Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P23510

- TNFL4_HUMAN

UniProt

P23510 - TNFL4_HUMAN

Protein

Tumor necrosis factor ligand superfamily member 4

Gene

TNFSF4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 1 (01 Nov 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

    GO - Molecular functioni

    1. receptor binding Source: ProtInc
    2. tumor necrosis factor receptor superfamily binding Source: BHF-UCL

    GO - Biological processi

    1. acute inflammatory response Source: BHF-UCL
    2. CD4-positive, alpha-beta T cell costimulation Source: Ensembl
    3. cellular response to lipopolysaccharide Source: BHF-UCL
    4. cellular response to nitrogen dioxide Source: Ensembl
    5. cellular response to prostaglandin E stimulus Source: BHF-UCL
    6. chemokine (C-C motif) ligand 11 production Source: BHF-UCL
    7. cholesterol metabolic process Source: Ensembl
    8. defense response to nematode Source: BHF-UCL
    9. immune response Source: InterPro
    10. memory T cell activation Source: BHF-UCL
    11. negative regulation of cytokine secretion Source: Ensembl
    12. negative regulation of interferon-gamma production Source: BHF-UCL
    13. negative regulation of interleukin-17 production Source: BHF-UCL
    14. negative regulation of regulatory T cell differentiation Source: BHF-UCL
    15. negative regulation of sequence-specific DNA binding transcription factor activity Source: BHF-UCL
    16. negative regulation of T-helper 1 cell differentiation Source: BHF-UCL
    17. negative regulation of transcription, DNA-templated Source: BHF-UCL
    18. positive regulation of activated T cell proliferation Source: Ensembl
    19. positive regulation of alpha-beta T cell proliferation Source: BHF-UCL
    20. positive regulation of B cell activation Source: BHF-UCL
    21. positive regulation of CD4-positive, alpha-beta T cell costimulation Source: BHF-UCL
    22. positive regulation of CD4-positive, alpha-beta T cell differentiation Source: BHF-UCL
    23. positive regulation of cell proliferation Source: ProtInc
    24. positive regulation of immunoglobulin mediated immune response Source: BHF-UCL
    25. positive regulation of immunoglobulin secretion Source: BHF-UCL
    26. positive regulation of inflammatory response Source: BHF-UCL
    27. positive regulation of interferon-gamma production Source: BHF-UCL
    28. positive regulation of interleukin-10 production Source: BHF-UCL
    29. positive regulation of interleukin-12 production Source: BHF-UCL
    30. positive regulation of interleukin-13 production Source: BHF-UCL
    31. positive regulation of interleukin-2 production Source: Ensembl
    32. positive regulation of interleukin-4-dependent isotype switching to IgE isotypes Source: BHF-UCL
    33. positive regulation of interleukin-4 production Source: BHF-UCL
    34. positive regulation of interleukin-6 production Source: BHF-UCL
    35. positive regulation of memory T cell activation Source: Ensembl
    36. positive regulation of memory T cell differentiation Source: BHF-UCL
    37. positive regulation of T cell cytokine production Source: BHF-UCL
    38. positive regulation of T-helper 2 cell activation Source: Ensembl
    39. positive regulation of T-helper 2 cell differentiation Source: BHF-UCL
    40. positive regulation of type 2 immune response Source: BHF-UCL
    41. regulation of adaptive immune response Source: BHF-UCL
    42. regulation of inflammatory response Source: BHF-UCL
    43. response to nitrogen dioxide Source: BHF-UCL
    44. response to virus Source: BHF-UCL
    45. signal transduction Source: ProtInc
    46. T cell proliferation Source: Ensembl
    47. T-helper 2 cell activation Source: BHF-UCL

    Keywords - Molecular functioni

    Cytokine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tumor necrosis factor ligand superfamily member 4
    Alternative name(s):
    Glycoprotein Gp34
    OX40 ligand
    Short name:
    OX40L
    TAX transcriptionally-activated glycoprotein 1
    CD_antigen: CD252
    Gene namesi
    Name:TNFSF4
    Synonyms:TXGP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:11934. TNFSF4.

    Subcellular locationi

    GO - Cellular componenti

    1. cell surface Source: BHF-UCL
    2. extracellular space Source: BHF-UCL
    3. integral component of plasma membrane Source: BHF-UCL

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Systemic lupus erythematosus (SLE) [MIM:152700]: A chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow.1 Publication
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry. The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T-cell-APC interaction and the functional consequences of T-cell activation, thereby destabilizing peripheral tolerance.

    Keywords - Diseasei

    Systemic lupus erythematosus

    Organism-specific databases

    MIMi152700. phenotype.
    Orphaneti2073. Narcolepsy-cataplexy.
    536. Systemic lupus erythematosus.
    PharmGKBiPA36625.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 183183Tumor necrosis factor ligand superfamily member 4PRO_0000185493Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi90 – 901N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi97 ↔ 1811 Publication
    Glycosylationi114 – 1141N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi152 – 1521N-linked (GlcNAc...)1 Publication
    Glycosylationi157 – 1571N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP23510.
    PRIDEiP23510.

    PTM databases

    PhosphoSiteiP23510.

    Expressioni

    Inductioni

    By HTLV-1 transactivator p40-Tax.

    Gene expression databases

    ArrayExpressiP23510.
    BgeeiP23510.
    CleanExiHS_TNFSF4.
    GenevestigatoriP23510.

    Organism-specific databases

    HPAiHPA059579.

    Interactioni

    Subunit structurei

    Homotrimer.1 Publication

    Protein-protein interaction databases

    DIPiDIP-3023N.
    STRINGi9606.ENSP00000281834.

    Structurei

    Secondary structure

    1
    183
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi61 – 7010
    Turni71 – 733
    Beta strandi74 – 785
    Beta strandi92 – 943
    Beta strandi99 – 12022
    Beta strandi126 – 14318
    Beta strandi148 – 1558
    Beta strandi165 – 17410

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2HEVX-ray2.41F51-183[»]
    ProteinModelPortaliP23510.
    SMRiP23510. Positions 58-183.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP23510.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2323CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini51 – 183133ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei24 – 5027Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the tumor necrosis factor family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG47572.
    HOGENOMiHOG000076309.
    HOVERGENiHBG056457.
    InParanoidiP23510.
    KOiK05469.
    OMAiMEGVQPL.
    PhylomeDBiP23510.
    TreeFamiTF336384.

    Family and domain databases

    InterProiIPR021184. TNF_CS.
    IPR006052. TNF_dom.
    IPR008983. Tumour_necrosis_fac-like_dom.
    [Graphical view]
    PfamiPF00229. TNF. 1 hit.
    [Graphical view]
    SMARTiSM00207. TNF. 1 hit.
    [Graphical view]
    SUPFAMiSSF49842. SSF49842. 1 hit.
    PROSITEiPS00251. TNF_1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P23510-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MERVQPLEEN VGNAARPRFE RNKLLLVASV IQGLGLLLCF TYICLHFSAL    50
    QVSHRYPRIQ SIKVQFTEYK KEKGFILTSQ KEDEIMKVQN NSVIINCDGF 100
    YLISLKGYFS QEVNISLHYQ KDEEPLFQLK KVRSVNSLMV ASLTYKDKVY 150
    LNVTTDNTSL DDFHVNGGEL ILIHQNPGEF CVL 183
    Length:183
    Mass (Da):21,050
    Last modified:November 1, 1991 - v1
    Checksum:i0D5604AD29D529CF
    GO
    Isoform 2 (identifier: P23510-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQ → M

    Show »
    Length:133
    Mass (Da):15,427
    Checksum:i27AF148E6E528C8F
    GO

    Sequence cautioni

    The sequence CAA18438.2 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MERVQ…FSALQ → M in isoform 2. 2 PublicationsVSP_056288Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90224 mRNA. Translation: BAA14259.1.
    X79929 mRNA. Translation: CAA56284.1.
    AK297932 mRNA. Translation: BAG60249.1.
    AL022310 Genomic DNA. Translation: CAA18438.2. Sequence problems.
    AL022310 Genomic DNA. Translation: CAI20416.1.
    CH471067 Genomic DNA. Translation: EAW90938.1.
    BC041663 mRNA. Translation: AAH41663.1.
    AB042988 Genomic DNA. Translation: BAB18304.1.
    CCDSiCCDS1306.1.
    PIRiA39680.
    RefSeqiNP_003317.1. NM_003326.3.
    XP_005245532.1. XM_005245475.2.
    UniGeneiHs.181097.

    Genome annotation databases

    EnsembliENST00000281834; ENSP00000281834; ENSG00000117586.
    ENST00000367718; ENSP00000356691; ENSG00000117586.
    GeneIDi7292.
    KEGGihsa:7292.
    UCSCiuc001giw.3. human.

    Polymorphism databases

    DMDMi121540.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90224 mRNA. Translation: BAA14259.1 .
    X79929 mRNA. Translation: CAA56284.1 .
    AK297932 mRNA. Translation: BAG60249.1 .
    AL022310 Genomic DNA. Translation: CAA18438.2 . Sequence problems.
    AL022310 Genomic DNA. Translation: CAI20416.1 .
    CH471067 Genomic DNA. Translation: EAW90938.1 .
    BC041663 mRNA. Translation: AAH41663.1 .
    AB042988 Genomic DNA. Translation: BAB18304.1 .
    CCDSi CCDS1306.1.
    PIRi A39680.
    RefSeqi NP_003317.1. NM_003326.3.
    XP_005245532.1. XM_005245475.2.
    UniGenei Hs.181097.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2HEV X-ray 2.41 F 51-183 [» ]
    ProteinModelPortali P23510.
    SMRi P23510. Positions 58-183.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-3023N.
    STRINGi 9606.ENSP00000281834.

    PTM databases

    PhosphoSitei P23510.

    Polymorphism databases

    DMDMi 121540.

    Proteomic databases

    PaxDbi P23510.
    PRIDEi P23510.

    Protocols and materials databases

    DNASUi 7292.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000281834 ; ENSP00000281834 ; ENSG00000117586 .
    ENST00000367718 ; ENSP00000356691 ; ENSG00000117586 .
    GeneIDi 7292.
    KEGGi hsa:7292.
    UCSCi uc001giw.3. human.

    Organism-specific databases

    CTDi 7292.
    GeneCardsi GC01M173152.
    HGNCi HGNC:11934. TNFSF4.
    HPAi HPA059579.
    MIMi 152700. phenotype.
    603594. gene.
    neXtProti NX_P23510.
    Orphaneti 2073. Narcolepsy-cataplexy.
    536. Systemic lupus erythematosus.
    PharmGKBi PA36625.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47572.
    HOGENOMi HOG000076309.
    HOVERGENi HBG056457.
    InParanoidi P23510.
    KOi K05469.
    OMAi MEGVQPL.
    PhylomeDBi P23510.
    TreeFami TF336384.

    Miscellaneous databases

    ChiTaRSi TNFSF4. human.
    EvolutionaryTracei P23510.
    GenomeRNAii 7292.
    NextBioi 28511.
    PROi P23510.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P23510.
    Bgeei P23510.
    CleanExi HS_TNFSF4.
    Genevestigatori P23510.

    Family and domain databases

    InterProi IPR021184. TNF_CS.
    IPR006052. TNF_dom.
    IPR008983. Tumour_necrosis_fac-like_dom.
    [Graphical view ]
    Pfami PF00229. TNF. 1 hit.
    [Graphical view ]
    SMARTi SM00207. TNF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49842. SSF49842. 1 hit.
    PROSITEi PS00251. TNF_1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of a novel glycoprotein, gp34, that is specifically induced by the human T-cell leukemia virus type I transactivator p40tax."
      Miura S., Ohtani K., Numata N., Niki M., Ohbo K., Ina Y., Gojobori T., Tanaka Y., Tozawa H., Nakamura M., Sugamura K.
      Mol. Cell. Biol. 11:1313-1325(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Identification of a human OX-40 ligand, a costimulator of CD4+ T cells with homology to tumor necrosis factor."
      Godfrey W.R., Fagnoni F.F., Harara M.A., Buck D., Engleman E.G.
      J. Exp. Med. 180:757-762(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    7. "New variations in human OX40 ligand (CD134L) gene."
      Hikami K., Tsuchiya N., Tokunaga K.
      Genes Immun. 1:521-522(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-67.
    8. "Molecular characterization of murine and human OX40/OX40 ligand systems: identification of a human OX40 ligand as the HTLV-1-regulated protein gp34."
      Baum P.R., Gayle R.B. III, Ramsdell F., Srinivasan S., Sorensen R.A., Watson M.L., Seldin M.F., Baker E., Sutherland G.R., Clifford K.N., Alderson M.R., Goodwin R.G., Fanslow W.C.
      EMBO J. 13:3992-4001(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    9. "Polymorphism at the TNF superfamily gene TNFSF4 confers susceptibility to systemic lupus erythematosus."
      Cunninghame Graham D.S., Graham R.R., Manku H., Wong A.K., Whittaker J.C., Gaffney P.M., Moser K.L., Rioux J.D., Altshuler D., Behrens T.W., Vyse T.J.
      Nat. Genet. 40:83-89(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO SLE.
    10. "The crystal structure of the costimulatory OX40-OX40L complex."
      Compaan D.M., Hymowitz S.G.
      Structure 14:1321-1330(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.41 ANGSTROMS) OF 48-183 IN COMPLEX WITH TNFRSF4, SUBUNIT, DISULFIDE BOND, GLYCOSYLATION AT ASN-152.

    Entry informationi

    Entry nameiTNFL4_HUMAN
    AccessioniPrimary (citable) accession number: P23510
    Secondary accession number(s): Q5JZA5, Q8IV74, Q9HCN9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1991
    Last sequence update: November 1, 1991
    Last modified: October 1, 2014
    This is version 125 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3