P23023 (DSX_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 134.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein doublesex | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 549 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Controls somatic sexual differentiation. Binds directly and specifically to the FBE (fat body enhancer) of the yolk protein 1 and 2 genes (Yp1 and Yp2). This enhancer is sufficient to direct the female-specific transcription characteristic of the Yp genes in adult fat bodies. Involved in regulation of male-specific expression of takeout in brain-associated fat body. Ref.7 |
| Subcellular location | |
| Miscellaneous | Experimentally shown to bind zinc. |
| Sequence similarities | Contains 1 DM DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| C901 | Q9VZ44 | 1 | EBI-196709,EBI-172504 | |
| Cas | Q9XZU1 | 1 | EBI-196709,EBI-126291 | |
| CG34168-RA | Q9VJM1 | 1 | EBI-196709,EBI-121063 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Male (identifier: P23023-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Female (identifier: P23023-2) Also known as: B; C; The sequence of this isoform differs from the canonical sequence as follows: 398-427: ARVEINRTVAQIYYNYYTPMALVNGAPMYL → GQYVVNEYSRQHNLNIYDGGELRNTTRQCG 428-549: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 549 | 549 | Protein doublesex | PRO_0000207041 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| DNA binding | 44 – 91 | 48 | DM Ref.5 Ref.6 | |||||||||||||||||||||||||
| Compositional bias | 119 – 224 | 106 | His-rich | |||||||||||||||||||||||||
| Compositional bias | 267 – 296 | 30 | Gly/Ser-rich | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 398 – 427 | 30 | ARVEI…APMYL → GQYVVNEYSRQHNLNIYDGG ELRNTTRQCG in isoform Female. | VSP_001321 | ||||||||||||||||||||||||
| Alternative sequence | 428 – 549 | 122 | Missing in isoform Female. | VSP_001322 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Mutagenesis | 47 | 1 | C → A or H: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Mutagenesis | 50 | 1 | H → Y: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Mutagenesis | 59 | 1 | H → Y: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Mutagenesis | 68 | 1 | C → D or Y: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Mutagenesis | 70 | 1 | C → Y: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Mutagenesis | 91 | 1 | R → Q: Abolishes DNA-binding. | |||||||||||||||||||||||||
| Sequence conflict | 53 | 1 | K → N in AAL25296. Ref.4 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 45 – 48 | 4 | ||||||||||||||||||||||||||
| Turn | 49 – 51 | 3 | ||||||||||||||||||||||||||
| Turn | 55 – 58 | 4 | ||||||||||||||||||||||||||
| Helix | 60 – 62 | 3 | ||||||||||||||||||||||||||
| Turn | 64 – 67 | 4 | ||||||||||||||||||||||||||
| Helix | 71 – 80 | 10 | ||||||||||||||||||||||||||
| Helix | 354 – 366 | 13 | ||||||||||||||||||||||||||
| Helix | 371 – 373 | 3 | ||||||||||||||||||||||||||
| Helix | 374 – 383 | 10 | ||||||||||||||||||||||||||
| Turn | 384 – 386 | 3 | ||||||||||||||||||||||||||
| Helix | 388 – 397 | 10 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Drosophila doublesex gene controls somatic sexual differentiation by producing alternatively spliced mRNAs encoding related sex-specific polypeptides." Burtis K.C., Baker B.S. Cell 56:997-1010(1989) [PubMed: 2493994] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS FEMALE AND MALE). Tissue: Larva and Pupae. |
| [2] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [3] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [4] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM FEMALE). Strain: Berkeley. Tissue: Head. |
| [5] | "The doublesex proteins of Drosophila melanogaster bind directly to a sex-specific yolk protein gene enhancer." Burtis K.C., Coschigano K.T., Baker B.S., Wensink P.C. EMBO J. 10:2577-2582(1991) [PubMed: 1907913] [Abstract] Cited for: DNA-BINDING. |
| [6] | "The Drosophila doublesex proteins share a novel zinc finger related DNA binding domain." Erdman S.E., Burtis K.C. EMBO J. 12:527-535(1993) [PubMed: 8440242] [Abstract] Cited for: DNA-BINDING DOMAIN, MUTAGENESIS. |
| [7] | "The Drosophila takeout gene is regulated by the somatic sex-determination pathway and affects male courtship behavior." Dauwalder B., Tsujimoto S., Moss J., Mattox W. Genes Dev. 16:2879-2892(2002) [PubMed: 12435630] [Abstract] Cited for: FUNCTION. Strain: Canton-S. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M25292 mRNA. Translation: AAA17840.1. M25293 mRNA. Translation: AAA17841.1. M25294 mRNA. Translation: AAA17842.1. AE014297 Genomic DNA. Translation: AAF54169.1. AE014297 Genomic DNA. Translation: AAN13385.1. AY060257 mRNA. Translation: AAL25296.1. BT029258 mRNA. Translation: ABK30895.1. | ||||||||||||||||||||||||||||||
| PIR | A32372. B32372. | ||||||||||||||||||||||||||||||
| RefSeq | NP_524272.4. NM_079548.4. NP_731197.1. NM_169202.1. NP_731198.1. NM_169203.1. | ||||||||||||||||||||||||||||||
| UniGene | Dm.3308. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P23023. | ||||||||||||||||||||||||||||||
| SMR | P23023. Positions 35-86, 350-408. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-17110N. | ||||||||||||||||||||||||||||||
| IntAct | P23023. 3 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-276845. | ||||||||||||||||||||||||||||||
| STRING | P23023. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P23023. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| EnsemblMetazoa | FBtr0081759; FBpp0081256; FBgn0000504. | ||||||||||||||||||||||||||||||
| GeneID | 40940. | ||||||||||||||||||||||||||||||
| KEGG | dme:Dmel_CG11094. | ||||||||||||||||||||||||||||||
| NMPDR | fig|7227.3.peg.11616. | ||||||||||||||||||||||||||||||
| UCSC | CG11094-RA. d. melanogaster. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 40940. | ||||||||||||||||||||||||||||||
| FlyBase | FBgn0000504. dsx. | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | inNOG11008. | ||||||||||||||||||||||||||||||
| GeneTree | EMGT00050000002224. | ||||||||||||||||||||||||||||||
| InParanoid | P23023. | ||||||||||||||||||||||||||||||
| OMA | MIDSKND. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4N2Z5N. | ||||||||||||||||||||||||||||||
| PhylomeDB | P23023. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P23023. | ||||||||||||||||||||||||||||||
| Bgee | P23023. | ||||||||||||||||||||||||||||||
| GermOnline | CG11094. Drosophila melanogaster. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR001275. DM_DNA-bd. IPR014932. DSX_dimer. [Graphical view] | ||||||||||||||||||||||||||||||
| Gene3D | G3DSA:4.10.1040.10. DM_DNA_bd. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF00751. DM. 1 hit. PF08828. DSX_dimer. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProDom | PD015828. DSX_dimer. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||
| SMART | SM00301. DM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF82927. DM_DNA_bd. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS40000. DM_1. 1 hit. PS50809. DM_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| NextBio | 821382. | ||||||||||||||||||||||||||||||
Entry information
| Entry name | DSX_DROME | ||||||||
| Accession | Primary (citable) accession number: P23023 Secondary accession number(s): P23022 Q9VHY0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with