Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P23560

- BDNF_HUMAN

UniProt

P23560 - BDNF_HUMAN

Protein

Brain-derived neurotrophic factor

Gene

BDNF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 1 (01 Nov 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei57 – 582Cleavage; by S1P

    GO - Molecular functioni

    1. growth factor activity Source: ProtInc

    GO - Biological processi

    1. axon guidance Source: Ensembl
    2. axon target recognition Source: Ensembl
    3. behavioral fear response Source: Ensembl
    4. chronic inflammatory response Source: Ensembl
    5. dendrite development Source: Ensembl
    6. feeding behavior Source: Ensembl
    7. glutamate secretion Source: Ensembl
    8. inner ear development Source: Ensembl
    9. learning or memory Source: Ensembl
    10. mechanoreceptor differentiation Source: Ensembl
    11. mitochondrial electron transport, NADH to ubiquinone Source: Ensembl
    12. negative regulation of neuroblast proliferation Source: Ensembl
    13. negative regulation of neuron apoptotic process Source: Ensembl
    14. negative regulation of striated muscle tissue development Source: Ensembl
    15. nerve development Source: Ensembl
    16. nervous system development Source: ProtInc
    17. neuron recognition Source: Ensembl
    18. positive regulation of long-term neuronal synaptic plasticity Source: Ensembl
    19. positive regulation of neuron differentiation Source: Ensembl
    20. positive regulation of synapse assembly Source: BHF-UCL
    21. regulation of excitatory postsynaptic membrane potential Source: Ensembl
    22. regulation of metabolic process Source: Ensembl
    23. regulation of retinal cell programmed cell death Source: Ensembl
    24. regulation of short-term neuronal synaptic plasticity Source: Ensembl
    25. response to anesthetic Source: Ensembl
    26. response to fluoxetine Source: Ensembl
    27. response to hormone Source: Ensembl
    28. response to hyperoxia Source: Ensembl
    29. response to hypoxia Source: Ensembl
    30. response to vitamin A Source: Ensembl
    31. ureteric bud development Source: Ensembl

    Keywords - Molecular functioni

    Growth factor

    Enzyme and pathway databases

    SignaLinkiP23560.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Brain-derived neurotrophic factor
    Short name:
    BDNF
    Alternative name(s):
    Abrineurin
    Gene namesi
    Name:BDNF
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:1033. BDNF.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. extracellular region Source: UniProtKB-SubCell
    3. perinuclear region of cytoplasm Source: UniProtKB
    4. synaptic vesicle Source: Ensembl

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Congenital central hypoventilation syndrome (CCHS) [MIM:209880]: Rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2 – 21T → I in CCHS. 1 Publication
    Corresponds to variant rs8192466 [ dbSNP | Ensembl ].
    VAR_018260

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi54 – 541R → A: Abolishes processing by S1P. 1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi209880. phenotype.
    610269. phenotype.
    Orphaneti661. Ondine syndrome.
    893. WAGR syndrome.
    PharmGKBiPA31891.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Sequence AnalysisAdd
    BLAST
    Propeptidei19 – 1281101 PublicationPRO_0000019633Add
    BLAST
    Chaini129 – 247119Brain-derived neurotrophic factorPRO_0000019634Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi121 – 1211N-linked (GlcNAc...)
    Disulfide bondi141 ↔ 208
    Disulfide bondi186 ↔ 237
    Disulfide bondi196 ↔ 239

    Post-translational modificationi

    The propeptide is N-glycosylated and glycosulfated.
    Converted into mature BDNF by plasmin (PLG).By similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP23560.
    PRIDEiP23560.

    PTM databases

    PhosphoSiteiP23560.

    Miscellaneous databases

    PMAP-CutDBQ6YNR3.

    Expressioni

    Tissue specificityi

    Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.1 Publication

    Gene expression databases

    ArrayExpressiP23560.
    BgeeiP23560.
    CleanExiHS_BDNF.
    GenevestigatoriP23560.

    Organism-specific databases

    HPAiCAB009564.
    HPA056104.

    Interactioni

    Subunit structurei

    Monomers and homodimers. Binds to NTRK2/TRKB.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    NTF3P207831EBI-1026003,EBI-1025994

    Protein-protein interaction databases

    BioGridi107096. 8 interactions.
    DIPiDIP-5719N.
    IntActiP23560. 6 interactions.
    MINTiMINT-1508504.

    Structurei

    Secondary structure

    1
    247
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi138 – 1414
    Beta strandi143 – 1497
    Helixi150 – 1534
    Beta strandi155 – 1584
    Beta strandi163 – 1664
    Beta strandi168 – 1714
    Beta strandi173 – 1786
    Beta strandi180 – 1867
    Helixi191 – 1933
    Turni201 – 2033
    Beta strandi204 – 22017
    Beta strandi226 – 24318

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1B8MX-ray2.75A129-247[»]
    1BNDX-ray2.30A129-247[»]
    ProteinModelPortaliP23560.
    SMRiP23560. Positions 136-244.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP23560.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NGF-beta family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG45248.
    HOVERGENiHBG006494.
    InParanoidiP23560.
    KOiK04355.
    OMAiRVGWRFI.
    OrthoDBiEOG7RBZ8Z.
    PhylomeDBiP23560.
    TreeFamiTF106463.

    Family and domain databases

    Gene3Di2.10.90.10. 1 hit.
    InterProiIPR020430. Brain-der_neurotrophic_factor.
    IPR029034. Cystine-knot_cytokine.
    IPR020408. Nerve_growth_factor-like.
    IPR002072. Nerve_growth_factor-rel.
    IPR019846. Nerve_growth_factor_CS.
    [Graphical view]
    PANTHERiPTHR11589. PTHR11589. 1 hit.
    PfamiPF00243. NGF. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001789. NGF. 1 hit.
    PRINTSiPR01912. BDNFACTOR.
    PR00268. NGF.
    ProDomiPD002052. Nerve_growth_factor-rel. 1 hit.
    [Graphical view] [Entries sharing at least one domain]
    SMARTiSM00140. NGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF57501. SSF57501. 1 hit.
    PROSITEiPS00248. NGF_1. 1 hit.
    PS50270. NGF_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: 2 types of transcripts are produced: non-coding transcripts (antisense, opposite strand (OS), 8 exons) and coding transcripts (11 exons). Brain BDNF and anti-BDNF transcripts form dsRNA duplexes.

    Isoform 1 (identifier: P23560-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTILFLTMVI SYFGCMKAAP MKEANIRGQG GLAYPGVRTH GTLESVNGPK    50
    AGSRGLTSLA DTFEHVIEEL LDEDQKVRPN EENNKDADLY TSRVMLSSQV 100
    PLEPPLLFLL EEYKNYLDAA NMSMRVRRHS DPARRGELSV CDSISEWVTA 150
    ADKKTAVDMS GGTVTVLEKV PVSKGQLKQY FYETKCNPMG YTKEGCRGID 200
    KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR 247
    Length:247
    Mass (Da):27,818
    Last modified:November 1, 1991 - v1
    Checksum:i0A60488254722A99
    GO
    Isoform 2 (identifier: P23560-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MFHQVRRVM

    Show »
    Length:255
    Mass (Da):28,872
    Checksum:i0E3881F4944CA23C
    GO
    Isoform 3 (identifier: P23560-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MQSREEEWFHQVRRVM

    Show »
    Length:262
    Mass (Da):29,817
    Checksum:i28DDC6F9E19BC727
    GO
    Isoform 4 (identifier: P23560-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCGATSFLHE...IKFHQVRRVM

    Show »
    Length:329
    Mass (Da):37,120
    Checksum:i5D19D9F2F62588FA
    GO
    Isoform 5 (identifier: P23560-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLCAISLCARVRKLRSAGRCGKFHQVRRVM

    Show »
    Length:276
    Mass (Da):31,116
    Checksum:iB7B42AA52E6C1A9C
    GO

    Polymorphismi

    Variations in BDNF are associated with susceptibility to bulimia nervosa 2 (BULN2) [MIMi:610269]. Several genes with an essential role in the regulation of eating behavior and body weight are considered candidates involved in the etiology of eating disorders (ED), but no relevant susceptibility genes with a major effect on anorexia nervosa (AN) or bulimia nervosa (BN) have been identified. BDNF has been implicated in the regulation of food intake and body weight in rodents. A strong association has been reported of the Met-66 allele of the Val-66-Met BDNF variant with restricting AN (ANR) and low minimum body mass index in Spanish patients. Met-66 variant is strongly associated to all ED subtypes (AN, ANR, binge-eating/purging AN and BN) in European patients. Another single nucleotide polymorphism located in the promoter region of the BDNF gene showed an effect on BN and late age at onset of weight loss. These are two variants associated with the pathophysiology of ED in different populations. These variants support a role for BDNF in the susceptibility to aberrant eating behaviors.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2 – 21T → I in CCHS. 1 Publication
    Corresponds to variant rs8192466 [ dbSNP | Ensembl ].
    VAR_018260
    Natural varianti66 – 661V → M Polymorphism that impairs localization to secretory granules or synapses; associated with poorer episodic memory; may have a protective effect in obsessive-compulsive disorder. 6 Publications
    Corresponds to variant rs6265 [ dbSNP | Ensembl ].
    VAR_004626
    Natural varianti75 – 751Q → H.
    Corresponds to variant rs1048218 [ dbSNP | Ensembl ].
    VAR_011797
    Natural varianti125 – 1251R → M.
    Corresponds to variant rs1048220 [ dbSNP | Ensembl ].
    VAR_011798
    Natural varianti127 – 1271R → L.
    Corresponds to variant rs1048221 [ dbSNP | Ensembl ].
    VAR_011799

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MFHQVRRVM in isoform 2. 3 PublicationsVSP_037948
    Alternative sequencei1 – 11M → MQSREEEWFHQVRRVM in isoform 3. 2 PublicationsVSP_038099
    Alternative sequencei1 – 11M → MCGATSFLHECTRLILVTTQ NAEFLQKGLQVHTCFGVYPH ASVWHDCASQKKGCAVYLHV SVEFNKLIPENGFIKFHQVR RVM in isoform 4. 1 PublicationVSP_038100
    Alternative sequencei1 – 11M → MLCAISLCARVRKLRSAGRC GKFHQVRRVM in isoform 5. 1 PublicationVSP_038101

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M37762 Genomic DNA. Translation: AAA51820.1.
    M61176 mRNA. Translation: AAA69805.2.
    M61181 Genomic DNA. Translation: AAA96140.1.
    X60201 mRNA. Translation: CAA42761.1.
    AY054392 mRNA. Translation: AAL23557.2.
    AY054393 mRNA. Translation: AAL23558.1.
    AY054394 mRNA. Translation: AAL23559.1.
    AY054395 mRNA. Translation: AAL23560.1.
    AY054396 mRNA. Translation: AAL23561.1.
    AY054397 mRNA. Translation: AAL23562.1.
    AY054398 mRNA. Translation: AAL23563.1.
    AY054399 mRNA. Translation: AAL23564.1.
    AY054400 mRNA. Translation: AAL23565.2.
    AF411339 Genomic DNA. Translation: AAO15434.1.
    EF674517 mRNA. Translation: ABS29021.1.
    EF674518 mRNA. Translation: ABS29022.1.
    EF674519 mRNA. Translation: ABS29023.1.
    EF674520 mRNA. Translation: ABS29024.1.
    EF674521 mRNA. Translation: ABS29025.1.
    EF689009 mRNA. Translation: ABS32249.1.
    EF689010 mRNA. Translation: ABS32250.1.
    EF689011 mRNA. Translation: ABS32251.1.
    EF689012 mRNA. Translation: ABS32252.1.
    EF689013 mRNA. Translation: ABS32253.1.
    EF689014 mRNA. Translation: ABS32254.1.
    EF689015 mRNA. Translation: ABS32255.1.
    EF689016 mRNA. Translation: ABS32256.1.
    EF689017 mRNA. Translation: ABS32257.1.
    EF689018 mRNA. Translation: ABS32258.1.
    EF689019 mRNA. Translation: ABS32259.1.
    EF689020 mRNA. Translation: ABS32260.1.
    EF689021 mRNA. Translation: ABS32261.1.
    X91251 mRNA. Translation: CAA62632.1.
    AF400438 mRNA. Translation: AAK92487.1.
    AY656701 mRNA. Translation: AAT74399.1.
    AK289853 mRNA. Translation: BAF82542.1.
    AK289763 mRNA. Translation: BAF82452.1.
    AC104563 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68274.1.
    CH471064 Genomic DNA. Translation: EAW68278.1.
    CH471064 Genomic DNA. Translation: EAW68279.1.
    CH471064 Genomic DNA. Translation: EAW68275.1.
    CH471064 Genomic DNA. Translation: EAW68276.1.
    CH471064 Genomic DNA. Translation: EAW68277.1.
    BC029795 mRNA. Translation: AAH29795.1.
    AY011481 Genomic DNA. Translation: AAG47514.1.
    CCDSiCCDS41628.1. [P23560-3]
    CCDS44558.1. [P23560-4]
    CCDS7865.1. [P23560-2]
    CCDS7866.1. [P23560-1]
    PIRiB36208. A40304.
    RefSeqiNP_001137277.1. NM_001143805.1. [P23560-1]
    NP_001137278.1. NM_001143806.1. [P23560-1]
    NP_001137279.1. NM_001143807.1. [P23560-1]
    NP_001137280.1. NM_001143808.1. [P23560-1]
    NP_001137281.1. NM_001143809.1. [P23560-5]
    NP_001137282.1. NM_001143810.1. [P23560-4]
    NP_001137283.1. NM_001143811.1. [P23560-1]
    NP_001137284.1. NM_001143812.1. [P23560-1]
    NP_001137285.1. NM_001143813.1. [P23560-1]
    NP_001137286.1. NM_001143814.1. [P23560-1]
    NP_001137288.1. NM_001143816.1. [P23560-1]
    NP_001700.2. NM_001709.4. [P23560-1]
    NP_733927.1. NM_170731.4. [P23560-2]
    NP_733928.1. NM_170732.4. [P23560-1]
    NP_733929.1. NM_170733.3. [P23560-1]
    NP_733930.1. NM_170734.3. [P23560-3]
    NP_733931.1. NM_170735.5. [P23560-1]
    UniGeneiHs.502182.

    Genome annotation databases

    EnsembliENST00000314915; ENSP00000320002; ENSG00000176697. [P23560-2]
    ENST00000356660; ENSP00000349084; ENSG00000176697. [P23560-1]
    ENST00000395978; ENSP00000379302; ENSG00000176697. [P23560-1]
    ENST00000395980; ENSP00000379304; ENSG00000176697. [P23560-1]
    ENST00000395981; ENSP00000379305; ENSG00000176697. [P23560-1]
    ENST00000395983; ENSP00000379307; ENSG00000176697. [P23560-1]
    ENST00000395986; ENSP00000379309; ENSG00000176697. [P23560-3]
    ENST00000418212; ENSP00000400502; ENSG00000176697. [P23560-1]
    ENST00000420794; ENSP00000389564; ENSG00000176697. [P23560-1]
    ENST00000438929; ENSP00000414303; ENSG00000176697. [P23560-4]
    ENST00000439476; ENSP00000389345; ENSG00000176697. [P23560-1]
    ENST00000525528; ENSP00000437138; ENSG00000176697. [P23560-1]
    ENST00000525950; ENSP00000432035; ENSG00000176697. [P23560-1]
    ENST00000530861; ENSP00000435564; ENSG00000176697. [P23560-1]
    ENST00000532997; ENSP00000435805; ENSG00000176697. [P23560-1]
    ENST00000533131; ENSP00000432727; ENSG00000176697. [P23560-1]
    ENST00000533246; ENSP00000432376; ENSG00000176697. [P23560-1]
    GeneIDi627.
    KEGGihsa:627.
    UCSCiuc001mrt.3. human. [P23560-3]
    uc001mru.3. human. [P23560-1]
    uc001msa.3. human. [P23560-2]
    uc009yje.3. human. [P23560-4]
    uc009yjf.3. human. [P23560-5]

    Polymorphism databases

    DMDMi114900.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    BDNF entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M37762 Genomic DNA. Translation: AAA51820.1 .
    M61176 mRNA. Translation: AAA69805.2 .
    M61181 Genomic DNA. Translation: AAA96140.1 .
    X60201 mRNA. Translation: CAA42761.1 .
    AY054392 mRNA. Translation: AAL23557.2 .
    AY054393 mRNA. Translation: AAL23558.1 .
    AY054394 mRNA. Translation: AAL23559.1 .
    AY054395 mRNA. Translation: AAL23560.1 .
    AY054396 mRNA. Translation: AAL23561.1 .
    AY054397 mRNA. Translation: AAL23562.1 .
    AY054398 mRNA. Translation: AAL23563.1 .
    AY054399 mRNA. Translation: AAL23564.1 .
    AY054400 mRNA. Translation: AAL23565.2 .
    AF411339 Genomic DNA. Translation: AAO15434.1 .
    EF674517 mRNA. Translation: ABS29021.1 .
    EF674518 mRNA. Translation: ABS29022.1 .
    EF674519 mRNA. Translation: ABS29023.1 .
    EF674520 mRNA. Translation: ABS29024.1 .
    EF674521 mRNA. Translation: ABS29025.1 .
    EF689009 mRNA. Translation: ABS32249.1 .
    EF689010 mRNA. Translation: ABS32250.1 .
    EF689011 mRNA. Translation: ABS32251.1 .
    EF689012 mRNA. Translation: ABS32252.1 .
    EF689013 mRNA. Translation: ABS32253.1 .
    EF689014 mRNA. Translation: ABS32254.1 .
    EF689015 mRNA. Translation: ABS32255.1 .
    EF689016 mRNA. Translation: ABS32256.1 .
    EF689017 mRNA. Translation: ABS32257.1 .
    EF689018 mRNA. Translation: ABS32258.1 .
    EF689019 mRNA. Translation: ABS32259.1 .
    EF689020 mRNA. Translation: ABS32260.1 .
    EF689021 mRNA. Translation: ABS32261.1 .
    X91251 mRNA. Translation: CAA62632.1 .
    AF400438 mRNA. Translation: AAK92487.1 .
    AY656701 mRNA. Translation: AAT74399.1 .
    AK289853 mRNA. Translation: BAF82542.1 .
    AK289763 mRNA. Translation: BAF82452.1 .
    AC104563 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68274.1 .
    CH471064 Genomic DNA. Translation: EAW68278.1 .
    CH471064 Genomic DNA. Translation: EAW68279.1 .
    CH471064 Genomic DNA. Translation: EAW68275.1 .
    CH471064 Genomic DNA. Translation: EAW68276.1 .
    CH471064 Genomic DNA. Translation: EAW68277.1 .
    BC029795 mRNA. Translation: AAH29795.1 .
    AY011481 Genomic DNA. Translation: AAG47514.1 .
    CCDSi CCDS41628.1. [P23560-3 ]
    CCDS44558.1. [P23560-4 ]
    CCDS7865.1. [P23560-2 ]
    CCDS7866.1. [P23560-1 ]
    PIRi B36208. A40304.
    RefSeqi NP_001137277.1. NM_001143805.1. [P23560-1 ]
    NP_001137278.1. NM_001143806.1. [P23560-1 ]
    NP_001137279.1. NM_001143807.1. [P23560-1 ]
    NP_001137280.1. NM_001143808.1. [P23560-1 ]
    NP_001137281.1. NM_001143809.1. [P23560-5 ]
    NP_001137282.1. NM_001143810.1. [P23560-4 ]
    NP_001137283.1. NM_001143811.1. [P23560-1 ]
    NP_001137284.1. NM_001143812.1. [P23560-1 ]
    NP_001137285.1. NM_001143813.1. [P23560-1 ]
    NP_001137286.1. NM_001143814.1. [P23560-1 ]
    NP_001137288.1. NM_001143816.1. [P23560-1 ]
    NP_001700.2. NM_001709.4. [P23560-1 ]
    NP_733927.1. NM_170731.4. [P23560-2 ]
    NP_733928.1. NM_170732.4. [P23560-1 ]
    NP_733929.1. NM_170733.3. [P23560-1 ]
    NP_733930.1. NM_170734.3. [P23560-3 ]
    NP_733931.1. NM_170735.5. [P23560-1 ]
    UniGenei Hs.502182.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1B8M X-ray 2.75 A 129-247 [» ]
    1BND X-ray 2.30 A 129-247 [» ]
    ProteinModelPortali P23560.
    SMRi P23560. Positions 136-244.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107096. 8 interactions.
    DIPi DIP-5719N.
    IntActi P23560. 6 interactions.
    MINTi MINT-1508504.

    PTM databases

    PhosphoSitei P23560.

    Polymorphism databases

    DMDMi 114900.

    Proteomic databases

    PaxDbi P23560.
    PRIDEi P23560.

    Protocols and materials databases

    DNASUi 627.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000314915 ; ENSP00000320002 ; ENSG00000176697 . [P23560-2 ]
    ENST00000356660 ; ENSP00000349084 ; ENSG00000176697 . [P23560-1 ]
    ENST00000395978 ; ENSP00000379302 ; ENSG00000176697 . [P23560-1 ]
    ENST00000395980 ; ENSP00000379304 ; ENSG00000176697 . [P23560-1 ]
    ENST00000395981 ; ENSP00000379305 ; ENSG00000176697 . [P23560-1 ]
    ENST00000395983 ; ENSP00000379307 ; ENSG00000176697 . [P23560-1 ]
    ENST00000395986 ; ENSP00000379309 ; ENSG00000176697 . [P23560-3 ]
    ENST00000418212 ; ENSP00000400502 ; ENSG00000176697 . [P23560-1 ]
    ENST00000420794 ; ENSP00000389564 ; ENSG00000176697 . [P23560-1 ]
    ENST00000438929 ; ENSP00000414303 ; ENSG00000176697 . [P23560-4 ]
    ENST00000439476 ; ENSP00000389345 ; ENSG00000176697 . [P23560-1 ]
    ENST00000525528 ; ENSP00000437138 ; ENSG00000176697 . [P23560-1 ]
    ENST00000525950 ; ENSP00000432035 ; ENSG00000176697 . [P23560-1 ]
    ENST00000530861 ; ENSP00000435564 ; ENSG00000176697 . [P23560-1 ]
    ENST00000532997 ; ENSP00000435805 ; ENSG00000176697 . [P23560-1 ]
    ENST00000533131 ; ENSP00000432727 ; ENSG00000176697 . [P23560-1 ]
    ENST00000533246 ; ENSP00000432376 ; ENSG00000176697 . [P23560-1 ]
    GeneIDi 627.
    KEGGi hsa:627.
    UCSCi uc001mrt.3. human. [P23560-3 ]
    uc001mru.3. human. [P23560-1 ]
    uc001msa.3. human. [P23560-2 ]
    uc009yje.3. human. [P23560-4 ]
    uc009yjf.3. human. [P23560-5 ]

    Organism-specific databases

    CTDi 627.
    GeneCardsi GC11M027676.
    H-InvDB HIX0035926.
    HGNCi HGNC:1033. BDNF.
    HPAi CAB009564.
    HPA056104.
    MIMi 113505. gene.
    209880. phenotype.
    610269. phenotype.
    neXtProti NX_P23560.
    Orphaneti 661. Ondine syndrome.
    893. WAGR syndrome.
    PharmGKBi PA31891.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45248.
    HOVERGENi HBG006494.
    InParanoidi P23560.
    KOi K04355.
    OMAi RVGWRFI.
    OrthoDBi EOG7RBZ8Z.
    PhylomeDBi P23560.
    TreeFami TF106463.

    Enzyme and pathway databases

    SignaLinki P23560.

    Miscellaneous databases

    EvolutionaryTracei P23560.
    GeneWikii Brain-derived_neurotrophic_factor.
    GenomeRNAii 627.
    NextBioi 2530.
    PMAP-CutDB Q6YNR3.
    PROi P23560.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P23560.
    Bgeei P23560.
    CleanExi HS_BDNF.
    Genevestigatori P23560.

    Family and domain databases

    Gene3Di 2.10.90.10. 1 hit.
    InterProi IPR020430. Brain-der_neurotrophic_factor.
    IPR029034. Cystine-knot_cytokine.
    IPR020408. Nerve_growth_factor-like.
    IPR002072. Nerve_growth_factor-rel.
    IPR019846. Nerve_growth_factor_CS.
    [Graphical view ]
    PANTHERi PTHR11589. PTHR11589. 1 hit.
    Pfami PF00243. NGF. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001789. NGF. 1 hit.
    PRINTSi PR01912. BDNFACTOR.
    PR00268. NGF.
    ProDomi PD002052. Nerve_growth_factor-rel. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    SMARTi SM00140. NGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57501. SSF57501. 1 hit.
    PROSITEi PS00248. NGF_1. 1 hit.
    PS50270. NGF_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of a human gene that is a member of the nerve growth factor family."
      Jones K.R., Reichardt L.F.
      Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1).
    2. "Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations."
      Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D.
      Genomics 10:558-568(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    3. "Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene."
      Shintani A., Ono Y., Kaisho Y., Igarashi K.
      Biochem. Biophys. Res. Commun. 182:325-332(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Human brain derived neurotrophic factor (BDNF) genes, splicing patterns, and assessments of associations with substance abuse and Parkinson's Disease."
      Liu Q.-R., Walther D., Drgon T., Polesskaya O., Lesnick T.G., Strain K.J., de Andrade M., Bower J.H., Maraganore D.M., Uhl G.R.
      Am. J. Med. Genet. B Neuropsychiatr. Genet. 134:93-103(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING.
    5. "Dissecting the human BDNF locus: bidirectional transcription, complex splicing, and multiple promoters."
      Pruunsild P., Kazantseva A., Aid T., Palm K., Timmusk T.
      Genomics 90:397-406(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.
      Tissue: Brain.
    6. "A cDNA clone of human brain-derived neurotrophic factor (HUMBDNFD)."
      Cheng Y., Gu J.
      Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    7. Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    8. Perez-Pinera P., Gonzalez-Martinez T., Garcia-Suarez O., Perez-Perez M., Esteban I., Monjil D., Vega J.A.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-66.
    9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    13. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    14. "Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary."
      Hallboeoek F., Ibanez C.F., Persson H.
      Neuron 6:845-858(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 185-227.
      Tissue: Leukocyte.
    15. "Purification and identification of brain-derived neurotrophic factor from human serum."
      Rosenfeld R.D., Zeni L., Haniu M., Talvenheimo J., Radka S.F., Bennett L., Miller J.A., Welcher A.A.
      Protein Expr. Purif. 6:465-471(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 129-144.
      Tissue: Serum.
    16. "Molecular phylogenetics and the origins of placental mammals."
      Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.-P., Ryder O.A., O'Brien S.J.
      Nature 409:614-618(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 12-197.
    17. "Biosynthesis and post-translational processing of the precursor to brain-derived neurotrophic factor."
      Mowla S.J., Farhadi H.F., Pareek S., Atwal J.K., Morris S.J., Seidah N.G., Murphy R.A.
      J. Biol. Chem. 276:12660-12666(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION, MUTAGENESIS OF ARG-54.
    18. Cited for: POLYMORPHISM, ASSOCIATION WITH BULIMIA NERVOSA.
    19. Cited for: INVOLVEMENT IN WAGRO SYNDROME.
    20. "Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer."
      Robinson R.C., Radziejewski C., Stuart D.I., Jones E.Y.
      Biochemistry 34:4139-4146(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS).
    21. Cited for: VARIANT MET-66.
    22. "Idiopathic congenital central hypoventilation syndrome: evaluation of brain-derived neurotrophic factor genomic DNA sequence variation."
      Weese-Mayer D.E., Bolk S., Silvestri J.M., Chakravarti A.
      Am. J. Med. Genet. 107:306-310(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CCHS ILE-2.
    23. "Sequence variants of the brain-derived neurotrophic factor (BDNF) gene are strongly associated with obsessive-compulsive disorder."
      Hall D., Dhilla A., Charalambous A., Gogos J.A., Karayiorgou M.
      Am. J. Hum. Genet. 73:370-376(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT MET-66, ROLE OF VARIANT MET-66 IN OBSESSIVE-COMPULSIVE DISORDER.
    24. "The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function."
      Egan M.F., Kojima M., Callicott J.H., Goldberg T.E., Kolachana B.S., Bertolino A., Zaitsev E., Gold B., Goldman D., Dean M., Lu B., Weinberger D.R.
      Cell 112:257-269(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT MET-66, CHARACTERIZATION OF VARIANT MET-66, ROLE IN EPISODIC MEMORY.
    25. Cited for: VARIANT MET-66.
    26. "Met66 in the brain-derived neurotrophic factor (BDNF) precursor is associated with anorexia nervosa restrictive type."
      Ribases M., Gratacos M., Armengol L., de Cid R., Badia A., Jimenez L., Solano R., Vallejo J., Fernandez F., Estivill X.
      Mol. Psychiatry 8:745-751(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT MET-66, ASSOCIATION OF VARIANT MET-66 WITH ANR.

    Entry informationi

    Entry nameiBDNF_HUMAN
    AccessioniPrimary (citable) accession number: P23560
    Secondary accession number(s): A7LA85
    , A7LA92, D3DQZ2, Q598Q1, Q6DN19, Q6YNR2, Q6YNR3, Q9BYY7, Q9UC24
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1991
    Last sequence update: November 1, 1991
    Last modified: October 1, 2014
    This is version 158 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3