Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor subfamily 4 group A member 1

Gene

NR4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation.By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi264 – 339Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri267 – 287NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri303 – 327NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

  • cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • cellular response to corticotropin-releasing hormone stimulus Source: UniProtKB
  • cellular response to fibroblast growth factor stimulus Source: BHF-UCL
  • cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
  • endothelial cell chemotaxis Source: BHF-UCL
  • fat cell differentiation Source: UniProtKB
  • negative regulation of cell cycle Source: UniProtKB
  • positive regulation of endothelial cell proliferation Source: BHF-UCL
  • positive regulation of transcription from RNA polymerase II promoter Source: MGI
  • regulation of type B pancreatic cell proliferation Source: UniProtKB
  • signal transduction Source: ProtInc
  • transcription initiation from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000123358-MONOMER.
ReactomeiR-HSA-198693. AKT phosphorylates targets in the nucleus.
R-HSA-383280. Nuclear Receptor transcription pathway.
R-HSA-5674400. Constitutive Signaling by AKT1 E17K in Cancer.
SignaLinkiP22736.
SIGNORiP22736.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor subfamily 4 group A member 1
Alternative name(s):
Early response protein NAK1
Nuclear hormone receptor NUR/77
Short name:
Nur77
Orphan nuclear receptor HMR
Orphan nuclear receptor TR3
ST-59
Testicular receptor 3
Gene namesi
Name:NR4A1
Synonyms:GFRP1, HMR, NAK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:7980. NR4A1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi595T → E: Strongly weakens interaction with STK11. 1 Publication1

Organism-specific databases

DisGeNETi3164.
OpenTargetsiENSG00000123358.
PharmGKBiPA31761.

Chemistry databases

ChEMBLiCHEMBL1293229.

Polymorphism and mutation databases

BioMutaiNR4A1.
DMDMi127819.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000537151 – 598Nuclear receptor subfamily 4 group A member 1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei341Phosphoserine; by PKABy similarity1
Modified residuei351PhosphoserineCombined sources1 Publication1

Post-translational modificationi

Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli.1 Publication
Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP22736.
PeptideAtlasiP22736.
PRIDEiP22736.

PTM databases

iPTMnetiP22736.
PhosphoSitePlusiP22736.

Expressioni

Tissue specificityi

Fetal muscle and adult liver, brain and thyroid.

Inductioni

By growth-stimulating agents.

Gene expression databases

BgeeiENSG00000123358.
CleanExiHS_NR4A1.
ExpressionAtlasiP22736. baseline and differential.
GenevisibleiP22736. HS.

Organism-specific databases

HPAiHPA059742.

Interactioni

Subunit structurei

Binds DNA as a monomer (By similarity). Interacts with GADD45GIP1. Interacts with STK11.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-721550,EBI-9028517From a different organism.
ANKIB1Q9P2G12EBI-721550,EBI-2687890
BCL2P104157EBI-721550,EBI-77694
CDKN2DP552733EBI-721550,EBI-745859
CUTAO608882EBI-721550,EBI-1051556
GKP321893EBI-721550,EBI-3926629
KRTAP10-5P603703EBI-721550,EBI-10172150
LONRF1Q17RB83EBI-721550,EBI-2341787
MATR3P432432EBI-721550,EBI-352602
PGBD1Q96JS33EBI-721550,EBI-10290053
PLXND1Q9Y4D72EBI-721550,EBI-310731
STAT3P407633EBI-721550,EBI-518675
TP53P046376EBI-721550,EBI-366083
TUBB4AP043502EBI-721550,EBI-355007
VASPP505522EBI-721550,EBI-748201

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109407. 100 interactors.
DIPiDIP-40392N.
IntActiP22736. 88 interactors.
MINTiMINT-2859679.
STRINGi9606.ENSP00000353427.

Chemistry databases

BindingDBiP22736.

Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi364 – 373Combined sources10
Helixi379 – 381Combined sources3
Beta strandi395 – 397Combined sources3
Helixi400 – 422Combined sources23
Helixi427 – 429Combined sources3
Helixi432 – 454Combined sources23
Helixi457 – 459Combined sources3
Beta strandi461 – 463Combined sources3
Beta strandi467 – 471Combined sources5
Helixi472 – 479Combined sources8
Helixi482 – 495Combined sources14
Helixi500 – 511Combined sources12
Helixi521 – 541Combined sources21
Turni544 – 546Combined sources3
Helixi550 – 556Combined sources7
Helixi558 – 579Combined sources22
Helixi586 – 594Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QW4X-ray2.80A/B/C/D347-598[»]
3V3EX-ray2.06A/B351-598[»]
3V3QX-ray2.22A/B351-598[»]
4JGVX-ray3.01A/B351-598[»]
4KZIX-ray2.41A/B351-598[»]
4KZJX-ray2.12A/B351-598[»]
4KZMX-ray2.30A/B351-598[»]
4RE8X-ray2.16A/B351-598[»]
4REEX-ray2.37A/B351-598[»]
4REFX-ray2.10A/B351-598[»]
4RZEX-ray2.49A/B351-598[»]
4RZFX-ray1.99A/B351-598[»]
4RZGX-ray2.70A/B351-598[»]
4WHFX-ray2.27A/B351-598[»]
4WHGX-ray2.18A/B351-598[»]
ProteinModelPortaliP22736.
SMRiP22736.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP22736.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni409 – 459Ligand-bindingSequence analysisAdd BLAST51

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi82 – 92Poly-SerAdd BLAST11
Compositional biasi583 – 586Poly-Pro4

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri267 – 287NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri303 – 327NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG4217. Eukaryota.
ENOG410YWNC. LUCA.
GeneTreeiENSGT00760000118887.
HOGENOMiHOG000230925.
HOVERGENiHBG052663.
InParanoidiP22736.
KOiK04465.
PhylomeDBiP22736.
TreeFamiTF315430.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR003071. Nuc_orp_HMR_rcpt.
IPR003070. Nuc_orph_rcpt.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01285. HMRNUCRECPTR.
PR01284. NUCLEARECPTR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P22736-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPCIQAQYGT PAPSPGPRDH LASDPLTPEF IKPTMDLASP EAAPAAPTAL
60 70 80 90 100
PSFSTFMDGY TGEFDTFLYQ LPGTVQPCSS ASSSASSTSS SSATSPASAS
110 120 130 140 150
FKFEDFQVYG CYPGPLSGPV DEALSSSGSD YYGSPCSAPS PSTPSFQPPQ
160 170 180 190 200
LSPWDGSFGH FSPSQTYEGL RAWTEQLPKA SGPPQPPAFF SFSPPTGPSP
210 220 230 240 250
SLAQSPLKLF PSQATHQLGE GESYSMPTAF PGLAPTSPHL EGSGILDTPV
260 270 280 290 300
TSTKARSGAP GGSEGRCAVC GDNASCQHYG VRTCEGCKGF FKRTVQKNAK
310 320 330 340 350
YICLANKDCP VDKRRRNRCQ FCRFQKCLAV GMVKEVVRTD SLKGRRGRLP
360 370 380 390 400
SKPKQPPDAS PANLLTSLVR AHLDSGPSTA KLDYSKFQEL VLPHFGKEDA
410 420 430 440 450
GDVQQFYDLL SGSLEVIRKW AEKIPGFAEL SPADQDLLLE SAFLELFILR
460 470 480 490 500
LAYRSKPGEG KLIFCSGLVL HRLQCARGFG DWIDSILAFS RSLHSLLVDV
510 520 530 540 550
PAFACLSALV LITDRHGLQE PRRVEELQNR IASCLKEHVA AVAGEPQPAS
560 570 580 590
CLSRLLGKLP ELRTLCTQGL QRIFYLKLED LVPPPPIIDK IFMDTLPF
Length:598
Mass (Da):64,463
Last modified:August 1, 1991 - v1
Checksum:i41DAAEA7C25FDA22
GO
Isoform 2 (identifier: P22736-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLAKACWSIQSEM

Note: No experimental confirmation available.
Show »
Length:611
Mass (Da):65,998
Checksum:i21F3BC282AE6BE8D
GO
Isoform 3 (identifier: P22736-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     293-325: RTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQ → VPRSPRWGLLLEMERGWPHPIGTCGLPLGSPPS
     326-598: Missing.

Show »
Length:325
Mass (Da):33,754
Checksum:iBCF2490A32A09175
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti253T → I (PubMed:1651101).Curated1
Sequence conflicti262G → P in AAA36763 (PubMed:2626032).Curated1
Sequence conflicti360S → F in CAG32985 (Ref. 8) Curated1
Sequence conflicti370R → L in AAA36763 (PubMed:2626032).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06153426L → V.Corresponds to variant rs1882118dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0430861M → MWLAKACWSIQSEM in isoform 2. 1 Publication1
Alternative sequenceiVSP_047769293 – 325RTVQK…FCRFQ → VPRSPRWGLLLEMERGWPHP IGTCGLPLGSPPS in isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_047770326 – 598Missing in isoform 3. 2 PublicationsAdd BLAST273

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49728 mRNA. Translation: BAA08565.1.
L13740 mRNA. Translation: AAA36763.1.
D85245 mRNA. Translation: BAA12746.1.
AK297526 mRNA. Translation: BAG59929.1.
HQ692855 mRNA. Translation: ADZ17366.1.
AB307717 mRNA. Translation: BAH02308.1.
BT007144 mRNA. Translation: AAP35808.1.
AK314437 mRNA. Translation: BAG37048.1.
CR456704 mRNA. Translation: CAG32985.1.
AC025259 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58222.1.
CH471111 Genomic DNA. Translation: EAW58224.1.
CH471111 Genomic DNA. Translation: EAW58225.1.
BC016147 mRNA. Translation: AAH16147.1.
CCDSiCCDS55828.1. [P22736-2]
CCDS8818.1. [P22736-1]
PIRiA37251.
RefSeqiNP_001189162.1. NM_001202233.1. [P22736-2]
NP_002126.2. NM_002135.4. [P22736-1]
NP_775180.1. NM_173157.2. [P22736-1]
XP_005268881.1. XM_005268824.3. [P22736-1]
XP_006719426.1. XM_006719363.1. [P22736-1]
XP_006719427.1. XM_006719364.3. [P22736-1]
UniGeneiHs.524430.
Hs.670088.

Genome annotation databases

EnsembliENST00000243050; ENSP00000243050; ENSG00000123358. [P22736-1]
ENST00000360284; ENSP00000353427; ENSG00000123358. [P22736-2]
ENST00000394824; ENSP00000378301; ENSG00000123358. [P22736-1]
ENST00000394825; ENSP00000378302; ENSG00000123358. [P22736-1]
ENST00000548232; ENSP00000449587; ENSG00000123358. [P22736-3]
ENST00000550082; ENSP00000449539; ENSG00000123358. [P22736-2]
GeneIDi3164.
KEGGihsa:3164.
UCSCiuc001rzs.4. human. [P22736-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49728 mRNA. Translation: BAA08565.1.
L13740 mRNA. Translation: AAA36763.1.
D85245 mRNA. Translation: BAA12746.1.
AK297526 mRNA. Translation: BAG59929.1.
HQ692855 mRNA. Translation: ADZ17366.1.
AB307717 mRNA. Translation: BAH02308.1.
BT007144 mRNA. Translation: AAP35808.1.
AK314437 mRNA. Translation: BAG37048.1.
CR456704 mRNA. Translation: CAG32985.1.
AC025259 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58222.1.
CH471111 Genomic DNA. Translation: EAW58224.1.
CH471111 Genomic DNA. Translation: EAW58225.1.
BC016147 mRNA. Translation: AAH16147.1.
CCDSiCCDS55828.1. [P22736-2]
CCDS8818.1. [P22736-1]
PIRiA37251.
RefSeqiNP_001189162.1. NM_001202233.1. [P22736-2]
NP_002126.2. NM_002135.4. [P22736-1]
NP_775180.1. NM_173157.2. [P22736-1]
XP_005268881.1. XM_005268824.3. [P22736-1]
XP_006719426.1. XM_006719363.1. [P22736-1]
XP_006719427.1. XM_006719364.3. [P22736-1]
UniGeneiHs.524430.
Hs.670088.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QW4X-ray2.80A/B/C/D347-598[»]
3V3EX-ray2.06A/B351-598[»]
3V3QX-ray2.22A/B351-598[»]
4JGVX-ray3.01A/B351-598[»]
4KZIX-ray2.41A/B351-598[»]
4KZJX-ray2.12A/B351-598[»]
4KZMX-ray2.30A/B351-598[»]
4RE8X-ray2.16A/B351-598[»]
4REEX-ray2.37A/B351-598[»]
4REFX-ray2.10A/B351-598[»]
4RZEX-ray2.49A/B351-598[»]
4RZFX-ray1.99A/B351-598[»]
4RZGX-ray2.70A/B351-598[»]
4WHFX-ray2.27A/B351-598[»]
4WHGX-ray2.18A/B351-598[»]
ProteinModelPortaliP22736.
SMRiP22736.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109407. 100 interactors.
DIPiDIP-40392N.
IntActiP22736. 88 interactors.
MINTiMINT-2859679.
STRINGi9606.ENSP00000353427.

Chemistry databases

BindingDBiP22736.
ChEMBLiCHEMBL1293229.

PTM databases

iPTMnetiP22736.
PhosphoSitePlusiP22736.

Polymorphism and mutation databases

BioMutaiNR4A1.
DMDMi127819.

Proteomic databases

PaxDbiP22736.
PeptideAtlasiP22736.
PRIDEiP22736.

Protocols and materials databases

DNASUi3164.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243050; ENSP00000243050; ENSG00000123358. [P22736-1]
ENST00000360284; ENSP00000353427; ENSG00000123358. [P22736-2]
ENST00000394824; ENSP00000378301; ENSG00000123358. [P22736-1]
ENST00000394825; ENSP00000378302; ENSG00000123358. [P22736-1]
ENST00000548232; ENSP00000449587; ENSG00000123358. [P22736-3]
ENST00000550082; ENSP00000449539; ENSG00000123358. [P22736-2]
GeneIDi3164.
KEGGihsa:3164.
UCSCiuc001rzs.4. human. [P22736-1]

Organism-specific databases

CTDi3164.
DisGeNETi3164.
GeneCardsiNR4A1.
H-InvDBHIX0171621.
HGNCiHGNC:7980. NR4A1.
HPAiHPA059742.
MIMi139139. gene.
neXtProtiNX_P22736.
OpenTargetsiENSG00000123358.
PharmGKBiPA31761.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4217. Eukaryota.
ENOG410YWNC. LUCA.
GeneTreeiENSGT00760000118887.
HOGENOMiHOG000230925.
HOVERGENiHBG052663.
InParanoidiP22736.
KOiK04465.
PhylomeDBiP22736.
TreeFamiTF315430.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000123358-MONOMER.
ReactomeiR-HSA-198693. AKT phosphorylates targets in the nucleus.
R-HSA-383280. Nuclear Receptor transcription pathway.
R-HSA-5674400. Constitutive Signaling by AKT1 E17K in Cancer.
SignaLinkiP22736.
SIGNORiP22736.

Miscellaneous databases

ChiTaRSiNR4A1. human.
EvolutionaryTraceiP22736.
GeneWikiiNerve_Growth_factor_IB.
GenomeRNAii3164.
PROiP22736.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000123358.
CleanExiHS_NR4A1.
ExpressionAtlasiP22736. baseline and differential.
GenevisibleiP22736. HS.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR003071. Nuc_orp_HMR_rcpt.
IPR003070. Nuc_orph_rcpt.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01285. HMRNUCRECPTR.
PR01284. NUCLEARECPTR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNR4A1_HUMAN
AccessioniPrimary (citable) accession number: P22736
Secondary accession number(s): B4DML7
, Q15627, Q53Y00, Q6IBU8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: August 1, 1991
Last modified: November 2, 2016
This is version 186 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.