed an effect on BN and late age at onset of weight loss. These are two variants associated with the pathophysiology of ED in different populations. These variants support a role for BDNF in the susceptibility to aberrant eating behaviors. |
| Involvement in disease | Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS) [MIM:209880]; also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. Ref.24 |
| Sequence similarities | Belongs to the NGF-beta family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Signal |
| Molecular function | Growth factor |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | growth factor activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NTF3 | P20783 | 1 | EBI-1026003,EBI-1025994 |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: 2 types of transcripts are produced: non-coding transcripts (antisense, opposite strand (OS), 8 exons) and coding transcripts (11 exons). Brain BDNF and anti-BDNF transcripts form dsRNA duplexes. | ||||||
| Isoform 1 (identifier: P23560-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P23560-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MFHQVRRVM | ||||||
| Isoform 3 (identifier: P23560-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQSREEEWFHQVRRVM | ||||||
| Isoform 4 (identifier: P23560-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCGATSFLHE...IKFHQVRRVM | ||||||
| Isoform 5 (identifier: P23560-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLCAISLCARVRKLRSAGRCGKFHQVRRVM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||||||||||||||||||||||||
| Propeptide | 19 – 128 | 110 | PRO_0000019633 | ||||||||||||||||||||||||||||
| Chain | 129 – 247 | 119 | Brain-derived neurotrophic factor | PRO_0000019634 | |||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||
| Site | 57 – 58 | 2 | Cleavage; by S1P | ||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||
| Disulfide bond | 141 ↔ 208 | ||||||||||||||||||||||||||||||
| Disulfide bond | 186 ↔ 237 | ||||||||||||||||||||||||||||||
| Disulfide bond | 196 ↔ 239 | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MFHQVRRVM in isoform 2. | VSP_037948 | |||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MQSREEEWFHQVRRVM in isoform 3. | VSP_038099 | |||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MCGATSFLHECTRLILVTTQ NAEFLQKGLQVHTCFGVYPH ASVWHDCASQKKGCAVYLHV SVEFNKLIPENGFIKFHQVR RVM in isoform 4. | VSP_038100 | |||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLCAISLCARVRKLRSAGRC GKFHQVRRVM in isoform 5. | VSP_038101 | |||||||||||||||||||||||||||
| Natural variant | 2 | 1 | T → I in CCHS. Ref.24 Corresponds to variant rs8192466 [ dbSNP | Ensembl ]. | VAR_018260 | |||||||||||||||||||||||||||
| Natural variant | 66 | 1 | V → M Polymorphism that impairs localization to secretory granules or synapses; associated with poorer episodic memory; may have a protective effect in obsessive-compulsive disorder. Ref.8 Ref.22 Ref.25 Ref.26 Ref.27 Ref.28 Corresponds to variant rs6265 [ dbSNP | Ensembl ]. | VAR_004626 | |||||||||||||||||||||||||||
| Natural variant | 75 | 1 | Q → H. Corresponds to variant rs1048218 [ dbSNP | Ensembl ]. | VAR_011797 | |||||||||||||||||||||||||||
| Natural variant | 125 | 1 | R → M. Corresponds to variant rs1048220 [ dbSNP | Ensembl ]. | VAR_011798 | |||||||||||||||||||||||||||
| Natural variant | 127 | 1 | R → L. Corresponds to variant rs1048221 [ dbSNP | Ensembl ]. | VAR_011799 | |||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||
| Mutagenesis | 54 | 1 | R → A: Abolishes processing by S1P. Ref.17 | ||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||
| Beta strand | 138 – 141 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 143 – 149 | 7 | |||||||||||||||||||||||||||||
| Helix | 150 – 153 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 155 – 158 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 163 – 166 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 168 – 171 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 173 – 178 | 6 | |||||||||||||||||||||||||||||
| Beta strand | 180 – 186 | 7 | |||||||||||||||||||||||||||||
| Helix | 191 – 193 | 3 | |||||||||||||||||||||||||||||
| Turn | 201 – 203 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 204 – 220 | 17 | |||||||||||||||||||||||||||||
| Beta strand | 226 – 243 | 18 | |||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a human gene that is a member of the nerve growth factor family." Jones K.R., Reichardt L.F. Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) [PubMed: 2236018] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1). |
| [2] | "Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations." Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D. Genomics 10:558-568(1991) [PubMed: 1889806] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). |
| [3] | "Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene." Shintani A., Ono Y., Kaisho Y., Igarashi K. Biochem. Biophys. Res. Commun. 182:325-332(1992) [PubMed: 1339267] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Human brain derived neurotrophic factor (BDNF) genes, splicing patterns, and assessments of associations with substance abuse and Parkinson's Disease." Liu Q.-R., Walther D., Drgon T., Polesskaya O., Lesnick T.G., Strain K.J., de Andrade M., Bower J.H., Maraganore D.M., Uhl G.R. Am. J. Med. Genet. B Neuropsychiatr. Genet. 134:93-103(2005) [PubMed: 15666411] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING. |
| [5] | "Dissecting the human BDNF locus: bidirectional transcription, complex splicing, and multiple promoters." Pruunsild P., Kazantseva A., Aid T., Palm K., Timmusk T. Genomics 90:397-406(2007) [PubMed: 17629449] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY. Tissue: Brain. |
| [6] | "A cDNA clone of human brain-derived neurotrophic factor (HUMBDNFD)." Cheng Y., Gu J. Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [7] | Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [8] | Perez-Pinera P., Gonzalez-Martinez T., Garcia-Suarez O., Perez-Perez M., Esteban I., Monjil D., Vega J.A. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-66. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [10] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [14] | "Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary." Hallboeoek F., Ibanez C.F., Persson H. Neuron 6:845-858(1991) [PubMed: 2025430] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 185-227. Tissue: Leukocyte. |
| [15] | "Purification and identification of brain-derived neurotrophic factor from human serum." Rosenfeld R.D., Zeni L., Haniu M., Talvenheimo J., Radka S.F., Bennett L., Miller J.A., Welcher A.A. Protein Expr. Purif. 6:465-471(1995) [PubMed: 8527932] [Abstract] Cited for: PROTEIN SEQUENCE OF 129-144. Tissue: Serum. |
| [16] | "Molecular phylogenetics and the origins of placental mammals." Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.-P., Ryder O.A., O'Brien S.J. Nature 409:614-618(2001) [PubMed: 11214319] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 12-197. |
| [17] | "Biosynthesis and post-translational processing of the precursor to brain-derived neurotrophic factor." Mowla S.J., Farhadi H.F., Pareek S., Atwal J.K., Morris S.J., Seidah N.G., Murphy R.A. J. Biol. Chem. 276:12660-12666(2001) [PubMed: 11152678] [Abstract] Cited for: CHARACTERIZATION, MUTAGENESIS OF ARG-54. |
| [18] | "Association of BDNF with anorexia, bulimia and age of onset of weight loss in six European populations." Ribases M., Gratacos M., Fernandez-Aranda F., Bellodi L., Boni C., Anderluh M., Cavallini M.C., Cellini E., Di Bella D., Erzegovesi S., Foulon C., Gabrovsek M., Gorwood P., Hebebrand J., Hinney A., Holliday J., Hu X., Karwautz A. Estivill X.Hum. Mol. Genet. 13:1205-1212(2004) [PubMed: 15115760] [Abstract] Cited for: POLYMORPHISM, ASSOCIATION WITH BULIMIA NERVOSA. |
| [19] | "Brain-derived neurotrophic factor and obesity in the WAGR syndrome." Han J.C., Liu Q.-R., Jones M., Levinn R.L., Menzie C.M., Jefferson-George K.S., Adler-Wailes D.C., Sanford E.L., Lacbawan F.L., Uhl G.R., Rennert O.M., Yanovski J.A. N. Engl. J. Med. 359:918-927(2008) [PubMed: 18753648] [Abstract] Cited for: INVOLVEMENT IN WAGRO SYNDROME. |
| [20] | Erratum Han J.C., Liu Q.-R., Jones M., Levinn R.L., Menzie C.M., Jefferson-George K.S., Adler-Wailes D.C., Sanford E.L., Lacbawan F.L., Uhl G.R., Rennert O.M., Yanovski J.A. N. Engl. J. Med. 359:1414-1414(2008) |
| [21] | "Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer." Robinson R.C., Radziejewski C., Stuart D.I., Jones E.Y. Biochemistry 34:4139-4146(1995) [PubMed: 7703225] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS). |
| [22] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed: 10391209] [Abstract] Cited for: VARIANT MET-66. |
| [23] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| [24] | "Idiopathic congenital central hypoventilation syndrome: evaluation of brain-derived neurotrophic factor genomic DNA sequence variation." Weese-Mayer D.E., Bolk S., Silvestri J.M., Chakravarti A. Am. J. Med. Genet. 107:306-310(2002) [PubMed: 11840487] [Abstract] Cited for: VARIANT CCHS ILE-2. |
| [25] | "Sequence variants of the brain-derived neurotrophic factor (BDNF) gene are strongly associated with obsessive-compulsive disorder." Hall D., Dhilla A., Charalambous A., Gogos J.A., Karayiorgou M. Am. J. Hum. Genet. 73:370-376(2003) [PubMed: 12836135] [Abstract] Cited for: VARIANT MET-66, ROLE OF VARIANT MET-66 IN OBSESSIVE-COMPULSIVE DISORDER. |
| [26] | "The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function." Egan M.F., Kojima M., Callicott J.H., Goldberg T.E., Kolachana B.S., Bertolino A., Zaitsev E., Gold B., Goldman D., Dean M., Lu B., Weinberger D.R. Cell 112:257-269(2003) [PubMed: 12553913] [Abstract] Cited for: VARIANT MET-66, CHARACTERIZATION OF VARIANT MET-66, ROLE IN EPISODIC MEMORY. |
| [27] | "Molecular analysis of congenital central hypoventilation syndrome." Sasaki A., Kanai M., Kijima K., Akaba K., Hashimoto M., Hasegawa H., Otaki S., Koizumi T., Kusuda S., Ogawa Y., Tuchiya K., Yamamoto W., Nakamura T., Hayasaka K. Hum. Genet. 114:22-26(2003) [PubMed: 14566559] [Abstract] Cited for: VARIANT MET-66. |
| [28] | "Met66 in the brain-derived neurotrophic factor (BDNF) precursor is associated with anorexia nervosa restrictive type." Ribases M., Gratacos M., Armengol L., de Cid R., Badia A., Jimenez L., Solano R., Vallejo J., Fernandez F., Estivill X. Mol. Psychiatry 8:745-751(2003) [PubMed: 12888803] [Abstract] Cited for: VARIANT MET-66, ASSOCIATION OF VARIANT MET-66 WITH ANR. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia BDNF entry |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M37762 Genomic DNA. Translation: AAA51820.1. M61176 mRNA. Translation: AAA69805.2. M61181 Genomic DNA. Translation: AAA96140.1. X60201 mRNA. Translation: CAA42761.1. AY054392 mRNA. Translation: AAL23557.2. AY054393 mRNA. Translation: AAL23558.1. AY054394 mRNA. Translation: AAL23559.1. AY054395 mRNA. Translation: AAL23560.1. AY054396 mRNA. Translation: AAL23561.1. AY054397 mRNA. Translation: AAL23562.1. AY054398 mRNA. Translation: AAL23563.1. AY054399 mRNA. Translation: AAL23564.1. AY054400 mRNA. Translation: AAL23565.2. AF411339 Genomic DNA. Translation: AAO15434.1. EF674517 mRNA. Translation: ABS29021.1. EF674518 mRNA. Translation: ABS29022.1. EF674519 mRNA. Translation: ABS29023.1. EF674520 mRNA. Translation: ABS29024.1. EF674521 mRNA. Translation: ABS29025.1. EF689009 mRNA. Translation: ABS32249.1. EF689010 mRNA. Translation: ABS32250.1. EF689011 mRNA. Translation: ABS32251.1. EF689012 mRNA. Translation: ABS32252.1. EF689013 mRNA. Translation: ABS32253.1. EF689014 mRNA. Translation: ABS32254.1. EF689015 mRNA. Translation: ABS32255.1. EF689016 mRNA. Translation: ABS32256.1. EF689017 mRNA. Translation: ABS32257.1. EF689018 mRNA. Translation: ABS32258.1. EF689019 mRNA. Translation: ABS32259.1. EF689020 mRNA. Translation: ABS32260.1. EF689021 mRNA. Translation: ABS32261.1. X91251 mRNA. Translation: CAA62632.1. AF400438 mRNA. Translation: AAK92487.1. AY656701 mRNA. Translation: AAT74399.1. AK289853 mRNA. Translation: BAF82542.1. AK289763 mRNA. Translation: BAF82452.1. AC104563 Genomic DNA. No translation available. CH471064 Genomic DNA. Translation: EAW68274.1. CH471064 Genomic DNA. Translation: EAW68278.1. CH471064 Genomic DNA. Translation: EAW68279.1. CH471064 Genomic DNA. Translation: EAW68275.1. CH471064 Genomic DNA. Translation: EAW68276.1. CH471064 Genomic DNA. Translation: EAW68277.1. BC029795 mRNA. Translation: AAH29795.1. AY011481 Genomic DNA. Translation: AAG47514.1. | ||||||||||||||||||
| IPI | IPI00012058. IPI00336003. IPI00377232. IPI00855724. IPI00917851. | ||||||||||||||||||
| PIR | A40304. B36208. | ||||||||||||||||||
| RefSeq | NP_001137277.1. NM_001143805.1. NP_001137278.1. NM_001143806.1. NP_001137279.1. NM_001143807.1. NP_001137280.1. NM_001143808.1. NP_001137281.1. NM_001143809.1. NP_001137282.1. NM_001143810.1. NP_001137283.1. NM_001143811.1. NP_001137284.1. NM_001143812.1. NP_001137285.1. NM_001143813.1. NP_001137286.1. NM_001143814.1. NP_001137288.1. NM_001143816.1. NP_001700.2. NM_001709.4. NP_733927.1. NM_170731.4. NP_733928.1. NM_170732.4. NP_733929.1. NM_170733.3. NP_733930.1. NM_170734.3. NP_733931.1. NM_170735.5. | ||||||||||||||||||
| UniGene | Hs.502182. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P23560. | ||||||||||||||||||
| SMR | P23560. Positions 136-244. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-5719N. | ||||||||||||||||||
| IntAct | P23560. 5 interactions. | ||||||||||||||||||
| STRING | P23560. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P23560. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 114900. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P23560. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000314915; ENSP00000320002; ENSG00000176697. ENST00000356660; ENSP00000349084; ENSG00000176697. ENST00000395978; ENSP00000379302; ENSG00000176697. ENST00000395980; ENSP00000379304; ENSG00000176697. ENST00000395981; ENSP00000379305; ENSG00000176697. ENST00000395983; ENSP00000379307; ENSG00000176697. ENST00000395986; ENSP00000379309; ENSG00000176697. ENST00000418212; ENSP00000400502; ENSG00000176697. ENST00000420794; ENSP00000389564; ENSG00000176697. ENST00000438929; ENSP00000414303; ENSG00000176697. ENST00000439476; ENSP00000389345; ENSG00000176697. | ||||||||||||||||||
| GeneID | 627. | ||||||||||||||||||
| KEGG | hsa:627. | ||||||||||||||||||
| UCSC | uc001mrs.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 627. | ||||||||||||||||||
| GeneCards | GC11M027676. | ||||||||||||||||||
| HGNC | HGNC:1033. BDNF. | ||||||||||||||||||
| HPA | CAB009564. | ||||||||||||||||||
| MIM | 113505. gene. 209880. phenotype. 610269. phenotype. | ||||||||||||||||||
| neXtProt | NX_P23560. | ||||||||||||||||||
| Orphanet | 661. Ondine syndrome. 893. WAGR syndrome. | ||||||||||||||||||
| PharmGKB | PA25335. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG05055. | ||||||||||||||||||
| HOVERGEN | HBG006494. | ||||||||||||||||||
| InParanoid | P23560. | ||||||||||||||||||
| OMA | DAANMSM. | ||||||||||||||||||
| OrthoDB | EOG4R503P. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | trkrpathway. Neurotrophic factor-mediated Trk receptor signaling. p75ntrpathway. p75(NTR)-mediated signaling. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P23560. | ||||||||||||||||||
| Bgee | P23560. | ||||||||||||||||||
| CleanEx | HS_BDNF. | ||||||||||||||||||
| Genevestigator | P23560. | ||||||||||||||||||
| GermOnline | ENSG00000176697. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR020430. Brain-der_neurotrophic_factor. IPR020408. Nerve_growth_factor-like. IPR002072. Nerve_growth_factor-rel. IPR019846. Nerve_growth_factor_CS. [Graphical view] | ||||||||||||||||||
| KO | K04355. | ||||||||||||||||||
| PANTHER | PTHR11589. NGF. 1 hit. | ||||||||||||||||||
| Pfam | PF00243. NGF. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF001789. NGF. 1 hit. | ||||||||||||||||||
| PRINTS | PR01912. BDNFACTOR. PR00268. NGF. | ||||||||||||||||||
| ProDom | PD002052. Nerve_growth_factor-rel. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||
| SMART | SM00140. NGF. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00248. NGF_1. 1 hit. PS50270. NGF_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 2530. | ||||||||||||||||||
| PMAP-CutDB | P23560. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BDNF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P23560 Secondary accession number(s): A7LA85 Q9UC24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with