Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein doublesex

Gene

dsx

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Controls somatic sexual differentiation. Binds directly and specifically to the FBE (fat body enhancer) of the yolk protein 1 and 2 genes (Yp1 and Yp2). This enhancer is sufficient to direct the female-specific transcription characteristic of the Yp genes in adult fat bodies. Involved in regulation of male-specific expression of takeout in brain-associated fat body.1 Publication

Miscellaneous

Experimentally shown to bind zinc.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi44 – 91DMPROSITE-ProRule annotationAdd BLAST48

GO - Molecular functioni

  • protein homodimerization activity Source: FlyBase
  • RNA polymerase II regulatory region sequence-specific DNA binding Source: FlyBase
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding Source: FlyBase
  • transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding Source: FlyBase
  • zinc ion binding Source: FlyBase

GO - Biological processi

  • axon midline choice point recognition Source: FlyBase
  • courtship behavior Source: FlyBase
  • female analia development Source: FlyBase
  • female sex differentiation Source: FlyBase
  • female somatic sex determination Source: FlyBase
  • genital disc development Source: FlyBase
  • imaginal disc-derived female genitalia development Source: FlyBase
  • imaginal disc-derived male genitalia development Source: FlyBase
  • male analia development Source: FlyBase
  • male courtship behavior Source: FlyBase
  • male courtship behavior, veined wing generated song production Source: FlyBase
  • male sex differentiation Source: FlyBase
  • negative regulation of developmental pigmentation Source: FlyBase
  • negative regulation of transcription, DNA-templated Source: FlyBase
  • positive regulation of transcription, DNA-templated Source: FlyBase
  • positive regulation of transcription from RNA polymerase II promoter Source: FlyBase
  • regulation of transcription from RNA polymerase II promoter Source: FlyBase
  • sex comb development Source: FlyBase
  • sex determination Source: FlyBase
  • sex-specific pigmentation Source: FlyBase
  • somatic sex determination Source: FlyBase

Keywordsi

Molecular functionDNA-binding
Biological processDifferentiation, Sexual differentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein doublesex
Gene namesi
Name:dsx
ORF Names:CG11094
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3R

Organism-specific databases

FlyBaseiFBgn0000504. dsx.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi47C → A or H: Abolishes DNA-binding. 1 Publication1
Mutagenesisi50H → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi59H → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi68C → D or Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi70C → Y: Abolishes DNA-binding. 1 Publication1
Mutagenesisi91R → Q: Abolishes DNA-binding. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002070411 – 549Protein doublesexAdd BLAST549

Proteomic databases

PaxDbiP23023.
PRIDEiP23023.

Expressioni

Gene expression databases

BgeeiFBgn0000504.
ExpressionAtlasiP23023. differential.
GenevisibleiP23023. DM.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

  • protein homodimerization activity Source: FlyBase

Protein-protein interaction databases

BioGridi66125. 50 interactors.
DIPiDIP-17110N.
IntActiP23023. 14 interactors.
STRINGi7227.FBpp0303107.

Structurei

Secondary structure

1549
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi45 – 48Combined sources4
Turni49 – 51Combined sources3
Turni55 – 58Combined sources4
Helixi60 – 62Combined sources3
Turni64 – 67Combined sources4
Helixi71 – 80Combined sources10
Helixi354 – 366Combined sources13
Helixi371 – 373Combined sources3
Helixi374 – 383Combined sources10
Turni384 – 386Combined sources3
Helixi388 – 407Combined sources20
Beta strandi411 – 413Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LPVNMR-A35-86[»]
1ZV1X-ray1.60A/B350-397[»]
2JZ0NMR-A/B350-397[»]
2JZ1NMR-A/B350-397[»]
ProteinModelPortaliP23023.
SMRiP23023.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP23023.

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi119 – 224His-richAdd BLAST106
Compositional biasi267 – 296Gly/Ser-richAdd BLAST30

Phylogenomic databases

eggNOGiKOG3815. Eukaryota.
ENOG410XSK9. LUCA.
GeneTreeiENSGT00550000074486.
InParanoidiP23023.
OrthoDBiEOG091G179Z.
PhylomeDBiP23023.

Family and domain databases

Gene3Di4.10.1040.10. 1 hit.
InterProiView protein in InterPro
IPR001275. DM_DNA-bd.
IPR036407. DM_DNA-bd_sf.
IPR026607. DMRT/dsx/mab-3.
IPR014932. DSX_dimer.
PANTHERiPTHR12322. PTHR12322. 1 hit.
PfamiView protein in Pfam
PF00751. DM. 1 hit.
PF08828. DSX_dimer. 1 hit.
ProDomiView protein in ProDom or Entries sharing at least one domain
PD015828. DSX_dimer. 1 hit.
SMARTiView protein in SMART
SM00301. DM. 1 hit.
SM01143. DSX_dimer. 1 hit.
SUPFAMiSSF82927. SSF82927. 1 hit.
PROSITEiView protein in PROSITE
PS40000. DM_1. 1 hit.
PS50809. DM_2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Male (identifier: P23023-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSEENWNSD TMSDSDMIDS KNDVCGGASS SSGSSISPRT PPNCARCRNH
60 70 80 90 100
GLKITLKGHK RYCKFRYCTC EKCRLTADRQ RVMALQTALR RAQAQDEQRA
110 120 130 140 150
LHMHEVPPAN PAATTLLSHH HHVAAPAHVH AHHVHAHHAH GGHHSHHGHV
160 170 180 190 200
LHHQQAAAAA AAAPSAPASH LGGSSTAASS IHGHAHAHHV HMAAAAAASV
210 220 230 240 250
AQHQHQSHPH SHHHHHQNHH QHPHQQPATQ TALRSPPHSD HGGSVGPATS
260 270 280 290 300
SSGGGAPSSS NAAAATSSNG SSGGGGGGGG GSSGGGAGGG RSSGTSVITS
310 320 330 340 350
ADHHMTTVPT PAQSLEGSCD SSSPSPSSTS GAAILPISVS VNRKNGANVP
360 370 380 390 400
LGQDVFLDYC QKLLEKFRYP WELMPLMYVI LKDADANIEE ASRRIEEARV
410 420 430 440 450
EINRTVAQIY YNYYTPMALV NGAPMYLTYP SIEQGRYGAH FTHLPLTQIC
460 470 480 490 500
PPTPEPLALS RSPSSPSGPS AVHNQKPSRP GSSNGTVHSA ASPTMVTTMA
510 520 530 540
TTSSTPTLSR RQRSRSATPT TPPPPPPAHS SSNGAYHHGH HLVSSTAAT
Length:549
Mass (Da):57,409
Last modified:November 1, 1991 - v1
Checksum:i3C1B92724E4CE083
GO
Isoform Female (identifier: P23023-2) [UniParc]FASTAAdd to basket
Also known as: B, C

The sequence of this isoform differs from the canonical sequence as follows:
     398-427: ARVEINRTVAQIYYNYYTPMALVNGAPMYL → GQYVVNEYSRQHNLNIYDGGELRNTTRQCG
     428-549: Missing.

Show »
Length:427
Mass (Da):44,768
Checksum:i75143686AC717315
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti53K → N in AAL25296 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001321398 – 427ARVEI…APMYL → GQYVVNEYSRQHNLNIYDGG ELRNTTRQCG in isoform Female. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_001322428 – 549Missing in isoform Female. 2 PublicationsAdd BLAST122

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25292 mRNA. Translation: AAA17840.1.
M25293 mRNA. Translation: AAA17841.1.
M25294 mRNA. Translation: AAA17842.1.
AE014297 Genomic DNA. Translation: AAF54169.1.
AE014297 Genomic DNA. Translation: AAN13385.1.
AY060257 mRNA. Translation: AAL25296.1.
BT029258 mRNA. Translation: ABK30895.1.
PIRiA32372.
B32372.
RefSeqiNP_001262352.1. NM_001275423.1. [P23023-1]
NP_001287220.1. NM_001300291.1. [P23023-2]
NP_524272.4. NM_079548.5. [P23023-2]
NP_731197.1. NM_169202.1. [P23023-1]
NP_731198.1. NM_169203.2. [P23023-2]
UniGeneiDm.3308.

Genome annotation databases

EnsemblMetazoaiFBtr0081759; FBpp0081256; FBgn0000504. [P23023-1]
FBtr0081760; FBpp0081257; FBgn0000504. [P23023-2]
FBtr0081761; FBpp0081258; FBgn0000504. [P23023-2]
FBtr0330073; FBpp0303106; FBgn0000504. [P23023-1]
FBtr0339710; FBpp0308767; FBgn0000504. [P23023-2]
GeneIDi40940.
KEGGidme:Dmel_CG11094.
UCSCiCG11094-RA. d. melanogaster. [P23023-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDSX_DROME
AccessioniPrimary (citable) accession number: P23023
Secondary accession number(s): P23022
, Q0KIA7, Q95TA5, Q9VHY0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1991
Last sequence update: November 1, 1991
Last modified: November 22, 2017
This is version 186 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references