P23142 (FBLN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibulin-1 Short name=FIBL-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 703 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP. Ref.10 Ref.15 Ref.17 Ref.19 |
| Subunit structure | Homomultimerizes and interacts with various extracellular matrix components such as FN1, LAMA1, LAMA2, NID, ACAN, CSPG2 and type IV collagen. Interacts also with APP, NOV, FGB and HPV type 16, HPV type 18, HPV type 31 and BPV type 1 E6 proteins. Interacts with FBLN7 By similarity. Ref.2 Ref.9 Ref.11 Ref.18 Ref.20 Ref.21 |
| Subcellular location | |
| Tissue specificity | Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells. Ref.2 |
| Developmental stage | Widely expressed during embryonic development. Prominent in the matrix of the leptomeningeal anlage, in basement membranes of the neuroepithelium and the perineurium of peripheral nerves. In embryos of gestational week (gw) 4, staining was observed in the early mesenchymal bone anlagen. In gw 6.5 and 8, all perichondrial structures showed expression but the chondrocytes themselves showed no staining. In gw 10, expression is prominent in the interterritorial matrix surrounding the hypertrophic chondrocytes. Ref.12 |
| Induction | Expression increased by estrogen in ovarian cancer cells. Ref.13 Ref.16 Ref.23 |
| Involvement in disease | Note=A chromosomal aberration involving FBLN1 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with C12orf2. Fibroblasts derived from a patient with synpolydactyly displayed alterations in the level of isoform D splice variant incorporated into the ECM and secreted into the conditioned culture medium. By contrast, the expression of isoform C was not perturbed in the patients fibroblasts. Furthermore, no aberrant polypeptides were detected in extracts of cultured patients fibroblasts. The translocation t(12;22) may result in haploinsufficiency of the isoform D splice variant, which could lead to the observed limb malformation. Note=Elevated expression and altered processing of FBLN1 protein is associated with human breast cancer. |
| Sequence similarities | Belongs to the fibulin family. Contains 3 anaphylatoxin-like domains. Contains 9 EGF-like domains. |
| Sequence caution | The sequence AAG17241.1 differs from that shown. Reason: Frameshift at positions 116, 619 and 639. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Host-virus interaction |
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Domain | EGF-like domain Repeat Signal |
| Ligand | Calcium |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | interspecies interaction between organisms Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular space Inferred from direct assay. Source: BHF-UCL soluble fractionTraceable author statement. Source: ProtInc |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro extracellular matrix structural constituentTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform D (identifier: P23142-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform A (identifier: P23142-2) The sequence of this isoform differs from the canonical sequence as follows: 567-703: Missing. | |||||||||
| Isoform B (identifier: P23142-3) The sequence of this isoform differs from the canonical sequence as follows: 567-601: LQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVI → QKSKKGRQNTPAGSSKEDCRVLPWKQGLEDTHLDA | |||||||||
| Isoform C (identifier: P23142-4) The sequence of this isoform differs from the canonical sequence as follows: 567-703: LQQEKTDTVR...VHIFVSEYWF → RCERLPCHEN...KLFIFVSAEL | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 650 | 1 | E → K in AAG17241. Ref.4 | ||||||
| Sequence conflict | 662 | 1 | L → F in AAG17241. Ref.4 | ||||||
| Sequence conflict | 680 – 682 | 3 | SAE → FAK in AAG17241. Ref.4 | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Ref.8 | ||||||||
| Chain | 30 – 703 | 674 | Fibulin-1 | PRO_0000007563 | |||||||
Regions | |||||||||||
| Domain | 36 – 76 | 41 | Anaphylatoxin-like 1 | ||||||||
| Domain | 77 – 111 | 35 | Anaphylatoxin-like 2 | ||||||||
| Domain | 112 – 144 | 33 | Anaphylatoxin-like 3 | ||||||||
| Domain | 176 – 215 | 40 | EGF-like 1 | ||||||||
| Domain | 216 – 261 | 46 | EGF-like 2; calcium-binding Potential | ||||||||
| Domain | 262 – 307 | 46 | EGF-like 3; calcium-binding Potential | ||||||||
| Domain | 308 – 355 | 48 | EGF-like 4; calcium-binding Potential | ||||||||
| Domain | 356 – 398 | 43 | EGF-like 5; calcium-binding | ||||||||
| Domain | 399 – 440 | 42 | EGF-like 6; calcium-binding | ||||||||
| Domain | 441 – 480 | 40 | EGF-like 7; calcium-binding | ||||||||
| Domain | 481 – 524 | 44 | EGF-like 8; calcium-binding | ||||||||
| Domain | 525 – 578 | 54 | EGF-like 9; calcium-binding | ||||||||
| Region | 356 – 440 | 85 | Self-association and FN1-binding; calcium is necessary for homotypic binding, but not for heterotypic binding | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 535 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 539 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 36 ↔ 61 | By similarity | |||||||||
| Disulfide bond | 37 ↔ 68 | By similarity | |||||||||
| Disulfide bond | 50 ↔ 69 | By similarity | |||||||||
| Disulfide bond | 78 ↔ 109 | By similarity | |||||||||
| Disulfide bond | 91 ↔ 110 | By similarity | |||||||||
| Disulfide bond | 112 ↔ 136 | By similarity | |||||||||
| Disulfide bond | 113 ↔ 143 | By similarity | |||||||||
| Disulfide bond | 126 ↔ 144 | By similarity | |||||||||
| Disulfide bond | 180 ↔ 190 | By similarity | |||||||||
| Disulfide bond | 186 ↔ 199 | By similarity | |||||||||
| Disulfide bond | 201 ↔ 214 | By similarity | |||||||||
| Disulfide bond | 220 ↔ 233 | By similarity | |||||||||
| Disulfide bond | 227 ↔ 242 | By similarity | |||||||||
| Disulfide bond | 248 ↔ 260 | By similarity | |||||||||
| Disulfide bond | 266 ↔ 279 | By similarity | |||||||||
| Disulfide bond | 273 ↔ 288 | By similarity | |||||||||
| Disulfide bond | 294 ↔ 306 | By similarity | |||||||||
| Disulfide bond | 312 ↔ 325 | By similarity | |||||||||
| Disulfide bond | 319 ↔ 334 | By similarity | |||||||||
| Disulfide bond | 341 ↔ 354 | By similarity | |||||||||
| Disulfide bond | 360 ↔ 373 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 382 | By similarity | |||||||||
| Disulfide bond | 384 ↔ 397 | By similarity | |||||||||
| Disulfide bond | 403 ↔ 415 | By similarity | |||||||||
| Disulfide bond | 411 ↔ 424 | By similarity | |||||||||
| Disulfide bond | 426 ↔ 439 | By similarity | |||||||||
| Disulfide bond | 445 ↔ 454 | By similarity | |||||||||
| Disulfide bond | 450 ↔ 463 | By similarity | |||||||||
| Disulfide bond | 465 ↔ 479 | By similarity | |||||||||
| Disulfide bond | 485 ↔ 498 | By similarity | |||||||||
| Disulfide bond | 494 ↔ 507 | By similarity | |||||||||
| Disulfide bond | 509 ↔ 523 | By similarity | |||||||||
| Disulfide bond | 529 ↔ 542 | By similarity | |||||||||
| Disulfide bond | 536 ↔ 551 | By similarity | |||||||||
| Disulfide bond | 556 ↔ 577 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 567 – 703 | 137 | Missing in isoform A. | VSP_001383 | |||||||
| Alternative sequence | 567 – 703 | 137 | LQQEK…SEYWF → RCERLPCHENRECSKLPLRI TYYHLSFPTNIQAPAVVFRM GPSSAVPGDSMQLAITGGNE EGFFTTRKVSPHSGVVALTK PVPEPRDLLLTVKMDLSRHG TVSSFVAKLFIFVSAEL in isoform C. | VSP_001385 | |||||||
| Alternative sequence | 567 – 601 | 35 | LQQEK…SHTVI → QKSKKGRQNTPAGSSKEDCR VLPWKQGLEDTHLDA in isoform B. | VSP_001384 | |||||||
| Natural variant | 141 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Ref.4 Ref.6 Corresponds to variant rs136730 [ dbSNP | Ensembl ]. | VAR_015650 | |||||||
| Natural variant | 509 | 1 | C → S. Corresponds to variant rs1802787 [ dbSNP | Ensembl ]. | VAR_055720 | |||||||
| Natural variant | 695 | 1 | H → R. Ref.3 Corresponds to variant rs13268 [ dbSNP | Ensembl ]. | VAR_055721 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 13 | 1 | P → Q in AAH22497. Ref.6 | ||||||||
| Sequence conflict | 36 | 1 | C → S AA sequence Ref.8 | ||||||||
| Sequence conflict | 41 – 42 | 2 | HR → SH AA sequence Ref.8 | ||||||||
| Sequence conflict | 521 | 1 | R → S in AAH22497. Ref.6 | ||||||||
| Sequence conflict | 548 | 1 | G → A in CAA37770. Ref.1 | ||||||||
| Sequence conflict | 548 | 1 | G → A in CAA37771. Ref.1 | ||||||||
| Sequence conflict | 548 | 1 | G → A in CAA37772. Ref.1 | ||||||||
| Sequence conflict | 548 | 1 | G → A in AAB17099. Ref.2 | ||||||||
| Sequence conflict | 548 | 1 | G → A in AAK37822. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibulin is an extracellular matrix and plasma glycoprotein with repeated domain structure." Argraves W.S., Tran H., Burgess W.H., Dickerson K. J. Cell Biol. 111:3155-3164(1990) [PubMed: 2269669] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), VARIANT ARG-141. |
| [2] | "Human fibulin-1D: molecular cloning, expression and similarity with S1-5 protein, a new member of the fibulin gene family." Tran H., Mattei M.-G., Godyna S., Argraves W.S. Matrix Biol. 15:479-493(1997) [PubMed: 9106159] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), TISSUE SPECIFICITY, VARIANT ARG-141, INTERACTION WITH FN1 AND FGB. |
| [3] | "Translational control of specific genes during differentiation of HL-60 cells." Krichevsky A.M., Metzer E., Rosen H. J. Biol. Chem. 274:14295-14305(1999) [PubMed: 10318851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), VARIANTS ARG-141 AND ARG-695. |
| [4] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed: 15498874] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C), VARIANT ARG-141. |
| [5] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C), VARIANT ARG-141. Tissue: Brain. |
| [7] | "Structural and functional characterization of the human and mouse fibulin-1 gene promoters: role of Sp1 and Sp3." Castoldi M., Chu M.-L. Biochem. J. 362:41-50(2002) [PubMed: 11829738] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-26. |
| [8] | "Fibulin, a novel protein that interacts with the fibronectin receptor beta subunit cytoplasmic domain." Argraves W.S., Dickerson K., Burgess W.H., Ruoslahti E. Cell 58:623-629(1989) [PubMed: 2527614] [Abstract] Cited for: PROTEIN SEQUENCE OF 30-44. |
| [9] | "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin." Balbona K., Tran H., Godyna S., Ingham K.C., Strickland D.K., Argraves W.S. J. Biol. Chem. 267:20120-20125(1992) [PubMed: 1400330] [Abstract] Cited for: SELF-ASSOCIATION, INTERACTION WITH FN1. |
| [10] | "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study." Roark E.F., Keene D.R., Haudenschild C.C., Godyna S., Little C.D., Argraves W.S. J. Histochem. Cytochem. 43:401-411(1995) [PubMed: 7534784] [Abstract] Cited for: POSSIBLE FUNCTION. |
| [11] | "The interaction of fibulin-1 with fibrinogen. A potential role in hemostasis and thrombosis." Tran H., Tanaka A., Litvinovich S.V., Medved L.V., Haudenschild C.C., Argraves W.S. J. Biol. Chem. 270:19458-19464(1995) [PubMed: 7642629] [Abstract] Cited for: INTERACTION WITH FGB. |
| [12] | "The extracellular matrix proteins fibulin-1 and fibulin-2 in the early human embryo." Miosge N., Gotz W., Sasaki T., Chu M.-L., Timpl R., Herken R. Histochem. J. 28:109-116(1996) [PubMed: 8737292] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [13] | "Estrogens increase the expression of fibulin-1, an extracellular matrix protein secreted by human ovarian cancer cells." Clinton G.M., Rougeot C., Derancourt J., Roger P., Defrenne A., Godyna S., Argraves W.S., Rochefort H. Proc. Natl. Acad. Sci. U.S.A. 93:316-320(1996) [PubMed: 8552629] [Abstract] Cited for: INDUCTION. |
| [14] | "The self-association and fibronectin-binding sites of fibulin-1 map to calcium-binding epidermal growth factor-like domains." Tran H., VanDusen W.J., Argraves W.S. J. Biol. Chem. 272:22600-22606(1997) [PubMed: 9278415] [Abstract] Cited for: CALCIUM-BINDING, SELF-ASSOCIATION, FN1-BINDING SITES. |
| [15] | "Suppression of anchorage-independent growth and matrigel invasion and delayed tumor formation by elevated expression of fibulin-1D in human fibrosarcoma-derived cell lines." Qing J., Maher V.M., Tran H., Argraves W.S., Dunstan R.W., McCormick J.J. Oncogene 15:2159-2168(1997) [PubMed: 9393974] [Abstract] Cited for: ROLE IN TUMOR FORMATION AND INVASION. |
| [16] | "Increased immunostaining of fibulin-1, an estrogen-regulated protein in the stroma of human ovarian epithelial tumors." Roger P., Pujol P., Lucas A., Baldet P., Rochefort H. Am. J. Pathol. 153:1579-1588(1998) [PubMed: 9811350] [Abstract] Cited for: INDUCTION. |
| [17] | "Estradiol and fibulin-1 inhibit motility of human ovarian- and breast-cancer cells induced by fibronectin." Hayashido Y., Lucas A., Rougeot C., Godyna S., Argraves W.S., Rochefort H. Int. J. Cancer 75:654-658(1998) [PubMed: 9466671] [Abstract] Cited for: ROLE IN TUMOR FORMATION AND INVASION. |
| [18] | "The C-terminal domain of the regulatory protein NOVH is sufficient to promote interaction with fibulin 1C: a clue for a role of NOVH in cell-adhesion signaling." Perbal B., Martinerie C., Sainson R., Werner M., He B., Roizman B. Proc. Natl. Acad. Sci. U.S.A. 96:869-874(1999) [PubMed: 9927660] [Abstract] Cited for: INTERACTION WITH NOV. |
| [19] | "Fibulin-1 suppression of fibronectin-regulated cell adhesion and motility." Twal W.O., Czirok A., Hegedus B., Knaak C., Chintalapudi M.R., Okagawa H., Sugi Y., Argraves W.S. J. Cell Sci. 114:4587-4598(2001) [PubMed: 11792823] [Abstract] Cited for: ROLE IN CELL ADHESION AND MOTILITY. |
| [20] | "Fibulin-1 binds the amino-terminal head of beta-amyloid precursor protein and modulates its physiological function." Ohsawa I., Takamura C., Kohsaka S. J. Neurochem. 76:1411-1420(2001) [PubMed: 11238726] [Abstract] Cited for: INTERACTION WITH APP. |
| [21] | "Interaction of oncogenic papillomavirus E6 proteins with fibulin-1." Du M., Fan X., Hong E., Chen J.J. Biochem. Biophys. Res. Commun. 296:962-969(2002) [PubMed: 12200142] [Abstract] Cited for: INTERACTION WITH HIGH-RISK HUMAN PAPILLOMAVIRUSES E6 PROTEIN, INHIBITION OF E6-MEDIATED TRANSFORMATION. |
| [22] | "The fibulin-1 gene (FBLN1) is disrupted in a t(12;22) associated with a complex type of synpolydactyly." Debeer P., Schoenmakers E.F.P.M., Twal W.O., Argraves W.S., De Smet L., Fryns J.-P., Van De Ven W.J.M. J. Med. Genet. 39:98-104(2002) [PubMed: 11836357] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION. |
| [23] | "Estrogen induction and overexpression of fibulin-1C mRNA in ovarian cancer cells." Moll F., Katsaros D., Lazennec G., Hellio N., Roger P., Giacalone P.-L., Chalbos D., Maudelonde T., Rochefort H., Pujol P. Oncogene 21:1097-1107(2002) [PubMed: 11850827] [Abstract] Cited for: INDUCTION. |
| [24] | "Elevated expression and altered processing of fibulin-1 protein in human breast cancer." Greene L.M., Twal W.O., Duffy M.J., McDermott E.W., Hill A.D., O'Higgins N.J., McCann A.H., Dervan P.A., Argraves W.S., Gallagher W.M. Br. J. Cancer 88:871-878(2003) [PubMed: 12644824] [Abstract] Cited for: ASSOCIATION WITH BREAST CANCER. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X53741 mRNA. Translation: CAA37770.1. X53742 mRNA. Translation: CAA37771.1. X53743 mRNA. Translation: CAA37772.1. U01244 mRNA. Translation: AAB17099.1. AF126110 mRNA. Translation: AAK37822.1. AF217999 mRNA. Translation: AAG17241.1. Frameshift. Z95331, Z98047, AL021391 Genomic DNA. Translation: CAI41717.1. Z98047, Z95331, AL021391 Genomic DNA. Translation: CAI19628.1. Z95331, AL021391, Z98047 Genomic DNA. Translation: CAQ08435.1. Z98047, AL021391, Z95331 Genomic DNA. Translation: CAQ10154.1. BC022497 mRNA. Translation: AAH22497.1. AY040589 Genomic DNA. Translation: AAK82945.1. |
| IPI | IPI00218803. IPI00296534. IPI00296537. IPI00333852. |
| PIR | C36346. |
| RefSeq | NP_001987.2. NM_001996.3. NP_006476.2. NM_006485.3. NP_006477.2. NM_006486.2. NP_006478.2. NM_006487.2. |
| UniGene | Hs.24601. Hs.593123. |
3D structure databases | |
| ProteinModelPortal | P23142. |
| SMR | P23142. Positions 37-68, 171-604. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P23142. 22 interactions. |
| MINT | MINT-5005948. |
| STRING | P23142. |
Polymorphism databases | |
| DMDM | 215274249. |
Proteomic databases | |
| PRIDE | P23142. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000327858; ENSP00000331544; ENSG00000077942. |
| GeneID | 2192. |
| KEGG | hsa:2192. |
| UCSC | uc003bgg.1. human. |
Organism-specific databases | |
| CTD | 2192. |
| GeneCards | GC22P045898. |
| HGNC | HGNC:3600. FBLN1. |
| HPA | CAB004393. HPA001612. HPA001613. |
| MIM | 135820. gene. 608180. phenotype. |
| neXtProt | NX_P23142. |
| Orphanet | 93403. Syndactyly type 2. |
| PharmGKB | PA28013. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10820. |
| GeneTree | ENSGT00600000084166. |
| HOVERGEN | HBG051559. |
Gene expression databases | |
| ArrayExpress | P23142. |
| Bgee | P23142. |
| Genevestigator | P23142. |
| GermOnline | ENSG00000077942. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000020. Anaphylatoxin/fibulin. IPR006210. EGF-like. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. IPR017048. Fibulin-1. [Graphical view] |
| PANTHER | PTHR24048:SF229. PTHR24048:SF229. 1 hit. |
| Pfam | PF01821. ANATO. 2 hits. PF07645. EGF_CA. 5 hits. [Graphical view] |
| PIRSF | PIRSF036313. Fibulin-1. 1 hit. |
| SMART | SM00104. ANATO. 3 hits. SM00181. EGF. 2 hits. SM00179. EGF_CA. 7 hits. [Graphical view] |
| PROSITE | PS01177. ANAPHYLATOXIN_1. 3 hits. PS01178. ANAPHYLATOXIN_2. 3 hits. PS00010. ASX_HYDROXYL. 4 hits. PS00022. EGF_1. False negative. PS01186. EGF_2. 3 hits. PS50026. EGF_3. 5 hits. PS01187. EGF_CA. 8 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 8855. |
| SOURCE | Search... |
Entry information
| Entry name | FBLN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P23142 Secondary accession number(s): B0QY42 Q9UH41 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with