Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Splicing factor, proline- and glutamine-rich

Gene

SFPQ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA- and RNA binding protein, involved in several nuclear processes. Essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as a heteromer with NONO. Binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. Involved in regulation of signal-induced alternative splicing. During splicing of PTPRC/CD45, a phosphorylated form is sequestered by THRAP3 from the pre-mRNA in resting T-cells; T-cell activation and subsequent reduced phosphorylation is proposed to lead to release from THRAP3 allowing binding to pre-mRNA splicing regulatotry elements which represses exon inclusion. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. May be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. SFPQ may be involved in homologous DNA pairing; in vitro, promotes the invasion of ssDNA between a duplex DNA and produces a D-loop formation. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1; in vitro, stimulates dissociation of TOP1 from DNA after cleavage and enhances its jumping between separate DNA helices. The SFPQ-NONO heteromer may be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends; in vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. SFPQ is involved in transcriptional regulation. Transcriptional repression is mediated by an interaction of SFPQ with SIN3A and subsequent recruitment of histone deacetylases (HDACs). The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. SFPQ isoform Long binds to the DNA binding domains (DBD) of nuclear hormone receptors, like RXRA and probably THRA, and acts as transcriptional corepressor in absence of hormone ligands. Binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex through histone deacetylation.10 Publications

GO - Molecular functioni

GO - Biological processi

  • alternative mRNA splicing, via spliceosome Source: BHF-UCL
  • double-strand break repair via homologous recombination Source: MGI
  • histone H3 deacetylation Source: UniProtKB
  • mRNA processing Source: ProtInc
  • negative regulation of circadian rhythm Source: UniProtKB
  • negative regulation of transcription, DNA-templated Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: ParkinsonsUK-UCL
  • positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway Source: ParkinsonsUK-UCL
  • positive regulation of sister chromatid cohesion Source: Ensembl
  • regulation of circadian rhythm Source: UniProtKB
  • rhythmic process Source: UniProtKB-KW
  • RNA splicing Source: ProtInc
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Biological rhythms, DNA damage, DNA recombination, DNA repair, mRNA processing, mRNA splicing, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-8849468. PTK6 Regulates Proteins Involved in RNA Processing.
SIGNORiP23246.

Names & Taxonomyi

Protein namesi
Recommended name:
Splicing factor, proline- and glutamine-rich
Alternative name(s):
100 kDa DNA-pairing protein
Short name:
hPOMp100
DNA-binding p52/p100 complex, 100 kDa subunit
Polypyrimidine tract-binding protein-associated-splicing factor
Short name:
PSF
Short name:
PTB-associated-splicing factor
Gene namesi
Name:SFPQ
Synonyms:PSF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:10774. SFPQ.

Subcellular locationi

GO - Cellular componenti

  • chromatin Source: ParkinsonsUK-UCL
  • cytoplasm Source: UniProtKB-SubCell
  • extracellular matrix Source: BHF-UCL
  • nuclear matrix Source: BHF-UCL
  • nucleoplasm Source: BHF-UCL
  • nucleus Source: ParkinsonsUK-UCL
  • paraspeckles Source: BHF-UCL
  • RNA polymerase II transcription factor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving SFPQ may be a cause of papillary renal cell carcinoma (PRCC). Translocation t(X;1)(p11.2;p34) with TFE3.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi687 – 6871T → A: Abolishes phosphorylation by GSK3B. Impairs interaction with THRAP3. 1 Publication
Mutagenesisi687 – 6871T → D: No effect on interaction with THRAP3 (phosphomimetic). 1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei662 – 6632Breakpoint for translocation to form SFPQ-TFE3

Organism-specific databases

MalaCardsiSFPQ.
Orphaneti319308. Translocation renal cell carcinoma.
PharmGKBiPA35690.

Polymorphism and mutation databases

BioMutaiSFPQ.
DMDMi1709851.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 707707Splicing factor, proline- and glutamine-richPRO_0000081909Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei8 – 81Phosphoserine; by MKNK21 Publication
Modified residuei33 – 331PhosphoserineCombined sources
Modified residuei208 – 2081N6-acetyllysineBy similarity
Modified residuei273 – 2731PhosphoserineCombined sources
Modified residuei283 – 2831Phosphoserine; by MKNK2Combined sources1 Publication
Modified residuei293 – 2931Phosphotyrosine; by ALK1 Publication
Modified residuei314 – 3141N6,N6-dimethyllysine1 Publication
Modified residuei319 – 3191N6-acetyllysineCombined sources
Modified residuei338 – 3381N6-acetyllysine; alternateCombined sources
Cross-linki338 – 338Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei368 – 3681PhosphothreonineCombined sources
Modified residuei374 – 3741PhosphoserineCombined sources
Modified residuei379 – 3791PhosphoserineCombined sources
Modified residuei421 – 4211N6-acetyllysineCombined sources
Modified residuei472 – 4721N6-acetyllysineCombined sources
Modified residuei496 – 4961PhosphoserineCombined sources
Modified residuei571 – 5711Dimethylated arginine1 Publication
Modified residuei626 – 6261PhosphoserineCombined sources
Modified residuei681 – 6811Omega-N-methylarginine1 Publication
Modified residuei687 – 6871PhosphothreonineCombined sources1 Publication
Modified residuei691 – 6911PhosphotyrosineCombined sources
Modified residuei693 – 6931Dimethylated arginine1 Publication

Post-translational modificationi

The N-terminus is blocked.
Phosphorylated on multiple serine and threonine residues during apoptosis. In vitro phosphorylated by PKC. Phosphorylation stimulates binding to DNA and D-loop formation, but inhibits binding to RNA. Phosphorylation of C-terminal tyrosines promotes its cytoplasmic localization, impaired its binding to polypyrimidine RNA and led to cell cycle arrest. In resting T-cells is phosphorylated at Thr-687 by GSK3B which is proposed to promote association with THRAP and to prevent binding to PTPRC/CD45 pre-mRNA; T-cell activation leads to reduced phosphorylation at Thr-687.6 Publications

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP23246.
MaxQBiP23246.
PaxDbiP23246.
PeptideAtlasiP23246.
PRIDEiP23246.

2D gel databases

SWISS-2DPAGEP23246.

PTM databases

iPTMnetiP23246.
PhosphoSiteiP23246.
SwissPalmiP23246.

Expressioni

Gene expression databases

BgeeiENSG00000116560.
CleanExiHS_SFPQ.
ExpressionAtlasiP23246. baseline and differential.
GenevisibleiP23246. HS.

Organism-specific databases

HPAiCAB009886.
HPA047513.
HPA054689.

Interactioni

Subunit structurei

Monomer and component of the SFPQ-NONO complex, which is probably a heterotetramer of two 52 kDa (NONO) and two 100 kDa (SFPQ) subunits. SFPQ is a component of spliceosome and U5.4/6 snRNP complexes. Interacts with SNRPA/U1A. Component of a snRNP-free complex with SNRPA/U1A. Part of complex consisting of SFPQ, NONO and MATR3. Interacts with polypyrimidine tract-binding protein 1/PTB. Part of a complex consisting of SFPQ, NONO and NR5A1. Interacts with RXRA, probably THRA, and SIN3A. Interacts with TOP1. Part of a complex consisting of SFPQ, NONO and TOP1. Interacts with SNRNP70 in apoptotic cells. Interacts with PSPC1. Interacts with RNF43. Interacts with PITX3 and NR4A2/NURR1. Interacts with PTK6. Interacts with THRAP3; the interaction is dependent on SFPQ phosphorylation at 'Thr-687' and inhibits binding of SFPQ to a ESS1 exonic splicing silencer element-containing RNA. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Interacts with PER1 and PER2.15 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
EBNA-LPQ8AZK72EBI-355453,EBI-1185167From a different organism.
HNF4AP412352EBI-355453,EBI-1049011
PTBP1P265992EBI-355453,EBI-350540
PTK6Q138825EBI-355453,EBI-1383632
RxraP287003EBI-355463,EBI-346715From a different organism.
SIN3AQ96ST32EBI-355453,EBI-347218
SNRPAP090124EBI-355453,EBI-607085
THRAP046252EBI-355463,EBI-286261From a different organism.
THRAP3Q9Y2W16EBI-355453,EBI-352039

GO - Molecular functioni

  • histone deacetylase binding Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi112319. 194 interactions.
IntActiP23246. 60 interactions.
MINTiMINT-1141893.
STRINGi9606.ENSP00000349748.

Structurei

Secondary structure

1
707
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi277 – 2837Combined sources
Helixi295 – 2973Combined sources
Beta strandi298 – 3036Combined sources
Helixi310 – 3167Combined sources
Helixi317 – 3204Combined sources
Beta strandi326 – 3294Combined sources
Turni330 – 3334Combined sources
Beta strandi334 – 3385Combined sources
Helixi342 – 35211Combined sources
Beta strandi356 – 3616Combined sources
Beta strandi363 – 3664Combined sources
Beta strandi370 – 3778Combined sources
Helixi384 – 3918Combined sources
Helixi392 – 3943Combined sources
Beta strandi397 – 4048Combined sources
Beta strandi406 – 4083Combined sources
Beta strandi410 – 42011Combined sources
Helixi421 – 43313Combined sources
Beta strandi439 – 4413Combined sources
Beta strandi446 – 4494Combined sources
Beta strandi454 – 4574Combined sources
Helixi461 – 4644Combined sources
Helixi468 – 4736Combined sources
Beta strandi478 – 4803Combined sources
Helixi486 – 52641Combined sources
Helixi555 – 58834Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4WIIX-ray2.05A/B276-535[»]
4WIJX-ray3.49A/B276-598[»]
4WIKX-ray3.00A/B369-598[»]
ProteinModelPortaliP23246.
SMRiP23246. Positions 292-592.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati9 – 1131
Repeati19 – 2132
Repeati25 – 2733
Domaini297 – 36973RRM 1PROSITE-ProRule annotationAdd
BLAST
Domaini371 – 45282RRM 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni9 – 27193 X 3 AA repeats of R-G-GAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi10 – 266257Gln/Glu/Pro-richAdd
BLAST
Compositional biasi10 – 156Poly-Gly
Compositional biasi20 – 278Poly-Gly
Compositional biasi56 – 6510Poly-Pro
Compositional biasi67 – 715Poly-Gln
Compositional biasi95 – 984Poly-Gln
Compositional biasi99 – 1035Poly-Pro
Compositional biasi184 – 1885Poly-Pro
Compositional biasi571 – 5744Poly-Arg
Compositional biasi613 – 6164Poly-Gly
Compositional biasi635 – 6417Poly-Gly

Sequence similaritiesi

Contains 2 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0115. Eukaryota.
ENOG410XQA0. LUCA.
GeneTreeiENSGT00390000005004.
HOGENOMiHOG000231095.
HOVERGENiHBG009801.
InParanoidiP23246.
KOiK13219.
OMAiGRQHHAP.
OrthoDBiEOG091G09T7.
PhylomeDBiP23246.
TreeFamiTF315795.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR012975. NOPS.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF08075. NOPS. 1 hit.
PF00076. RRM_1. 2 hits.
[Graphical view]
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform Long (identifier: P23246-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRDRFRSRG GGGGGFHRRG GGGGRGGLHD FRSPPPGMGL NQNRGPMGPG
60 70 80 90 100
PGQSGPKPPI PPPPPHQQQQ QPPPQQPPPQ QPPPHQPPPH PQPHQQQQPP
110 120 130 140 150
PPPQDSSKPV VAQGPGPAPG VGSAPPASSS APPATPPTSG APPGSGPGPT
160 170 180 190 200
PTPPPAVTSA PPGAPPPTPP SSGVPTTPPQ AGGPPPPPAA VPGPGPGPKQ
210 220 230 240 250
GPGPGGPKGG KMPGGPKPGG GPGLSTPGGH PKPPHRGGGE PRGGRQHHPP
260 270 280 290 300
YHQQHHQGPP PGGPGGRSEE KISDSEGFKA NLSLLRRPGE KTYTQRCRLF
310 320 330 340 350
VGNLPADITE DEFKRLFAKY GEPGEVFINK GKGFGFIKLE SRALAEIAKA
360 370 380 390 400
ELDDTPMRGR QLRVRFATHA AALSVRNLSP YVSNELLEEA FSQFGPIERA
410 420 430 440 450
VVIVDDRGRS TGKGIVEFAS KPAARKAFER CSEGVFLLTT TPRPVIVEPL
460 470 480 490 500
EQLDDEDGLP EKLAQKNPMY QKERETPPRF AQHGTFEYEY SQRWKSLDEM
510 520 530 540 550
EKQQREQVEK NMKDAKDKLE SEMEDAYHEH QANLLRQDLM RRQEELRRME
560 570 580 590 600
ELHNQEMQKR KEMQLRQEEE RRRREEEMMI RQREMEEQMR RQREESYSRM
610 620 630 640 650
GYMDPRERDM RMGGGGAMNM GDPYGSGGQK FPPLGGGGGI GYEANPGVPP
660 670 680 690 700
ATMSGSMMGS DMRTERFGQG GAGPVGGQGP RGMGPGTPAG YGRGREEYEG

PNKKPRF
Length:707
Mass (Da):76,149
Last modified:October 1, 1996 - v2
Checksum:i6D8D5EA95E235847
GO
Isoform Short (identifier: P23246-2) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     663-707: RTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF → VRMIDVG

Show »
Length:669
Mass (Da):72,263
Checksum:i46BAE5D117400578
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti243 – 2431G → R AA sequence (PubMed:8439294).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei663 – 70745RTERF…KKPRF → VRMIDVG in isoform Short. CuratedVSP_005855Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X70944 mRNA. Translation: CAA50283.1.
AL590434 Genomic DNA. Translation: CAI12467.1.
CH471059 Genomic DNA. Translation: EAX07426.1.
X16850 mRNA. Translation: CAA34747.1.
CCDSiCCDS388.1. [P23246-1]
PIRiA46302.
S29770.
RefSeqiNP_005057.1. NM_005066.2. [P23246-1]
XP_005271169.1. XM_005271112.4. [P23246-1]
XP_005271170.1. XM_005271113.4. [P23246-1]
XP_005271172.1. XM_005271115.4. [P23246-2]
UniGeneiHs.355934.
Hs.611911.

Genome annotation databases

EnsembliENST00000357214; ENSP00000349748; ENSG00000116560. [P23246-1]
GeneIDi6421.
KEGGihsa:6421.
UCSCiuc001bys.4. human. [P23246-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X70944 mRNA. Translation: CAA50283.1.
AL590434 Genomic DNA. Translation: CAI12467.1.
CH471059 Genomic DNA. Translation: EAX07426.1.
X16850 mRNA. Translation: CAA34747.1.
CCDSiCCDS388.1. [P23246-1]
PIRiA46302.
S29770.
RefSeqiNP_005057.1. NM_005066.2. [P23246-1]
XP_005271169.1. XM_005271112.4. [P23246-1]
XP_005271170.1. XM_005271113.4. [P23246-1]
XP_005271172.1. XM_005271115.4. [P23246-2]
UniGeneiHs.355934.
Hs.611911.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4WIIX-ray2.05A/B276-535[»]
4WIJX-ray3.49A/B276-598[»]
4WIKX-ray3.00A/B369-598[»]
ProteinModelPortaliP23246.
SMRiP23246. Positions 292-592.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112319. 194 interactions.
IntActiP23246. 60 interactions.
MINTiMINT-1141893.
STRINGi9606.ENSP00000349748.

PTM databases

iPTMnetiP23246.
PhosphoSiteiP23246.
SwissPalmiP23246.

Polymorphism and mutation databases

BioMutaiSFPQ.
DMDMi1709851.

2D gel databases

SWISS-2DPAGEP23246.

Proteomic databases

EPDiP23246.
MaxQBiP23246.
PaxDbiP23246.
PeptideAtlasiP23246.
PRIDEiP23246.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357214; ENSP00000349748; ENSG00000116560. [P23246-1]
GeneIDi6421.
KEGGihsa:6421.
UCSCiuc001bys.4. human. [P23246-1]

Organism-specific databases

CTDi6421.
GeneCardsiSFPQ.
HGNCiHGNC:10774. SFPQ.
HPAiCAB009886.
HPA047513.
HPA054689.
MalaCardsiSFPQ.
MIMi605199. gene.
neXtProtiNX_P23246.
Orphaneti319308. Translocation renal cell carcinoma.
PharmGKBiPA35690.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0115. Eukaryota.
ENOG410XQA0. LUCA.
GeneTreeiENSGT00390000005004.
HOGENOMiHOG000231095.
HOVERGENiHBG009801.
InParanoidiP23246.
KOiK13219.
OMAiGRQHHAP.
OrthoDBiEOG091G09T7.
PhylomeDBiP23246.
TreeFamiTF315795.

Enzyme and pathway databases

ReactomeiR-HSA-8849468. PTK6 Regulates Proteins Involved in RNA Processing.
SIGNORiP23246.

Miscellaneous databases

ChiTaRSiSFPQ. human.
GeneWikiiSFPQ.
GenomeRNAii6421.
PROiP23246.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000116560.
CleanExiHS_SFPQ.
ExpressionAtlasiP23246. baseline and differential.
GenevisibleiP23246. HS.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR012975. NOPS.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF08075. NOPS. 1 hit.
PF00076. RRM_1. 2 hits.
[Graphical view]
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSFPQ_HUMAN
AccessioniPrimary (citable) accession number: P23246
Secondary accession number(s): P30808, Q5SZ71
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: October 1, 1996
Last modified: September 7, 2016
This is version 188 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was originally thought to be myoblast cell surface antigen 24.1D5 and a possible membrane-bound protein ectokinase.1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.