P23246 (SFPQ_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Splicing factor, proline- and glutamine-rich Alternative name(s): 100 kDa DNA-pairing protein Short name=hPOMp100 DNA-binding p52/p100 complex, 100 kDa subunit Polypyrimidine tract-binding protein-associated-splicing factor Short name=PSF Short name=PTB-associated-splicing factor | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 707 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA- and RNA binding protein, involved in several nuclear processes. Essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as a heteromer with NONO. Binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. Involved in regulation of signal-induced alternative splicing. During splicing of PTPRC/CD45, a phosphorylated form is sequestered by THRAP3 from the pre-mRNA in resting T-cells; T-cell activation and subsequent reduced phosphorylation is proposed to lead to release from THRAP3 allowing binding to pre-mRNA splicing regulatotry elements which represses exon inclusion. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. May be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. SFPQ may be involved in homologous DNA pairing; in vitro, promotes the invasion of ssDNA between a duplex DNA and produces a D-loop formation. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1; in vitro, stimulates dissociation of TOP1 from DNA after cleavage and enhances its jumping between separate DNA helices. The SFPQ-NONO heteromer may be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends; in vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. SFPQ is involved in transcriptional regulation. Transcriptional repression is probably mediated by an interaction of SFPQ with SIN3A and subsequent recruitment of histone deacetylases (HDACs). The SFPQ-NONO/SF-1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. SFPQ isoform Long binds to the DNA binding domains (DBD) of nuclear hormone receptors, like RXRA and probably THRA, and acts as transcriptional corepressor in absence of hormone ligands. Binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity. Ref.1 Ref.11 Ref.14 Ref.15 Ref.16 Ref.17 Ref.19 Ref.20 Ref.22 Ref.31 |
| Subunit structure | Monomer and component of the SFPQ-NONO complex, which is probably a heterotetramer of two 52 kDa (NONO) and two 100 kDa (SFPQ) subunits. SFPQ is a component of spliceosome and U5.4/6 snRNP complexes. Interacts with SNRPA/U1A. Component of a snRNP-free complex with SNRPA/U1A. Part of complex consisting of SFPQ, NONO and MATR3. Interacts with polypyrimidine tract-binding protein 1/PTB. Part of a complex consisting of SFPQ, NONO and NR5A1. Interacts with RXRA, probably THRA, and SIN3A. Interacts with TOP1. Part of a complex consisting of SFPQ, NONO and TOP1. Interacts with SNRNP70 in apoptotic cells. Interacts with PSPC1. Interacts with RNF43. Interacts with PITX3 and NR4A2/NURR1. Interacts with PTK6. Interacts with THRAP3; the interaction is dependent on SFPQ phosphorylation at 'Thr-687' and inhibits binding of SFPQ to a ESS1 exonic splicing silencer element-containing RNA. Ref.5 Ref.6 Ref.9 Ref.10 Ref.11 Ref.13 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 Ref.27 Ref.28 Ref.31 |
| Subcellular location | Nucleus matrix. Cytoplasm. Note: Predominantly in nuclear matrix. Ref.9 Ref.10 Ref.28 |
| Post-translational modification | The N-terminus is blocked. Phosphorylated on multiple serine and threonine residues during apoptosis. In vitro phosphorylated by PKC. Phosphorylation stimulates binding to DNA and D-loop formation, but inhibits binding to RNA. Phosphorylation of C-terminal tyrosines promotes its cytoplasmic localization, impaired its binding to polypyrimidine RNA and led to cell cycle arrest. In resting T-cells is phosphorylated at Thr-687 by GSK3B which is proposed to promote association with THRAP and to prevent binding to PTPRC/CD45 pre-mRNA; T-cell activation leads to reduced phosphorylation at Thr-687. Ref.16 Ref.18 Ref.23 Ref.24 Ref.28 Ref.31 Arg-7, Arg-9, Arg-19 and Arg-25 are dimethylated, probably to asymmetric dimethylarginine. Ref.4 |
| Involvement in disease | A chromosomal aberration involving SFPQ may be a cause of papillary renal cell carcinoma (PRCC). Translocation t(X;1)(p11.2;p34) with TFE3. |
| Sequence similarities | Contains 2 RRM (RNA recognition motif) domains. |
| Caution | Was originally (Ref.8) thought to be myoblast cell surface antigen 24.1D5 and a possible membrane-bound protein ectokinase. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PTBP1 | P26599 | 2 | EBI-355453,EBI-350540 | |
| Rxra | P28700 | 3 | EBI-355463,EBI-346715 | From a different organism. |
| SIN3A | Q96ST3 | 2 | EBI-355453,EBI-347218 | |
| SNRPA | P09012 | 4 | EBI-355453,EBI-607085 | |
| THRA | P04625 | 2 | EBI-355463,EBI-286261 | From a different organism. |
| THRAP3 | Q9Y2W1 | 6 | EBI-355453,EBI-352039 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform Long (identifier: P23246-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P23246-2) Also known as: F; The sequence of this isoform differs from the canonical sequence as follows: 663-707: RTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF → VRMIDVG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 707 | 707 | Splicing factor, proline- and glutamine-rich | PRO_0000081909 | |||||
Regions | |||||||||
| Repeat | 9 – 11 | 3 | 1 | ||||||
| Repeat | 19 – 21 | 3 | 2 | ||||||
| Repeat | 25 – 27 | 3 | 3 | ||||||
| Domain | 297 – 369 | 73 | RRM 1 | ||||||
| Domain | 371 – 452 | 82 | RRM 2 | ||||||
| Region | 9 – 27 | 19 | 3 X 3 AA repeats of R-G-G | ||||||
| Compositional bias | 10 – 266 | 257 | Gln/Glu/Pro-rich | ||||||
| Compositional bias | 10 – 15 | 6 | Poly-Gly | ||||||
| Compositional bias | 20 – 27 | 8 | Poly-Gly | ||||||
| Compositional bias | 56 – 65 | 10 | Poly-Pro | ||||||
| Compositional bias | 67 – 71 | 5 | Poly-Gln | ||||||
| Compositional bias | 95 – 98 | 4 | Poly-Gln | ||||||
| Compositional bias | 99 – 103 | 5 | Poly-Pro | ||||||
| Compositional bias | 184 – 188 | 5 | Poly-Pro | ||||||
| Compositional bias | 571 – 574 | 4 | Poly-Arg | ||||||
| Compositional bias | 613 – 616 | 4 | Poly-Gly | ||||||
| Compositional bias | 635 – 641 | 7 | Poly-Gly | ||||||
Sites | |||||||||
| Site | 662 – 663 | 2 | Breakpoint for translocation to form SFPQ-TFE3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 8 | 1 | Phosphoserine; by MKNK2 Ref.24 | ||||||
| Modified residue | 33 | 1 | Phosphoserine Ref.32 Ref.34 | ||||||
| Modified residue | 273 | 1 | Phosphoserine Ref.26 Ref.34 | ||||||
| Modified residue | 283 | 1 | Phosphoserine; by MKNK2 Ref.24 Ref.34 | ||||||
| Modified residue | 293 | 1 | Phosphotyrosine; by ALK Ref.23 | ||||||
| Modified residue | 314 | 1 | N6,N6-dimethyllysine Ref.4 | ||||||
| Modified residue | 319 | 1 | N6-acetyllysine Ref.30 | ||||||
| Modified residue | 338 | 1 | N6-acetyllysine Ref.30 | ||||||
| Modified residue | 379 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 421 | 1 | N6-acetyllysine Ref.30 | ||||||
| Modified residue | 472 | 1 | N6-acetyllysine Ref.30 | ||||||
| Modified residue | 571 | 1 | Dimethylated arginine Ref.4 | ||||||
| Modified residue | 626 | 1 | Phosphoserine Ref.32 | ||||||
| Modified residue | 681 | 1 | Omega-N-methylarginine Ref.4 | ||||||
| Modified residue | 687 | 1 | Phosphothreonine Ref.25 Ref.26 Ref.31 | ||||||
| Modified residue | 693 | 1 | Dimethylated arginine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 663 – 707 | 45 | RTERF…KKPRF → VRMIDVG in isoform Short. | VSP_005855 | |||||
Experimental info | |||||||||
| Mutagenesis | 687 | 1 | T → A: Abolishes phosphorylation by GSK3B. Impairs interaction with THRAP3. Ref.31 | ||||||
| Mutagenesis | 687 | 1 | T → D: No effect on interaction with THRAP3 (phosphomimetic). Ref.31 | ||||||
| Sequence conflict | 243 | 1 | G → R AA sequence Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of PSF, a novel pre-mRNA splicing factor." Patton J.G., Porro E.B., Galceran J., Tempst P., Nadal-Ginard B. Genes Dev. 7:393-406(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE, ALTERNATIVE SPLICING, FUNCTION. Tissue: Fetal brain. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 33-44; 218-236; 246-267; 272-286; 299-315; 320-330; 350-358; 364-407; 414-425; 431-462; 480-493; 517-536; 549-559; 567-572; 575-581; 600-606; 612-630 AND 667-695, METHYLATION AT LYS-314; ARG-571; ARG-681 AND ARG-693, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [5] | "Purification and characterization of a DNA-binding heterodimer of 52 and 100 kDa from HeLa cells." Zhang W.-W., Zhang L.-X., Busch R.K., Farres J., Busch H. Biochem. J. 290:267-272(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 48-68 AND 213-246, BLOCKAGE OF N-TERMINUS, DNA-BINDING, SUBUNIT. |
| [6] | "The human U5 snRNP-specific 100-kD protein is an RS domain-containing, putative RNA helicase with significant homology to the yeast splicing factor Prp28p." Teigelkamp S., Mundt C., Achsel T., Will C.L., Luehrmann R. RNA 3:1313-1326(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 292-311; 415-421 AND 503-510, IDENTIFICATION IN U5/4/6 SNRNP COMPLEXES. |
| [7] | Lubec G., Chen W.-Q., Sun Y. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 299-314 AND 480-493, MASS SPECTROMETRY. Tissue: Fetal brain cortex. |
| [8] | "Cloning and characterization of a myoblast cell surface antigen defined by 24.1D5 monoclonal antibody." Gower H.J., Moore S.E., Dickson G., Elsom V.L., Nayak R., Walsh F.S. Development 105:723-731(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 312-707. Tissue: Fetal skeletal muscle. |
| [9] | "The snRNP-free U1A (SF-A) complex(es): identification of the largest subunit as PSF, the polypyrimidine-tract binding protein-associated splicing factor." Lutz C.S., Cooke C., O'Connor J.P., Kobayashi R., Alwine J.C. RNA 4:1493-1499(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 414-421 AND 427-448, SUBCELLULAR LOCATION, INTERACTION WITH SNRPA, IDENTIFICATION IN A SNRNP-FREE COMPLEX WITH SNRPA. |
| [10] | "Differential nuclear localization and nuclear matrix association of the splicing factors PSF and PTB." Meissner M., Dechat T., Gerner C., Grimm R., Foisner R., Sauermann G. J. Cell. Biochem. 76:559-566(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 600-606 AND 667-677, INTERACTION WITH PTBP1, SUBCELLULAR LOCATION. |
| [11] | "A novel set of spliceosome-associated proteins and the essential splicing factor PSF bind stably to pre-mRNA prior to catalytic step II of the splicing reaction." Gozani O., Patton J.G., Reed R. EMBO J. 13:3356-3367(1994) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PRE-MRNA, IDENTIFICATION IN SPLICEOSOME COMPLEX. |
| [12] | "Fusion of splicing factor genes PSF and NonO (p54nrb) to the TFE3 gene in papillary renal cell carcinoma." Clark J., Lu Y.-J., Sidhar S.K., Parker C., Gill S., Smedley D., Hamoudi R., Linehan W.M., Shipley J., Cooper C.S. Oncogene 15:2233-2239(1997) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TFE3. |
| [13] | "The RNA-splicing factor PSF/p54 controls DNA-topoisomerase I activity by a direct interaction." Straub T., Grue P., Uhse A., Lisby M., Knudsen B.R., Tange T.O., Westergaard O., Boege F. J. Biol. Chem. 273:26261-26264(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TOP1, IDENTIFICATION IN A COMPLEX WITH NONO AND TOP1. |
| [14] | "PSF/p54(nrb) stimulates 'jumping' of DNA topoisomerase I between separate DNA helices." Straub T., Knudsen B.R., Boege F. Biochemistry 39:7552-7558(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DNA UNWINDING. |
| [15] | "Polypyrimidine tract-binding protein-associated splicing factor is a negative regulator of transcriptional activity of the porcine p450scc insulin-like growth factor response element." Urban R.J., Bodenburg Y., Kurosky A., Wood T.G., Gasic S. Mol. Endocrinol. 14:774-782(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRANSCRIPTION REGULATION, IDENTIFICATION BY MASS SPECTROMETRY. |
| [16] | "Human 100-kDa homologous DNA-pairing protein is the splicing factor PSF and promotes DNA strand invasion." Akhmedov A.T., Lopez B.S. Nucleic Acids Res. 28:3022-3030(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN HOMOLOGOUS DNA PAIRING, PHOSPHORYLATION. |
| [17] | "The fate of dsRNA in the nucleus: a p54(nrb)-containing complex mediates the nuclear retention of promiscuously A-to-I edited RNAs." Zhang Z., Carmichael G.G. Cell 106:465-475(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN NUCLEAR RETENTION OF A-TO-I EDITED RNAS, IDENTIFICATION IN A COMPLEX WITH NONO AND MATR3. |
| [18] | "Nuclear relocalization of the pre-mRNA splicing factor PSF during apoptosis involves hyperphosphorylation, masking of antigenic epitopes, and changes in protein interactions." Shav-Tal Y., Cohen M., Lapter S., Dye B., Patton J.G., Vandekerckhove J., Zipori D. Mol. Biol. Cell 12:2328-2340(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNRNP70, PHOSPHORYLATION. |
| [19] | "PSF is a novel corepressor that mediates its effect through Sin3A and the DNA binding domain of nuclear hormone receptors." Mathur M., Tucker P.W., Samuels H.H. Mol. Cell. Biol. 21:2298-2311(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRANSCRIPTION REGULATION, INTERACTION WITH RXRA; THRA AND SIN3A. |
| [20] | "Transcriptional activation of human CYP17 in H295R adrenocortical cells depends on complex formation among p54(nrb)/NonO, protein-associated splicing factor, and SF-1, a complex that also participates in repression of transcription." Sewer M.B., Nguyen V.Q., Huang C.J., Tucker P.W., Kagawa N., Waterman M.R. Endocrinology 143:1280-1290(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRANSCRIPTION REGULATION, INTERACTION WITH NR5A1 AND SIN3A, IDENTIFICATION IN A COMPLEX WITH NONO AND NR5A1. |
| [21] | "PSF and p54nrb bind a conserved stem in U5 snRNA." Peng R., Dye B.T., Perez I., Barnard D.C., Thompson A.B., Patton J.G. RNA 8:1334-1347(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NONO AND U5 SNRNA, IDENTIFICATION IN IN U5/4/6 SNRNP SND SPLICEOSOME COMPLEXES. |
| [22] | "Identification of the polypyrimidine tract binding protein-associated splicing factor.p54(nrb) complex as a candidate DNA double-strand break rejoining factor." Bladen C.L., Udayakumar D., Takeda Y., Dynan W.S. J. Biol. Chem. 280:5205-5210(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DNA REPAIR, IDENTIFICATION BY MASS SPECTROMETRY, DNA-BINDING, SUBUNIT. |
| [23] | "NPM/ALK binds and phosphorylates the RNA/DNA-binding protein PSF in anaplastic large-cell lymphoma." Galietta A., Gunby R.H., Redaelli S., Stano P., Carniti C., Bachi A., Tucker P.W., Tartari C.J., Huang C.J., Colombo E., Pulford K., Puttini M., Piazza R.G., Ruchatz H., Villa A., Donella-Deana A., Marin O., Perrotti D., Gambacorti-Passerini C. Blood 110:2600-2609(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-293. |
| [24] | "The PSF.p54nrb complex is a novel Mnk substrate that binds the mRNA for tumor necrosis factor alpha." Buxade M., Morrice N., Krebs D.L., Proud C.G. J. Biol. Chem. 283:57-65(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-8 AND SER-283 BY MKNK2. |
| [25] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-687, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [26] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-273 AND THR-687, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [27] | "Proteomic identification of a PSF/p54nrb heterodimer as RNF43 oncoprotein-interacting proteins." Miyamoto K., Sakurai H., Sugiura T. Proteomics 8:2907-2910(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RNF43. |
| [28] | "BRK phosphorylates PSF promoting its cytoplasmic localization and cell cycle arrest." Lukong K.E., Huot M.E., Richard S. Cell. Signal. 21:1415-1422(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, INTERACTION WITH PTK6, SUBCELLULAR LOCATION. |
| [29] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-379, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [30] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-319; LYS-338; LYS-421 AND LYS-472, MASS SPECTROMETRY. |
| [31] | "Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing." Heyd F., Lynch K.W. Mol. Cell 40:126-137(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT THR-687, INTERACTION WITH THRAP3, MUTAGENESIS OF THR-687. |
| [32] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-626, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [33] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [34] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33; SER-273 AND SER-283, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X70944 mRNA. Translation: CAA50283.1. AL590434 Genomic DNA. Translation: CAI12467.1. CH471059 Genomic DNA. Translation: EAX07426.1. X16850 mRNA. Translation: CAA34747.1. |
| IPI | IPI00010740. IPI00216613. |
| PIR | A46302. S29770. |
| RefSeq | NP_005057.1. NM_005066.2. |
| UniGene | Hs.355934. Hs.611911. |
3D structure databases | |
| ProteinModelPortal | P23246. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P23246. 41 interactions. |
| MINT | MINT-1141893. |
| STRING | 9606.ENSP00000349748. |
PTM databases | |
| PhosphoSite | P23246. |
Polymorphism databases | |
| DMDM | 1709851. |
2D gel databases | |
| SWISS-2DPAGE | P23246. |
Proteomic databases | |
| PaxDb | P23246. |
| PeptideAtlas | P23246. |
| PRIDE | P23246. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357214; ENSP00000349748; ENSG00000116560. |
| GeneID | 6421. |
| KEGG | hsa:6421. |
| UCSC | uc001bys.3. human. |
Organism-specific databases | |
| CTD | 6421. |
| GeneCards | GC01M035641. |
| HGNC | HGNC:10774. SFPQ. |
| HPA | CAB009886. |
| MIM | 605199. gene. |
| neXtProt | NX_P23246. |
| PharmGKB | PA35690. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG298586. |
| HOGENOM | HOG000231095. |
| HOVERGEN | HBG009801. |
| InParanoid | P23246. |
| KO | K13219. |
| OMA | APGGHPK. |
| OrthoDB | EOG4RNB8S. |
| PhylomeDB | P23246. |
Gene expression databases | |
| ArrayExpress | P23246. |
| Bgee | P23246. |
| CleanEx | HS_SFPQ. |
| Genevestigator | P23246. |
| GermOnline | ENSG00000116560. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.70.330. 2 hits. |
| InterPro | IPR012975. NOPS. IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] |
| Pfam | PF08075. NOPS. 1 hit. PF00076. RRM_1. 2 hits. [Graphical view] |
| SMART | SM00360. RRM. 2 hits. [Graphical view] |
| PROSITE | PS50102. RRM. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SFPQ. human. |
| GenomeRNAi | 6421. |
| NextBio | 24935. |
| SOURCE | Search... |
Entry information
| Entry name | SFPQ_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P23246 Secondary accession number(s): P30808, Q5SZ71 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
