SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P22736

- NR4A1_HUMAN

UniProt

P22736 - NR4A1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear receptor subfamily 4 group A member 1

Gene
NR4A1, GFRP1, HMR, NAK1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' By similarity. May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi264 – 33976Nuclear receptorAdd
BLAST
Zinc fingeri267 – 28721NR C4-typeAdd
BLAST
Zinc fingeri303 – 32725NR C4-typeAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: BHF-UCL
  2. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: ProtInc
  3. protein binding Source: IntAct
  4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: Ensembl
  5. sequence-specific DNA binding Source: Ensembl
  6. steroid hormone receptor activity Source: InterPro
  7. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell migration involved in sprouting angiogenesis Source: BHF-UCL
  2. cellular response to fibroblast growth factor stimulus Source: BHF-UCL
  3. cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
  4. endothelial cell chemotaxis Source: BHF-UCL
  5. epidermal growth factor receptor signaling pathway Source: Reactome
  6. Fc-epsilon receptor signaling pathway Source: Reactome
  7. fibroblast growth factor receptor signaling pathway Source: Reactome
  8. gene expression Source: Reactome
  9. innate immune response Source: Reactome
  10. intracellular receptor signaling pathway Source: GOC
  11. negative regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
  12. neurotrophin TRK receptor signaling pathway Source: Reactome
  13. phosphatidylinositol-mediated signaling Source: Reactome
  14. positive regulation of apoptotic process Source: Ensembl
  15. positive regulation of endothelial cell proliferation Source: BHF-UCL
  16. signal transduction Source: ProtInc
  17. skeletal muscle cell differentiation Source: Ensembl
  18. transcription initiation from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12442. AKT phosphorylates targets in the nucleus.
REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
REACT_15525. Nuclear Receptor transcription pathway.
SignaLinkiP22736.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor subfamily 4 group A member 1
Alternative name(s):
Early response protein NAK1
Nuclear hormone receptor NUR/77
Short name:
Nur77
Orphan nuclear receptor HMR
Orphan nuclear receptor TR3
ST-59
Testicular receptor 3
Gene namesi
Name:NR4A1
Synonyms:GFRP1, HMR, NAK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:7980. NR4A1.

Subcellular locationi

Cytoplasm. Nucleus 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleoplasm Source: Reactome
  3. nucleus Source: BHF-UCL
  4. transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi595 – 5951T → E: Strongly weakens interaction with STK11. 1 Publication

Organism-specific databases

PharmGKBiPA31761.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598Nuclear receptor subfamily 4 group A member 1PRO_0000053715Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei341 – 3411Phosphoserine; by PKA By similarity
Modified residuei351 – 3511Phosphoserine2 Publications

Post-translational modificationi

Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli.1 Publication
Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP22736.
PaxDbiP22736.
PRIDEiP22736.

PTM databases

PhosphoSiteiP22736.

Expressioni

Tissue specificityi

Fetal muscle and adult liver, brain and thyroid.

Inductioni

By growth-stimulating agents.

Gene expression databases

ArrayExpressiP22736.
BgeeiP22736.
CleanExiHS_NR4A1.
GenevestigatoriP22736.

Organism-specific databases

HPAiHPA051230.

Interactioni

Subunit structurei

Binds DNA as a monomer By similarity. Interacts with GADD45GIP1. Interacts with STK11.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-721550,EBI-9028517From a different organism.
ANKIB1Q9P2G12EBI-721550,EBI-2687890
BCL2P104157EBI-721550,EBI-77694
CUTAO608882EBI-721550,EBI-1051556
GKP321893EBI-721550,EBI-3926629
MATR3P432432EBI-721550,EBI-352602
PLXND1Q9Y4D72EBI-721550,EBI-310731
STAT3P407633EBI-721550,EBI-518675
TP53P046376EBI-721550,EBI-366083
TUBB4AP043502EBI-721550,EBI-355007
VASPP505522EBI-721550,EBI-748201

Protein-protein interaction databases

BioGridi109407. 84 interactions.
DIPiDIP-40392N.
IntActiP22736. 81 interactions.
MINTiMINT-2859679.
STRINGi9606.ENSP00000243050.

Structurei

Secondary structure

1
598
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi363 – 37412
Helixi379 – 3813
Helixi400 – 41213
Helixi414 – 4229
Helixi427 – 4293
Helixi432 – 45423
Helixi457 – 4593
Beta strandi461 – 4633
Beta strandi467 – 4715
Helixi472 – 4798
Helixi482 – 49514
Helixi500 – 51112
Helixi521 – 54323
Helixi550 – 5567
Helixi558 – 57922
Helixi586 – 59510

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2QW4X-ray2.80A/B/C/D347-598[»]
3V3EX-ray2.06A/B351-598[»]
3V3QX-ray2.22A/B351-598[»]
4JGVX-ray3.01A/B351-598[»]
4KZIX-ray2.41A/B351-598[»]
4KZJX-ray2.12A/B351-598[»]
4KZMX-ray2.30A/B351-598[»]
ProteinModelPortaliP22736.
SMRiP22736. Positions 265-598.

Miscellaneous databases

EvolutionaryTraceiP22736.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni409 – 45951Ligand-binding Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi82 – 9211Poly-SerAdd
BLAST
Compositional biasi583 – 5864Poly-Pro

Sequence similaritiesi

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG245120.
HOGENOMiHOG000230925.
HOVERGENiHBG052663.
InParanoidiP22736.
KOiK04465.
OMAiFISIEAQ.
PhylomeDBiP22736.
TreeFamiTF315430.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR003071. Nuc_orp_HMR_rcpt.
IPR003070. Nuc_orph_rcpt.
IPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01285. HMRNUCRECPTR.
PR01284. NUCLEARECPTR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P22736-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPCIQAQYGT PAPSPGPRDH LASDPLTPEF IKPTMDLASP EAAPAAPTAL    50
PSFSTFMDGY TGEFDTFLYQ LPGTVQPCSS ASSSASSTSS SSATSPASAS 100
FKFEDFQVYG CYPGPLSGPV DEALSSSGSD YYGSPCSAPS PSTPSFQPPQ 150
LSPWDGSFGH FSPSQTYEGL RAWTEQLPKA SGPPQPPAFF SFSPPTGPSP 200
SLAQSPLKLF PSQATHQLGE GESYSMPTAF PGLAPTSPHL EGSGILDTPV 250
TSTKARSGAP GGSEGRCAVC GDNASCQHYG VRTCEGCKGF FKRTVQKNAK 300
YICLANKDCP VDKRRRNRCQ FCRFQKCLAV GMVKEVVRTD SLKGRRGRLP 350
SKPKQPPDAS PANLLTSLVR AHLDSGPSTA KLDYSKFQEL VLPHFGKEDA 400
GDVQQFYDLL SGSLEVIRKW AEKIPGFAEL SPADQDLLLE SAFLELFILR 450
LAYRSKPGEG KLIFCSGLVL HRLQCARGFG DWIDSILAFS RSLHSLLVDV 500
PAFACLSALV LITDRHGLQE PRRVEELQNR IASCLKEHVA AVAGEPQPAS 550
CLSRLLGKLP ELRTLCTQGL QRIFYLKLED LVPPPPIIDK IFMDTLPF 598
Length:598
Mass (Da):64,463
Last modified:August 1, 1991 - v1
Checksum:i41DAAEA7C25FDA22
GO
Isoform 2 (identifier: P22736-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLAKACWSIQSEM

Note: No experimental confirmation available.

Show »
Length:611
Mass (Da):65,998
Checksum:i21F3BC282AE6BE8D
GO
Isoform 3 (identifier: P22736-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     293-325: RTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQ → VPRSPRWGLLLEMERGWPHPIGTCGLPLGSPPS
     326-598: Missing.

Show »
Length:325
Mass (Da):33,754
Checksum:iBCF2490A32A09175
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti26 – 261L → V.
Corresponds to variant rs1882118 [ dbSNP | Ensembl ].
VAR_061534

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MWLAKACWSIQSEM in isoform 2. VSP_043086
Alternative sequencei293 – 32533RTVQK…FCRFQ → VPRSPRWGLLLEMERGWPHP IGTCGLPLGSPPS in isoform 3. VSP_047769Add
BLAST
Alternative sequencei326 – 598273Missing in isoform 3. VSP_047770Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti253 – 2531T → I1 Publication
Sequence conflicti262 – 2621G → P in AAA36763. 1 Publication
Sequence conflicti360 – 3601S → F in CAG32985. 1 Publication
Sequence conflicti370 – 3701R → L in AAA36763. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D49728 mRNA. Translation: BAA08565.1.
L13740 mRNA. Translation: AAA36763.1.
D85245 mRNA. Translation: BAA12746.1.
AK297526 mRNA. Translation: BAG59929.1.
HQ692855 mRNA. Translation: ADZ17366.1.
AB307717 mRNA. Translation: BAH02308.1.
BT007144 mRNA. Translation: AAP35808.1.
AK314437 mRNA. Translation: BAG37048.1.
CR456704 mRNA. Translation: CAG32985.1.
AC025259 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58222.1.
CH471111 Genomic DNA. Translation: EAW58224.1.
CH471111 Genomic DNA. Translation: EAW58225.1.
BC016147 mRNA. Translation: AAH16147.1.
CCDSiCCDS55828.1. [P22736-2]
CCDS8818.1. [P22736-1]
PIRiA37251.
RefSeqiNP_001189162.1. NM_001202233.1. [P22736-2]
NP_002126.2. NM_002135.4. [P22736-1]
NP_775180.1. NM_173157.2. [P22736-1]
XP_005268881.1. XM_005268824.2. [P22736-1]
XP_006719426.1. XM_006719363.1. [P22736-1]
XP_006719427.1. XM_006719364.1. [P22736-1]
UniGeneiHs.524430.
Hs.670088.

Genome annotation databases

EnsembliENST00000243050; ENSP00000243050; ENSG00000123358. [P22736-1]
ENST00000360284; ENSP00000353427; ENSG00000123358. [P22736-2]
ENST00000394824; ENSP00000378301; ENSG00000123358. [P22736-1]
ENST00000394825; ENSP00000378302; ENSG00000123358. [P22736-1]
ENST00000548232; ENSP00000449587; ENSG00000123358. [P22736-3]
ENST00000550082; ENSP00000449539; ENSG00000123358. [P22736-2]
GeneIDi3164.
KEGGihsa:3164.
UCSCiuc001rzr.2. human.
uc001rzs.3. human. [P22736-1]
uc010sno.2. human. [P22736-2]

Polymorphism databases

DMDMi127819.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D49728 mRNA. Translation: BAA08565.1 .
L13740 mRNA. Translation: AAA36763.1 .
D85245 mRNA. Translation: BAA12746.1 .
AK297526 mRNA. Translation: BAG59929.1 .
HQ692855 mRNA. Translation: ADZ17366.1 .
AB307717 mRNA. Translation: BAH02308.1 .
BT007144 mRNA. Translation: AAP35808.1 .
AK314437 mRNA. Translation: BAG37048.1 .
CR456704 mRNA. Translation: CAG32985.1 .
AC025259 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58222.1 .
CH471111 Genomic DNA. Translation: EAW58224.1 .
CH471111 Genomic DNA. Translation: EAW58225.1 .
BC016147 mRNA. Translation: AAH16147.1 .
CCDSi CCDS55828.1. [P22736-2 ]
CCDS8818.1. [P22736-1 ]
PIRi A37251.
RefSeqi NP_001189162.1. NM_001202233.1. [P22736-2 ]
NP_002126.2. NM_002135.4. [P22736-1 ]
NP_775180.1. NM_173157.2. [P22736-1 ]
XP_005268881.1. XM_005268824.2. [P22736-1 ]
XP_006719426.1. XM_006719363.1. [P22736-1 ]
XP_006719427.1. XM_006719364.1. [P22736-1 ]
UniGenei Hs.524430.
Hs.670088.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2QW4 X-ray 2.80 A/B/C/D 347-598 [» ]
3V3E X-ray 2.06 A/B 351-598 [» ]
3V3Q X-ray 2.22 A/B 351-598 [» ]
4JGV X-ray 3.01 A/B 351-598 [» ]
4KZI X-ray 2.41 A/B 351-598 [» ]
4KZJ X-ray 2.12 A/B 351-598 [» ]
4KZM X-ray 2.30 A/B 351-598 [» ]
ProteinModelPortali P22736.
SMRi P22736. Positions 265-598.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109407. 84 interactions.
DIPi DIP-40392N.
IntActi P22736. 81 interactions.
MINTi MINT-2859679.
STRINGi 9606.ENSP00000243050.

Chemistry

BindingDBi P22736.
ChEMBLi CHEMBL1293229.

PTM databases

PhosphoSitei P22736.

Polymorphism databases

DMDMi 127819.

Proteomic databases

MaxQBi P22736.
PaxDbi P22736.
PRIDEi P22736.

Protocols and materials databases

DNASUi 3164.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000243050 ; ENSP00000243050 ; ENSG00000123358 . [P22736-1 ]
ENST00000360284 ; ENSP00000353427 ; ENSG00000123358 . [P22736-2 ]
ENST00000394824 ; ENSP00000378301 ; ENSG00000123358 . [P22736-1 ]
ENST00000394825 ; ENSP00000378302 ; ENSG00000123358 . [P22736-1 ]
ENST00000548232 ; ENSP00000449587 ; ENSG00000123358 . [P22736-3 ]
ENST00000550082 ; ENSP00000449539 ; ENSG00000123358 . [P22736-2 ]
GeneIDi 3164.
KEGGi hsa:3164.
UCSCi uc001rzr.2. human.
uc001rzs.3. human. [P22736-1 ]
uc010sno.2. human. [P22736-2 ]

Organism-specific databases

CTDi 3164.
GeneCardsi GC12P052416.
H-InvDB HIX0171621.
HGNCi HGNC:7980. NR4A1.
HPAi HPA051230.
MIMi 139139. gene.
neXtProti NX_P22736.
PharmGKBi PA31761.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG245120.
HOGENOMi HOG000230925.
HOVERGENi HBG052663.
InParanoidi P22736.
KOi K04465.
OMAi FISIEAQ.
PhylomeDBi P22736.
TreeFami TF315430.

Enzyme and pathway databases

Reactomei REACT_12442. AKT phosphorylates targets in the nucleus.
REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
REACT_15525. Nuclear Receptor transcription pathway.
SignaLinki P22736.

Miscellaneous databases

ChiTaRSi NR4A1. human.
EvolutionaryTracei P22736.
GeneWikii Nerve_Growth_factor_IB.
GenomeRNAii 3164.
NextBioi 12546.
PROi P22736.
SOURCEi Search...

Gene expression databases

ArrayExpressi P22736.
Bgeei P22736.
CleanExi HS_NR4A1.
Genevestigatori P22736.

Family and domain databases

Gene3Di 1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProi IPR003071. Nuc_orp_HMR_rcpt.
IPR003070. Nuc_orph_rcpt.
IPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view ]
Pfami PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view ]
PRINTSi PR01285. HMRNUCRECPTR.
PR01284. NUCLEARECPTR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTi SM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view ]
SUPFAMi SSF48508. SSF48508. 1 hit.
PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A human early response gene homologous to murine nur77 and rat NGFI-B, and related to the nuclear receptor superfamily."
    Nakai A., Kartha S., Sakurai A., Toback F.G., Degroot L.J.
    Mol. Endocrinol. 4:1438-1443(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal skeletal muscle.
  2. "Isolation and characterization of human TR3 receptor: a member of steroid receptor superfamily."
    Chang C., Kokontis J., Liao S., Chang Y.
    J. Steroid Biochem. 34:391-395(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Identification of an isoform of human TR3 (NGFI-B, Nur77)."
    Ohkura N., Ito M., Tsukada T., Sasaki K., Yamaguchi K., Miki K.
    Submitted (MAY-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Skeletal muscle.
  4. "Comprehensive DNA-binding analysis of human hormone nuclear receptors by fluorescence correlation spectroscopy based on cell-free system."
    Kobayashi T., Kodani Y., Sawasaki T., Endo Y.
    Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  5. "Isolation of cDNA coding for multiple human nuclear receptor clones."
    Kaighin V.A., Martin A.L., Aronstam R.S.
    Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Trachea.
  8. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.
  12. "Phorbol ester, forskolin, and serum induction of a human colon nuclear hormone receptor gene related to the NUR 77/NGFI-B genes."
    Bondy G.P.
    Cell Growth Differ. 2:203-208(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 35-398 (ISOFORM 1).
    Tissue: Colon adenocarcinoma.
  13. "Negative cross-talk between the human orphan nuclear receptor Nur77/NAK-1/TR3 and nuclear factor-kappaB."
    Harant H., Lindley I.J.
    Nucleic Acids Res. 32:5280-5290(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  14. "CR6-interacting factor 1 interacts with orphan nuclear receptor Nur77 and inhibits its transactivation."
    Park K.C., Song K.-H., Chung H.K., Kim H., Kim D.W., Song J.H., Hwang E.S., Jung H.S., Park S.-H., Bae I., Lee I.K., Choi H.-S., Shong M.
    Mol. Endocrinol. 19:12-24(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GADD45GIP1.
  15. "RAS/ERK signaling promotes site-specific ribosomal protein S6 phosphorylation via RSK and stimulates cap-dependent translation."
    Roux P.P., Shahbazian D., Vu H., Holz M.K., Cohen M.S., Taunton J., Sonenberg N., Blenis J.
    J. Biol. Chem. 282:14056-14064(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-351.
  16. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-351, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. "Regulation of Nur77 protein turnover through acetylation and deacetylation induced by p300 and HDAC1."
    Kang S.A., Na H., Kang H.J., Kim S.H., Lee M.H., Lee M.O.
    Biochem. Pharmacol. 80:867-873(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION, SUBCELLULAR LOCATION.
  19. Cited for: X-RAY CRYSTALLOGRAPHY (2.06 ANGSTROMS) OF 351-598 ALONE AND IN COMPLEX WITH ANTAGONIST, FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11, MUTAGENESIS OF THR-595.

Entry informationi

Entry nameiNR4A1_HUMAN
AccessioniPrimary (citable) accession number: P22736
Secondary accession number(s): B4DML7
, Q15627, Q53Y00, Q6IBU8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: August 1, 1991
Last modified: September 3, 2014
This is version 162 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi