SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P23142

- FBLN1_HUMAN

UniProt

P23142 - FBLN1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibulin-1

Gene
FBLN1, PP213
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.4 Publications

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. extracellular matrix structural constituent Source: ProtInc
  3. peptidase activator activity Source: Ensembl

GO - Biological processi

  1. embryo implantation Source: Ensembl
  2. extracellular matrix organization Source: Reactome
  3. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Host-virus interaction

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_150331. Molecules associated with elastic fibres.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibulin-1
Short name:
FIBL-1
Gene namesi
Name:FBLN1
ORF Names:PP213
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:3600. FBLN1.

Subcellular locationi

GO - Cellular componenti

  1. basement membrane Source: Ensembl
  2. extracellular region Source: UniProtKB
  3. extracellular space Source: BHF-UCL
  4. extracellular vesicular exosome Source: UniProt
  5. proteinaceous extracellular matrix Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving FBLN1 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with RASSF8. Fibroblasts derived from a patient with synpolydactyly displayed alterations in the level of isoform D splice variant incorporated into the ECM and secreted into the conditioned culture medium. By contrast, the expression of isoform C was not perturbed in the patients fibroblasts. Furthermore, no aberrant polypeptides were detected in extracts of cultured patients fibroblasts. The translocation t(12;22) may result in haploinsufficiency of the isoform D splice variant, which could lead to the observed limb malformation.
Elevated expression and altered processing of FBLN1 protein is associated with human breast cancer.

Organism-specific databases

MIMi608180. phenotype.
Orphaneti295197. Synpolydactyly type 2.
PharmGKBiPA28013.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 29291 PublicationAdd
BLAST
Chaini30 – 703674Fibulin-1PRO_0000007563Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi36 ↔ 61 By similarity
Disulfide bondi37 ↔ 68 By similarity
Disulfide bondi50 ↔ 69 By similarity
Disulfide bondi78 ↔ 109 By similarity
Disulfide bondi91 ↔ 110 By similarity
Glycosylationi98 – 981N-linked (GlcNAc...) (complex)1 Publication
Disulfide bondi112 ↔ 136 By similarity
Disulfide bondi113 ↔ 143 By similarity
Disulfide bondi126 ↔ 144 By similarity
Disulfide bondi180 ↔ 190 By similarity
Disulfide bondi186 ↔ 199 By similarity
Disulfide bondi201 ↔ 214 By similarity
Disulfide bondi220 ↔ 233 By similarity
Disulfide bondi227 ↔ 242 By similarity
Disulfide bondi248 ↔ 260 By similarity
Disulfide bondi266 ↔ 279 By similarity
Disulfide bondi273 ↔ 288 By similarity
Disulfide bondi294 ↔ 306 By similarity
Disulfide bondi312 ↔ 325 By similarity
Disulfide bondi319 ↔ 334 By similarity
Disulfide bondi341 ↔ 354 By similarity
Disulfide bondi360 ↔ 373 By similarity
Disulfide bondi367 ↔ 382 By similarity
Disulfide bondi384 ↔ 397 By similarity
Disulfide bondi403 ↔ 415 By similarity
Disulfide bondi411 ↔ 424 By similarity
Disulfide bondi426 ↔ 439 By similarity
Disulfide bondi445 ↔ 454 By similarity
Disulfide bondi450 ↔ 463 By similarity
Disulfide bondi465 ↔ 479 By similarity
Disulfide bondi485 ↔ 498 By similarity
Disulfide bondi494 ↔ 507 By similarity
Disulfide bondi509 ↔ 523 By similarity
Disulfide bondi529 ↔ 542 By similarity
Glycosylationi535 – 5351N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi536 ↔ 551 By similarity
Glycosylationi539 – 5391N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi556 ↔ 577 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP23142.
PaxDbiP23142.
PRIDEiP23142.

PTM databases

PhosphoSiteiP23142.

Expressioni

Tissue specificityi

Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells.1 Publication

Developmental stagei

Widely expressed during embryonic development. Prominent in the matrix of the leptomeningeal anlage, in basement membranes of the neuroepithelium and the perineurium of peripheral nerves. In embryos of gestational week (gw) 4, staining was observed in the early mesenchymal bone anlagen. In gw 6.5 and 8, all perichondrial structures showed expression but the chondrocytes themselves showed no staining. In gw 10, expression is prominent in the interterritorial matrix surrounding the hypertrophic chondrocytes.1 Publication

Inductioni

Expression increased by estrogen in ovarian cancer cells.3 Publications

Gene expression databases

ArrayExpressiP23142.
BgeeiP23142.
GenevestigatoriP23142.

Organism-specific databases

HPAiCAB004393.
HPA001612.
HPA001613.

Interactioni

Subunit structurei

Homomultimerizes and interacts with various extracellular matrix components such as FN1, LAMA1, LAMA2, NID, ACAN, CSPG2 and type IV collagen. Interacts also with APP, NOV, FGB and HPV type 16, HPV type 18, HPV type 31 and BPV type 1 E6 proteins. Interacts with FBLN7 By similarity.6 Publications

Protein-protein interaction databases

BioGridi108486. 30 interactions.
IntActiP23142. 26 interactions.
MINTiMINT-5005948.

Structurei

3D structure databases

ProteinModelPortaliP23142.
SMRiP23142. Positions 184-591.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 7641Anaphylatoxin-like 1Add
BLAST
Domaini77 – 11135Anaphylatoxin-like 2Add
BLAST
Domaini112 – 14433Anaphylatoxin-like 3Add
BLAST
Domaini176 – 21540EGF-like 1Add
BLAST
Domaini216 – 26146EGF-like 2; calcium-binding Reviewed predictionAdd
BLAST
Domaini262 – 30746EGF-like 3; calcium-binding Reviewed predictionAdd
BLAST
Domaini308 – 35548EGF-like 4; calcium-binding Reviewed predictionAdd
BLAST
Domaini356 – 39843EGF-like 5; calcium-bindingAdd
BLAST
Domaini399 – 44042EGF-like 6; calcium-bindingAdd
BLAST
Domaini441 – 48040EGF-like 7; calcium-bindingAdd
BLAST
Domaini481 – 52444EGF-like 8; calcium-bindingAdd
BLAST
Domaini525 – 57854EGF-like 9; calcium-bindingAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni356 – 44085Self-association and FN1-binding; calcium is necessary for homotypic binding, but not for heterotypic bindingAdd
BLAST

Sequence similaritiesi

Belongs to the fibulin family.
Contains 9 EGF-like domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG12793.
HOGENOMiHOG000007079.
HOVERGENiHBG051559.
KOiK17307.
PhylomeDBiP23142.
TreeFamiTF317514.

Family and domain databases

InterProiIPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR017048. Fibulin-1.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF01821. ANATO. 2 hits.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view]
PIRSFiPIRSF036313. Fibulin-1. 1 hit.
SMARTiSM00104. ANATO. 3 hits.
SM00181. EGF. 2 hits.
SM00179. EGF_CA. 7 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 2 hits.
PROSITEiPS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 4 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 5 hits.
PS01187. EGF_CA. 8 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform D (identifier: P23142-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MERAAPSRRV PLPLLLLGGL ALLAAGVDAD VLLEACCADG HRMATHQKDC    50
SLPYATESKE CRMVQEQCCH SQLEELHCAT GISLANEQDR CATPHGDNAS 100
LEATFVKRCC HCCLLGRAAQ AQGQSCEYSL MVGYQCGQVF QACCVKSQET 150
GDLDVGGLQE TDKIIEVEEE QEDPYLNDRC RGGGPCKQQC RDTGDEVVCS 200
CFVGYQLLSD GVSCEDVNEC ITGSHSCRLG ESCINTVGSF RCQRDSSCGT 250
GYELTEDNSC KDIDECESGI HNCLPDFICQ NTLGSFRCRP KLQCKSGFIQ 300
DALGNCIDIN ECLSISAPCP IGHTCINTEG SYTCQKNVPN CGRGYHLNEE 350
GTRCVDVDEC APPAEPCGKG HRCVNSPGSF RCECKTGYYF DGISRMCVDV 400
NECQRYPGRL CGHKCENTLG SYLCSCSVGF RLSVDGRSCE DINECSSSPC 450
SQECANVYGS YQCYCRRGYQ LSDVDGVTCE DIDECALPTG GHICSYRCIN 500
IPGSFQCSCP SSGYRLAPNG RNCQDIDECV TGIHNCSINE TCFNIQGGFR 550
CLAFECPENY RRSAATLQQE KTDTVRCIKS CRPNDVTCVF DPVHTISHTV 600
ISLPTFREFT RPEEIIFLRA ITPPHPASQA NIIFDITEGN LRDSFDIIKR 650
YMDGMTVGVV RQVRPIVGPF HAVLKLEMNY VVGGVVSHRN VVNVHIFVSE 700
YWF 703
Length:703
Mass (Da):77,214
Last modified:November 25, 2008 - v4
Checksum:i302F7ED2DF34CA71
GO
Isoform A (identifier: P23142-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: Missing.

Show »
Length:566
Mass (Da):61,552
Checksum:i2F8AAA8886D2A1C0
GO
Isoform B (identifier: P23142-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: LQQEKTDTVR...VHIFVSEYWF → QKSKKGRQNTPAGSSKEDCRVLPWKQGLEDTHLDA

Show »
Length:601
Mass (Da):65,443
Checksum:i2203FEF959DB3925
GO
Isoform C (identifier: P23142-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-703: LQQEKTDTVR...VHIFVSEYWF → RCERLPCHEN...KLFIFVSAEL

Show »
Length:683
Mass (Da):74,434
Checksum:iB6B9ED49F590F612
GO

Sequence cautioni

The sequence AAG17241.1 differs from that shown. Reason: Frameshift at positions 116, 619 and 639.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti141 – 1411Q → R.5 Publications
Corresponds to variant rs136730 [ dbSNP | Ensembl ].
VAR_015650
Natural varianti509 – 5091C → S.
Corresponds to variant rs1802787 [ dbSNP | Ensembl ].
VAR_055720
Natural varianti695 – 6951H → R.1 Publication
Corresponds to variant rs13268 [ dbSNP | Ensembl ].
VAR_055721

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei567 – 703137Missing in isoform A. VSP_001383Add
BLAST
Alternative sequencei567 – 703137LQQEK…SEYWF → QKSKKGRQNTPAGSSKEDCR VLPWKQGLEDTHLDA in isoform B. VSP_001384Add
BLAST
Alternative sequencei567 – 703137LQQEK…SEYWF → RCERLPCHENRECSKLPLRI TYYHLSFPTNIQAPAVVFRM GPSSAVPGDSMQLAITGGNE EGFFTTRKVSPHSGVVALTK PVPEPRDLLLTVKMDLSRHG TVSSFVAKLFIFVSAEL in isoform C. VSP_001385Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131P → Q in AAH22497. 1 Publication
Sequence conflicti36 – 361C → S AA sequence 1 Publication
Sequence conflicti41 – 422HR → SH AA sequence 1 Publication
Sequence conflicti521 – 5211R → S in AAH22497. 1 Publication
Sequence conflicti548 – 5481G → A in CAA37770. 1 Publication
Sequence conflicti548 – 5481G → A in CAA37771. 1 Publication
Sequence conflicti548 – 5481G → A in CAA37772. 1 Publication
Sequence conflicti548 – 5481G → A in AAB17099. 1 Publication
Sequence conflicti548 – 5481G → A in AAK37822. 1 Publication
Isoform C (identifier: P23142-4)
Sequence conflicti650 – 6501E → K in AAG17241. 1 Publication
Sequence conflicti662 – 6621L → F in AAG17241. 1 Publication
Sequence conflicti680 – 6823SAE → FAK in AAG17241. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X53741 mRNA. Translation: CAA37770.1.
X53742 mRNA. Translation: CAA37771.1.
X53743 mRNA. Translation: CAA37772.1.
U01244 mRNA. Translation: AAB17099.1.
AF126110 mRNA. Translation: AAK37822.1.
AF217999 mRNA. Translation: AAG17241.1. Frameshift.
AL021391 Genomic DNA. No translation available.
Z95331 Genomic DNA. No translation available.
Z98047 Genomic DNA. No translation available.
BC022497 mRNA. Translation: AAH22497.1.
AY040589 Genomic DNA. Translation: AAK82945.1.
CCDSiCCDS14067.1. [P23142-1]
CCDS14069.1. [P23142-4]
CCDS43028.1. [P23142-2]
PIRiC36346.
RefSeqiNP_001987.2. NM_001996.3.
NP_006476.2. NM_006485.3.
NP_006477.2. NM_006486.2.
NP_006478.2. NM_006487.2.
UniGeneiHs.24601.

Genome annotation databases

EnsembliENST00000262722; ENSP00000262722; ENSG00000077942. [P23142-4]
ENST00000327858; ENSP00000331544; ENSG00000077942. [P23142-1]
ENST00000340923; ENSP00000342212; ENSG00000077942. [P23142-2]
ENST00000442170; ENSP00000393812; ENSG00000077942.
GeneIDi2192.
KEGGihsa:2192.
UCSCiuc003bgg.1. human. [P23142-1]
uc003bgh.3. human. [P23142-4]

Polymorphism databases

DMDMi215274249.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X53741 mRNA. Translation: CAA37770.1 .
X53742 mRNA. Translation: CAA37771.1 .
X53743 mRNA. Translation: CAA37772.1 .
U01244 mRNA. Translation: AAB17099.1 .
AF126110 mRNA. Translation: AAK37822.1 .
AF217999 mRNA. Translation: AAG17241.1 . Frameshift.
AL021391 Genomic DNA. No translation available.
Z95331 Genomic DNA. No translation available.
Z98047 Genomic DNA. No translation available.
BC022497 mRNA. Translation: AAH22497.1 .
AY040589 Genomic DNA. Translation: AAK82945.1 .
CCDSi CCDS14067.1. [P23142-1 ]
CCDS14069.1. [P23142-4 ]
CCDS43028.1. [P23142-2 ]
PIRi C36346.
RefSeqi NP_001987.2. NM_001996.3.
NP_006476.2. NM_006485.3.
NP_006477.2. NM_006486.2.
NP_006478.2. NM_006487.2.
UniGenei Hs.24601.

3D structure databases

ProteinModelPortali P23142.
SMRi P23142. Positions 184-591.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108486. 30 interactions.
IntActi P23142. 26 interactions.
MINTi MINT-5005948.

PTM databases

PhosphoSitei P23142.

Polymorphism databases

DMDMi 215274249.

Proteomic databases

MaxQBi P23142.
PaxDbi P23142.
PRIDEi P23142.

Protocols and materials databases

DNASUi 2192.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262722 ; ENSP00000262722 ; ENSG00000077942 . [P23142-4 ]
ENST00000327858 ; ENSP00000331544 ; ENSG00000077942 . [P23142-1 ]
ENST00000340923 ; ENSP00000342212 ; ENSG00000077942 . [P23142-2 ]
ENST00000442170 ; ENSP00000393812 ; ENSG00000077942 .
GeneIDi 2192.
KEGGi hsa:2192.
UCSCi uc003bgg.1. human. [P23142-1 ]
uc003bgh.3. human. [P23142-4 ]

Organism-specific databases

CTDi 2192.
GeneCardsi GC22P045898.
HGNCi HGNC:3600. FBLN1.
HPAi CAB004393.
HPA001612.
HPA001613.
MIMi 135820. gene.
608180. phenotype.
neXtProti NX_P23142.
Orphaneti 295197. Synpolydactyly type 2.
PharmGKBi PA28013.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
HOGENOMi HOG000007079.
HOVERGENi HBG051559.
KOi K17307.
PhylomeDBi P23142.
TreeFami TF317514.

Enzyme and pathway databases

Reactomei REACT_150331. Molecules associated with elastic fibres.

Miscellaneous databases

ChiTaRSi FBLN1. human.
GeneWikii FBLN1.
GenomeRNAii 2192.
NextBioi 35466434.
PROi P23142.
SOURCEi Search...

Gene expression databases

ArrayExpressi P23142.
Bgeei P23142.
Genevestigatori P23142.

Family and domain databases

InterProi IPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR017048. Fibulin-1.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF01821. ANATO. 2 hits.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view ]
PIRSFi PIRSF036313. Fibulin-1. 1 hit.
SMARTi SM00104. ANATO. 3 hits.
SM00181. EGF. 2 hits.
SM00179. EGF_CA. 7 hits.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 2 hits.
PROSITEi PS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 4 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 5 hits.
PS01187. EGF_CA. 8 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibulin is an extracellular matrix and plasma glycoprotein with repeated domain structure."
    Argraves W.S., Tran H., Burgess W.H., Dickerson K.
    J. Cell Biol. 111:3155-3164(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), VARIANT ARG-141.
  2. "Human fibulin-1D: molecular cloning, expression and similarity with S1-5 protein, a new member of the fibulin gene family."
    Tran H., Mattei M.-G., Godyna S., Argraves W.S.
    Matrix Biol. 15:479-493(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), TISSUE SPECIFICITY, VARIANT ARG-141, INTERACTION WITH FN1 AND FGB.
  3. "Translational control of specific genes during differentiation of HL-60 cells."
    Krichevsky A.M., Metzer E., Rosen H.
    J. Biol. Chem. 274:14295-14305(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), VARIANTS ARG-141 AND ARG-695.
  4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C), VARIANT ARG-141.
  5. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C), VARIANT ARG-141.
    Tissue: Brain.
  7. "Structural and functional characterization of the human and mouse fibulin-1 gene promoters: role of Sp1 and Sp3."
    Castoldi M., Chu M.-L.
    Biochem. J. 362:41-50(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-26.
  8. "Fibulin, a novel protein that interacts with the fibronectin receptor beta subunit cytoplasmic domain."
    Argraves W.S., Dickerson K., Burgess W.H., Ruoslahti E.
    Cell 58:623-629(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 30-44.
  9. "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin."
    Balbona K., Tran H., Godyna S., Ingham K.C., Strickland D.K., Argraves W.S.
    J. Biol. Chem. 267:20120-20125(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: SELF-ASSOCIATION, INTERACTION WITH FN1.
  10. "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study."
    Roark E.F., Keene D.R., Haudenschild C.C., Godyna S., Little C.D., Argraves W.S.
    J. Histochem. Cytochem. 43:401-411(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: POSSIBLE FUNCTION.
  11. "The interaction of fibulin-1 with fibrinogen. A potential role in hemostasis and thrombosis."
    Tran H., Tanaka A., Litvinovich S.V., Medved L.V., Haudenschild C.C., Argraves W.S.
    J. Biol. Chem. 270:19458-19464(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FGB.
  12. "The extracellular matrix proteins fibulin-1 and fibulin-2 in the early human embryo."
    Miosge N., Gotz W., Sasaki T., Chu M.-L., Timpl R., Herken R.
    Histochem. J. 28:109-116(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  13. "Estrogens increase the expression of fibulin-1, an extracellular matrix protein secreted by human ovarian cancer cells."
    Clinton G.M., Rougeot C., Derancourt J., Roger P., Defrenne A., Godyna S., Argraves W.S., Rochefort H.
    Proc. Natl. Acad. Sci. U.S.A. 93:316-320(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  14. "The self-association and fibronectin-binding sites of fibulin-1 map to calcium-binding epidermal growth factor-like domains."
    Tran H., VanDusen W.J., Argraves W.S.
    J. Biol. Chem. 272:22600-22606(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: CALCIUM-BINDING, SELF-ASSOCIATION, FN1-BINDING SITES.
  15. "Suppression of anchorage-independent growth and matrigel invasion and delayed tumor formation by elevated expression of fibulin-1D in human fibrosarcoma-derived cell lines."
    Qing J., Maher V.M., Tran H., Argraves W.S., Dunstan R.W., McCormick J.J.
    Oncogene 15:2159-2168(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN TUMOR FORMATION AND INVASION.
  16. "Increased immunostaining of fibulin-1, an estrogen-regulated protein in the stroma of human ovarian epithelial tumors."
    Roger P., Pujol P., Lucas A., Baldet P., Rochefort H.
    Am. J. Pathol. 153:1579-1588(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  17. "Estradiol and fibulin-1 inhibit motility of human ovarian- and breast-cancer cells induced by fibronectin."
    Hayashido Y., Lucas A., Rougeot C., Godyna S., Argraves W.S., Rochefort H.
    Int. J. Cancer 75:654-658(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN TUMOR FORMATION AND INVASION.
  18. "The C-terminal domain of the regulatory protein NOVH is sufficient to promote interaction with fibulin 1C: a clue for a role of NOVH in cell-adhesion signaling."
    Perbal B., Martinerie C., Sainson R., Werner M., He B., Roizman B.
    Proc. Natl. Acad. Sci. U.S.A. 96:869-874(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NOV.
  19. "Fibulin-1 suppression of fibronectin-regulated cell adhesion and motility."
    Twal W.O., Czirok A., Hegedus B., Knaak C., Chintalapudi M.R., Okagawa H., Sugi Y., Argraves W.S.
    J. Cell Sci. 114:4587-4598(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN CELL ADHESION AND MOTILITY.
  20. "Fibulin-1 binds the amino-terminal head of beta-amyloid precursor protein and modulates its physiological function."
    Ohsawa I., Takamura C., Kohsaka S.
    J. Neurochem. 76:1411-1420(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH APP.
  21. "Interaction of oncogenic papillomavirus E6 proteins with fibulin-1."
    Du M., Fan X., Hong E., Chen J.J.
    Biochem. Biophys. Res. Commun. 296:962-969(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HIGH-RISK HUMAN PAPILLOMAVIRUSES E6 PROTEIN, INHIBITION OF E6-MEDIATED TRANSFORMATION.
  22. "The fibulin-1 gene (FBLN1) is disrupted in a t(12;22) associated with a complex type of synpolydactyly."
    Debeer P., Schoenmakers E.F.P.M., Twal W.O., Argraves W.S., De Smet L., Fryns J.-P., Van De Ven W.J.M.
    J. Med. Genet. 39:98-104(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHROMOSOMAL TRANSLOCATION.
  23. "Estrogen induction and overexpression of fibulin-1C mRNA in ovarian cancer cells."
    Moll F., Katsaros D., Lazennec G., Hellio N., Roger P., Giacalone P.-L., Chalbos D., Maudelonde T., Rochefort H., Pujol P.
    Oncogene 21:1097-1107(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  24. "Elevated expression and altered processing of fibulin-1 protein in human breast cancer."
    Greene L.M., Twal W.O., Duffy M.J., McDermott E.W., Hill A.D., O'Higgins N.J., McCann A.H., Dervan P.A., Argraves W.S., Gallagher W.M.
    Br. J. Cancer 88:871-878(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ASSOCIATION WITH BREAST CANCER.
  25. Cited for: GLYCOSYLATION AT ASN-98.

Entry informationi

Entry nameiFBLN1_HUMAN
AccessioniPrimary (citable) accession number: P23142
Secondary accession number(s): B0QY42
, B1AHL4, P23143, P23144, P37888, Q5TIC4, Q8TBH8, Q9HBQ5, Q9UC21, Q9UGR4, Q9UH41
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 25, 2008
Last modified: September 3, 2014
This is version 179 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi