Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P23560

- BDNF_HUMAN

UniProt

P23560 - BDNF_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Brain-derived neurotrophic factor

Gene

BDNF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei57 – 582Cleavage; by S1P

GO - Molecular functioni

  1. growth factor activity Source: ProtInc

GO - Biological processi

  1. axon extension Source: Ensembl
  2. axon guidance Source: Ensembl
  3. axon target recognition Source: Ensembl
  4. behavioral fear response Source: Ensembl
  5. chronic inflammatory response Source: Ensembl
  6. circadian rhythm Source: Ensembl
  7. dendrite development Source: Ensembl
  8. dendrite extension Source: Ensembl
  9. feeding behavior Source: Ensembl
  10. gamma-aminobutyric acid signaling pathway Source: Ensembl
  11. glutamate secretion Source: Ensembl
  12. inner ear development Source: Ensembl
  13. learning or memory Source: Ensembl
  14. mechanoreceptor differentiation Source: Ensembl
  15. mitochondrial electron transport, NADH to ubiquinone Source: Ensembl
  16. negative regulation of neuroblast proliferation Source: Ensembl
  17. negative regulation of neuron apoptotic process Source: Ensembl
  18. negative regulation of striated muscle tissue development Source: Ensembl
  19. negative regulation of synaptic transmission, GABAergic Source: Ensembl
  20. nerve development Source: Ensembl
  21. nervous system development Source: ProtInc
  22. neuron recognition Source: Ensembl
  23. positive regulation of long-term neuronal synaptic plasticity Source: Ensembl
  24. positive regulation of neuron differentiation Source: Ensembl
  25. positive regulation of peptidyl-serine phosphorylation Source: Ensembl
  26. positive regulation of synapse assembly Source: BHF-UCL
  27. regulation of excitatory postsynaptic membrane potential Source: Ensembl
  28. regulation of retinal cell programmed cell death Source: Ensembl
  29. regulation of short-term neuronal synaptic plasticity Source: Ensembl
  30. response to anesthetic Source: Ensembl
  31. response to fluoxetine Source: Ensembl
  32. response to hormone Source: Ensembl
  33. response to hyperoxia Source: Ensembl
  34. response to hypoxia Source: Ensembl
  35. response to vitamin A Source: Ensembl
  36. taste bud development Source: Ensembl
  37. ureteric bud development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Enzyme and pathway databases

SignaLinkiP23560.

Names & Taxonomyi

Protein namesi
Recommended name:
Brain-derived neurotrophic factor
Short name:
BDNF
Alternative name(s):
Abrineurin
Gene namesi
Name:BDNF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:1033. BDNF.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. extracellular region Source: UniProtKB-KW
  3. perinuclear region of cytoplasm Source: UniProtKB
  4. synaptic vesicle Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Congenital central hypoventilation syndrome (CCHS) [MIM:209880]: Rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21T → I in CCHS. 1 Publication
Corresponds to variant rs8192466 [ dbSNP | Ensembl ].
VAR_018260

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi54 – 541R → A: Abolishes processing by S1P. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi209880. phenotype.
610269. phenotype.
Orphaneti661. Ondine syndrome.
893. WAGR syndrome.
PharmGKBiPA31891.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818Sequence AnalysisAdd
BLAST
Propeptidei19 – 1281101 PublicationPRO_0000019633Add
BLAST
Chaini129 – 247119Brain-derived neurotrophic factorPRO_0000019634Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi121 – 1211N-linked (GlcNAc...)
Disulfide bondi141 ↔ 208
Disulfide bondi186 ↔ 237
Disulfide bondi196 ↔ 239

Post-translational modificationi

The propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG).By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP23560.
PRIDEiP23560.

PTM databases

PhosphoSiteiP23560.

Miscellaneous databases

PMAP-CutDBQ6YNR3.

Expressioni

Tissue specificityi

Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.1 Publication

Gene expression databases

BgeeiP23560.
CleanExiHS_BDNF.
ExpressionAtlasiP23560. baseline and differential.
GenevestigatoriP23560.

Organism-specific databases

HPAiCAB009564.
HPA056104.

Interactioni

Subunit structurei

Monomers and homodimers. Binds to NTRK2/TRKB.

Protein-protein interaction databases

BioGridi107096. 8 interactions.
DIPiDIP-5719N.
IntActiP23560. 6 interactions.
MINTiMINT-1508504.

Structurei

Secondary structure

1
247
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi138 – 1414
Beta strandi143 – 1497
Helixi150 – 1534
Beta strandi155 – 1584
Beta strandi163 – 1664
Beta strandi168 – 1714
Beta strandi173 – 1786
Beta strandi180 – 1867
Helixi191 – 1933
Turni201 – 2033
Beta strandi204 – 22017
Beta strandi226 – 24318

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1B8MX-ray2.75A129-247[»]
1BNDX-ray2.30A129-247[»]
ProteinModelPortaliP23560.
SMRiP23560. Positions 136-244.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23560.

Family & Domainsi

Sequence similaritiesi

Belongs to the NGF-beta family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG45248.
GeneTreeiENSGT00390000007725.
HOVERGENiHBG006494.
InParanoidiP23560.
KOiK04355.
OMAiRVGWRFI.
OrthoDBiEOG7RBZ8Z.
PhylomeDBiP23560.
TreeFamiTF106463.

Family and domain databases

Gene3Di2.10.90.10. 1 hit.
InterProiIPR020430. Brain-der_neurotrophic_factor.
IPR029034. Cystine-knot_cytokine.
IPR020408. Nerve_growth_factor-like.
IPR002072. Nerve_growth_factor-rel.
IPR019846. Nerve_growth_factor_CS.
[Graphical view]
PANTHERiPTHR11589. PTHR11589. 1 hit.
PfamiPF00243. NGF. 1 hit.
[Graphical view]
PIRSFiPIRSF001789. NGF. 1 hit.
PRINTSiPR01912. BDNFACTOR.
PR00268. NGF.
ProDomiPD002052. Nerve_growth_factor-rel. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SMARTiSM00140. NGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
PROSITEiPS00248. NGF_1. 1 hit.
PS50270. NGF_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: 2 types of transcripts are produced: non-coding transcripts (antisense, opposite strand (OS), 8 exons) and coding transcripts (11 exons). Brain BDNF and anti-BDNF transcripts form dsRNA duplexes.

Isoform 1 (identifier: P23560-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTILFLTMVI SYFGCMKAAP MKEANIRGQG GLAYPGVRTH GTLESVNGPK
60 70 80 90 100
AGSRGLTSLA DTFEHVIEEL LDEDQKVRPN EENNKDADLY TSRVMLSSQV
110 120 130 140 150
PLEPPLLFLL EEYKNYLDAA NMSMRVRRHS DPARRGELSV CDSISEWVTA
160 170 180 190 200
ADKKTAVDMS GGTVTVLEKV PVSKGQLKQY FYETKCNPMG YTKEGCRGID
210 220 230 240
KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR
Length:247
Mass (Da):27,818
Last modified:November 1, 1991 - v1
Checksum:i0A60488254722A99
GO
Isoform 2 (identifier: P23560-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFHQVRRVM

Show »
Length:255
Mass (Da):28,872
Checksum:i0E3881F4944CA23C
GO
Isoform 3 (identifier: P23560-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQSREEEWFHQVRRVM

Show »
Length:262
Mass (Da):29,817
Checksum:i28DDC6F9E19BC727
GO
Isoform 4 (identifier: P23560-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCGATSFLHE...IKFHQVRRVM

Show »
Length:329
Mass (Da):37,120
Checksum:i5D19D9F2F62588FA
GO
Isoform 5 (identifier: P23560-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLCAISLCARVRKLRSAGRCGKFHQVRRVM

Show »
Length:276
Mass (Da):31,116
Checksum:iB7B42AA52E6C1A9C
GO

Polymorphismi

Variations in BDNF are associated with susceptibility to bulimia nervosa 2 (BULN2) [MIMi:610269]. Several genes with an essential role in the regulation of eating behavior and body weight are considered candidates involved in the etiology of eating disorders (ED), but no relevant susceptibility genes with a major effect on anorexia nervosa (AN) or bulimia nervosa (BN) have been identified. BDNF has been implicated in the regulation of food intake and body weight in rodents. A strong association has been reported of the Met-66 allele of the Val-66-Met BDNF variant with restricting AN (ANR) and low minimum body mass index in Spanish patients. Met-66 variant is strongly associated to all ED subtypes (AN, ANR, binge-eating/purging AN and BN) in European patients. Another single nucleotide polymorphism located in the promoter region of the BDNF gene showed an effect on BN and late age at onset of weight loss. These are two variants associated with the pathophysiology of ED in different populations. These variants support a role for BDNF in the susceptibility to aberrant eating behaviors.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21T → I in CCHS. 1 Publication
Corresponds to variant rs8192466 [ dbSNP | Ensembl ].
VAR_018260
Natural varianti66 – 661V → M Polymorphism that impairs localization to secretory granules or synapses; associated with poorer episodic memory; may have a protective effect in obsessive-compulsive disorder. 6 Publications
Corresponds to variant rs6265 [ dbSNP | Ensembl ].
VAR_004626
Natural varianti75 – 751Q → H.
Corresponds to variant rs1048218 [ dbSNP | Ensembl ].
VAR_011797
Natural varianti125 – 1251R → M.
Corresponds to variant rs1048220 [ dbSNP | Ensembl ].
VAR_011798
Natural varianti127 – 1271R → L.
Corresponds to variant rs1048221 [ dbSNP | Ensembl ].
VAR_011799

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MFHQVRRVM in isoform 2. 3 PublicationsVSP_037948
Alternative sequencei1 – 11M → MQSREEEWFHQVRRVM in isoform 3. 2 PublicationsVSP_038099
Alternative sequencei1 – 11M → MCGATSFLHECTRLILVTTQ NAEFLQKGLQVHTCFGVYPH ASVWHDCASQKKGCAVYLHV SVEFNKLIPENGFIKFHQVR RVM in isoform 4. 1 PublicationVSP_038100
Alternative sequencei1 – 11M → MLCAISLCARVRKLRSAGRC GKFHQVRRVM in isoform 5. 1 PublicationVSP_038101

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M37762 Genomic DNA. Translation: AAA51820.1.
M61176 mRNA. Translation: AAA69805.2.
M61181 Genomic DNA. Translation: AAA96140.1.
X60201 mRNA. Translation: CAA42761.1.
AY054392 mRNA. Translation: AAL23557.2.
AY054393 mRNA. Translation: AAL23558.1.
AY054394 mRNA. Translation: AAL23559.1.
AY054395 mRNA. Translation: AAL23560.1.
AY054396 mRNA. Translation: AAL23561.1.
AY054397 mRNA. Translation: AAL23562.1.
AY054398 mRNA. Translation: AAL23563.1.
AY054399 mRNA. Translation: AAL23564.1.
AY054400 mRNA. Translation: AAL23565.2.
AF411339 Genomic DNA. Translation: AAO15434.1.
EF674517 mRNA. Translation: ABS29021.1.
EF674518 mRNA. Translation: ABS29022.1.
EF674519 mRNA. Translation: ABS29023.1.
EF674520 mRNA. Translation: ABS29024.1.
EF674521 mRNA. Translation: ABS29025.1.
EF689009 mRNA. Translation: ABS32249.1.
EF689010 mRNA. Translation: ABS32250.1.
EF689011 mRNA. Translation: ABS32251.1.
EF689012 mRNA. Translation: ABS32252.1.
EF689013 mRNA. Translation: ABS32253.1.
EF689014 mRNA. Translation: ABS32254.1.
EF689015 mRNA. Translation: ABS32255.1.
EF689016 mRNA. Translation: ABS32256.1.
EF689017 mRNA. Translation: ABS32257.1.
EF689018 mRNA. Translation: ABS32258.1.
EF689019 mRNA. Translation: ABS32259.1.
EF689020 mRNA. Translation: ABS32260.1.
EF689021 mRNA. Translation: ABS32261.1.
X91251 mRNA. Translation: CAA62632.1.
AF400438 mRNA. Translation: AAK92487.1.
AY656701 mRNA. Translation: AAT74399.1.
AK289853 mRNA. Translation: BAF82542.1.
AK289763 mRNA. Translation: BAF82452.1.
AC104563 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68274.1.
CH471064 Genomic DNA. Translation: EAW68278.1.
CH471064 Genomic DNA. Translation: EAW68279.1.
CH471064 Genomic DNA. Translation: EAW68275.1.
CH471064 Genomic DNA. Translation: EAW68276.1.
CH471064 Genomic DNA. Translation: EAW68277.1.
BC029795 mRNA. Translation: AAH29795.1.
AY011481 Genomic DNA. Translation: AAG47514.1.
CCDSiCCDS41628.1. [P23560-3]
CCDS44558.1. [P23560-4]
CCDS7865.1. [P23560-2]
CCDS7866.1. [P23560-1]
PIRiB36208. A40304.
RefSeqiNP_001137277.1. NM_001143805.1. [P23560-1]
NP_001137278.1. NM_001143806.1. [P23560-1]
NP_001137279.1. NM_001143807.1. [P23560-1]
NP_001137280.1. NM_001143808.1. [P23560-1]
NP_001137281.1. NM_001143809.1. [P23560-5]
NP_001137282.1. NM_001143810.1. [P23560-4]
NP_001137283.1. NM_001143811.1. [P23560-1]
NP_001137284.1. NM_001143812.1. [P23560-1]
NP_001137285.1. NM_001143813.1. [P23560-1]
NP_001137286.1. NM_001143814.1. [P23560-1]
NP_001137288.1. NM_001143816.1. [P23560-1]
NP_001700.2. NM_001709.4. [P23560-1]
NP_733927.1. NM_170731.4. [P23560-2]
NP_733928.1. NM_170732.4. [P23560-1]
NP_733929.1. NM_170733.3. [P23560-1]
NP_733930.1. NM_170734.3. [P23560-3]
NP_733931.1. NM_170735.5. [P23560-1]
UniGeneiHs.502182.

Genome annotation databases

EnsembliENST00000314915; ENSP00000320002; ENSG00000176697. [P23560-2]
ENST00000356660; ENSP00000349084; ENSG00000176697. [P23560-1]
ENST00000395978; ENSP00000379302; ENSG00000176697. [P23560-1]
ENST00000395980; ENSP00000379304; ENSG00000176697. [P23560-1]
ENST00000395981; ENSP00000379305; ENSG00000176697. [P23560-1]
ENST00000395983; ENSP00000379307; ENSG00000176697. [P23560-1]
ENST00000395986; ENSP00000379309; ENSG00000176697. [P23560-3]
ENST00000418212; ENSP00000400502; ENSG00000176697. [P23560-1]
ENST00000420794; ENSP00000389564; ENSG00000176697. [P23560-1]
ENST00000438929; ENSP00000414303; ENSG00000176697. [P23560-4]
ENST00000439476; ENSP00000389345; ENSG00000176697. [P23560-1]
ENST00000525528; ENSP00000437138; ENSG00000176697. [P23560-1]
ENST00000525950; ENSP00000432035; ENSG00000176697. [P23560-1]
ENST00000530861; ENSP00000435564; ENSG00000176697. [P23560-1]
ENST00000532997; ENSP00000435805; ENSG00000176697. [P23560-1]
ENST00000533131; ENSP00000432727; ENSG00000176697. [P23560-1]
ENST00000533246; ENSP00000432376; ENSG00000176697. [P23560-1]
GeneIDi627.
KEGGihsa:627.
UCSCiuc001mrt.3. human. [P23560-3]
uc001mru.3. human. [P23560-1]
uc001msa.3. human. [P23560-2]
uc009yje.3. human. [P23560-4]
uc009yjf.3. human. [P23560-5]

Polymorphism databases

DMDMi114900.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

BDNF entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M37762 Genomic DNA. Translation: AAA51820.1 .
M61176 mRNA. Translation: AAA69805.2 .
M61181 Genomic DNA. Translation: AAA96140.1 .
X60201 mRNA. Translation: CAA42761.1 .
AY054392 mRNA. Translation: AAL23557.2 .
AY054393 mRNA. Translation: AAL23558.1 .
AY054394 mRNA. Translation: AAL23559.1 .
AY054395 mRNA. Translation: AAL23560.1 .
AY054396 mRNA. Translation: AAL23561.1 .
AY054397 mRNA. Translation: AAL23562.1 .
AY054398 mRNA. Translation: AAL23563.1 .
AY054399 mRNA. Translation: AAL23564.1 .
AY054400 mRNA. Translation: AAL23565.2 .
AF411339 Genomic DNA. Translation: AAO15434.1 .
EF674517 mRNA. Translation: ABS29021.1 .
EF674518 mRNA. Translation: ABS29022.1 .
EF674519 mRNA. Translation: ABS29023.1 .
EF674520 mRNA. Translation: ABS29024.1 .
EF674521 mRNA. Translation: ABS29025.1 .
EF689009 mRNA. Translation: ABS32249.1 .
EF689010 mRNA. Translation: ABS32250.1 .
EF689011 mRNA. Translation: ABS32251.1 .
EF689012 mRNA. Translation: ABS32252.1 .
EF689013 mRNA. Translation: ABS32253.1 .
EF689014 mRNA. Translation: ABS32254.1 .
EF689015 mRNA. Translation: ABS32255.1 .
EF689016 mRNA. Translation: ABS32256.1 .
EF689017 mRNA. Translation: ABS32257.1 .
EF689018 mRNA. Translation: ABS32258.1 .
EF689019 mRNA. Translation: ABS32259.1 .
EF689020 mRNA. Translation: ABS32260.1 .
EF689021 mRNA. Translation: ABS32261.1 .
X91251 mRNA. Translation: CAA62632.1 .
AF400438 mRNA. Translation: AAK92487.1 .
AY656701 mRNA. Translation: AAT74399.1 .
AK289853 mRNA. Translation: BAF82542.1 .
AK289763 mRNA. Translation: BAF82452.1 .
AC104563 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68274.1 .
CH471064 Genomic DNA. Translation: EAW68278.1 .
CH471064 Genomic DNA. Translation: EAW68279.1 .
CH471064 Genomic DNA. Translation: EAW68275.1 .
CH471064 Genomic DNA. Translation: EAW68276.1 .
CH471064 Genomic DNA. Translation: EAW68277.1 .
BC029795 mRNA. Translation: AAH29795.1 .
AY011481 Genomic DNA. Translation: AAG47514.1 .
CCDSi CCDS41628.1. [P23560-3 ]
CCDS44558.1. [P23560-4 ]
CCDS7865.1. [P23560-2 ]
CCDS7866.1. [P23560-1 ]
PIRi B36208. A40304.
RefSeqi NP_001137277.1. NM_001143805.1. [P23560-1 ]
NP_001137278.1. NM_001143806.1. [P23560-1 ]
NP_001137279.1. NM_001143807.1. [P23560-1 ]
NP_001137280.1. NM_001143808.1. [P23560-1 ]
NP_001137281.1. NM_001143809.1. [P23560-5 ]
NP_001137282.1. NM_001143810.1. [P23560-4 ]
NP_001137283.1. NM_001143811.1. [P23560-1 ]
NP_001137284.1. NM_001143812.1. [P23560-1 ]
NP_001137285.1. NM_001143813.1. [P23560-1 ]
NP_001137286.1. NM_001143814.1. [P23560-1 ]
NP_001137288.1. NM_001143816.1. [P23560-1 ]
NP_001700.2. NM_001709.4. [P23560-1 ]
NP_733927.1. NM_170731.4. [P23560-2 ]
NP_733928.1. NM_170732.4. [P23560-1 ]
NP_733929.1. NM_170733.3. [P23560-1 ]
NP_733930.1. NM_170734.3. [P23560-3 ]
NP_733931.1. NM_170735.5. [P23560-1 ]
UniGenei Hs.502182.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1B8M X-ray 2.75 A 129-247 [» ]
1BND X-ray 2.30 A 129-247 [» ]
ProteinModelPortali P23560.
SMRi P23560. Positions 136-244.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107096. 8 interactions.
DIPi DIP-5719N.
IntActi P23560. 6 interactions.
MINTi MINT-1508504.

PTM databases

PhosphoSitei P23560.

Polymorphism databases

DMDMi 114900.

Proteomic databases

PaxDbi P23560.
PRIDEi P23560.

Protocols and materials databases

DNASUi 627.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000314915 ; ENSP00000320002 ; ENSG00000176697 . [P23560-2 ]
ENST00000356660 ; ENSP00000349084 ; ENSG00000176697 . [P23560-1 ]
ENST00000395978 ; ENSP00000379302 ; ENSG00000176697 . [P23560-1 ]
ENST00000395980 ; ENSP00000379304 ; ENSG00000176697 . [P23560-1 ]
ENST00000395981 ; ENSP00000379305 ; ENSG00000176697 . [P23560-1 ]
ENST00000395983 ; ENSP00000379307 ; ENSG00000176697 . [P23560-1 ]
ENST00000395986 ; ENSP00000379309 ; ENSG00000176697 . [P23560-3 ]
ENST00000418212 ; ENSP00000400502 ; ENSG00000176697 . [P23560-1 ]
ENST00000420794 ; ENSP00000389564 ; ENSG00000176697 . [P23560-1 ]
ENST00000438929 ; ENSP00000414303 ; ENSG00000176697 . [P23560-4 ]
ENST00000439476 ; ENSP00000389345 ; ENSG00000176697 . [P23560-1 ]
ENST00000525528 ; ENSP00000437138 ; ENSG00000176697 . [P23560-1 ]
ENST00000525950 ; ENSP00000432035 ; ENSG00000176697 . [P23560-1 ]
ENST00000530861 ; ENSP00000435564 ; ENSG00000176697 . [P23560-1 ]
ENST00000532997 ; ENSP00000435805 ; ENSG00000176697 . [P23560-1 ]
ENST00000533131 ; ENSP00000432727 ; ENSG00000176697 . [P23560-1 ]
ENST00000533246 ; ENSP00000432376 ; ENSG00000176697 . [P23560-1 ]
GeneIDi 627.
KEGGi hsa:627.
UCSCi uc001mrt.3. human. [P23560-3 ]
uc001mru.3. human. [P23560-1 ]
uc001msa.3. human. [P23560-2 ]
uc009yje.3. human. [P23560-4 ]
uc009yjf.3. human. [P23560-5 ]

Organism-specific databases

CTDi 627.
GeneCardsi GC11M027676.
H-InvDB HIX0035926.
HGNCi HGNC:1033. BDNF.
HPAi CAB009564.
HPA056104.
MIMi 113505. gene.
209880. phenotype.
610269. phenotype.
neXtProti NX_P23560.
Orphaneti 661. Ondine syndrome.
893. WAGR syndrome.
PharmGKBi PA31891.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG45248.
GeneTreei ENSGT00390000007725.
HOVERGENi HBG006494.
InParanoidi P23560.
KOi K04355.
OMAi RVGWRFI.
OrthoDBi EOG7RBZ8Z.
PhylomeDBi P23560.
TreeFami TF106463.

Enzyme and pathway databases

SignaLinki P23560.

Miscellaneous databases

EvolutionaryTracei P23560.
GeneWikii Brain-derived_neurotrophic_factor.
GenomeRNAii 627.
NextBioi 2530.
PMAP-CutDB Q6YNR3.
PROi P23560.
SOURCEi Search...

Gene expression databases

Bgeei P23560.
CleanExi HS_BDNF.
ExpressionAtlasi P23560. baseline and differential.
Genevestigatori P23560.

Family and domain databases

Gene3Di 2.10.90.10. 1 hit.
InterProi IPR020430. Brain-der_neurotrophic_factor.
IPR029034. Cystine-knot_cytokine.
IPR020408. Nerve_growth_factor-like.
IPR002072. Nerve_growth_factor-rel.
IPR019846. Nerve_growth_factor_CS.
[Graphical view ]
PANTHERi PTHR11589. PTHR11589. 1 hit.
Pfami PF00243. NGF. 1 hit.
[Graphical view ]
PIRSFi PIRSF001789. NGF. 1 hit.
PRINTSi PR01912. BDNFACTOR.
PR00268. NGF.
ProDomi PD002052. Nerve_growth_factor-rel. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
SMARTi SM00140. NGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57501. SSF57501. 1 hit.
PROSITEi PS00248. NGF_1. 1 hit.
PS50270. NGF_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a human gene that is a member of the nerve growth factor family."
    Jones K.R., Reichardt L.F.
    Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1).
  2. "Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations."
    Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D.
    Genomics 10:558-568(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
  3. "Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene."
    Shintani A., Ono Y., Kaisho Y., Igarashi K.
    Biochem. Biophys. Res. Commun. 182:325-332(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Human brain derived neurotrophic factor (BDNF) genes, splicing patterns, and assessments of associations with substance abuse and Parkinson's Disease."
    Liu Q.-R., Walther D., Drgon T., Polesskaya O., Lesnick T.G., Strain K.J., de Andrade M., Bower J.H., Maraganore D.M., Uhl G.R.
    Am. J. Med. Genet. B Neuropsychiatr. Genet. 134:93-103(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING.
  5. "Dissecting the human BDNF locus: bidirectional transcription, complex splicing, and multiple promoters."
    Pruunsild P., Kazantseva A., Aid T., Palm K., Timmusk T.
    Genomics 90:397-406(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.
    Tissue: Brain.
  6. "A cDNA clone of human brain-derived neurotrophic factor (HUMBDNFD)."
    Cheng Y., Gu J.
    Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  7. Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  8. Perez-Pinera P., Gonzalez-Martinez T., Garcia-Suarez O., Perez-Perez M., Esteban I., Monjil D., Vega J.A.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-66.
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  14. "Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary."
    Hallboeoek F., Ibanez C.F., Persson H.
    Neuron 6:845-858(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 185-227.
    Tissue: Leukocyte.
  15. "Purification and identification of brain-derived neurotrophic factor from human serum."
    Rosenfeld R.D., Zeni L., Haniu M., Talvenheimo J., Radka S.F., Bennett L., Miller J.A., Welcher A.A.
    Protein Expr. Purif. 6:465-471(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 129-144.
    Tissue: Serum.
  16. "Molecular phylogenetics and the origins of placental mammals."
    Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.-P., Ryder O.A., O'Brien S.J.
    Nature 409:614-618(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 12-197.
  17. "Biosynthesis and post-translational processing of the precursor to brain-derived neurotrophic factor."
    Mowla S.J., Farhadi H.F., Pareek S., Atwal J.K., Morris S.J., Seidah N.G., Murphy R.A.
    J. Biol. Chem. 276:12660-12666(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION, MUTAGENESIS OF ARG-54.
  18. Cited for: POLYMORPHISM, ASSOCIATION WITH BULIMIA NERVOSA.
  19. Cited for: INVOLVEMENT IN WAGRO SYNDROME.
  20. "Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer."
    Robinson R.C., Radziejewski C., Stuart D.I., Jones E.Y.
    Biochemistry 34:4139-4146(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS).
  21. Cited for: VARIANT MET-66.
  22. "Idiopathic congenital central hypoventilation syndrome: evaluation of brain-derived neurotrophic factor genomic DNA sequence variation."
    Weese-Mayer D.E., Bolk S., Silvestri J.M., Chakravarti A.
    Am. J. Med. Genet. 107:306-310(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CCHS ILE-2.
  23. "Sequence variants of the brain-derived neurotrophic factor (BDNF) gene are strongly associated with obsessive-compulsive disorder."
    Hall D., Dhilla A., Charalambous A., Gogos J.A., Karayiorgou M.
    Am. J. Hum. Genet. 73:370-376(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT MET-66, ROLE OF VARIANT MET-66 IN OBSESSIVE-COMPULSIVE DISORDER.
  24. "The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function."
    Egan M.F., Kojima M., Callicott J.H., Goldberg T.E., Kolachana B.S., Bertolino A., Zaitsev E., Gold B., Goldman D., Dean M., Lu B., Weinberger D.R.
    Cell 112:257-269(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT MET-66, CHARACTERIZATION OF VARIANT MET-66, ROLE IN EPISODIC MEMORY.
  25. Cited for: VARIANT MET-66.
  26. "Met66 in the brain-derived neurotrophic factor (BDNF) precursor is associated with anorexia nervosa restrictive type."
    Ribases M., Gratacos M., Armengol L., de Cid R., Badia A., Jimenez L., Solano R., Vallejo J., Fernandez F., Estivill X.
    Mol. Psychiatry 8:745-751(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT MET-66, ASSOCIATION OF VARIANT MET-66 WITH ANR.

Entry informationi

Entry nameiBDNF_HUMAN
AccessioniPrimary (citable) accession number: P23560
Secondary accession number(s): A7LA85
, A7LA92, D3DQZ2, Q598Q1, Q6DN19, Q6YNR2, Q6YNR3, Q9BYY7, Q9UC24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: October 29, 2014
This is version 159 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3