Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P22570

- ADRO_HUMAN

UniProt

P22570 - ADRO_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NADPH:adrenodoxin oxidoreductase, mitochondrial

Gene

FDXR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.

Catalytic activityi

2 reduced adrenodoxin + NADP+ = 2 oxidized adrenodoxin + NADPH.

Cofactori

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei49 – 491FAD; via amide nitrogenBy similarity
Binding sitei69 – 691FADBy similarity
Binding sitei77 – 771FAD; via amide nitrogenBy similarity
Binding sitei113 – 1131FAD; via amide nitrogen and carbonyl oxygenBy similarity
Binding sitei240 – 2401NADPBy similarity
Binding sitei398 – 3981FAD; via amide nitrogenBy similarity
Binding sitei405 – 4051NADP; via amide nitrogenBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi184 – 1874NADPBy similarity
Nucleotide bindingi228 – 2292NADPBy similarity
Nucleotide bindingi405 – 4073FADBy similarity

GO - Molecular functioni

  1. ferredoxin-NADP+ reductase activity Source: ProtInc
  2. NADPH-adrenodoxin reductase activity Source: Ensembl
  3. NADPH binding Source: Ensembl

GO - Biological processi

  1. cholesterol metabolic process Source: UniProtKB-UniPathway
  2. generation of precursor metabolites and energy Source: ProtInc
  3. NADPH oxidation Source: Ensembl
  4. oxidation-reduction process Source: ProtInc
  5. small molecule metabolic process Source: Reactome
  6. steroid biosynthetic process Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Cholesterol metabolism, Electron transport, Lipid metabolism, Steroid metabolism, Sterol metabolism, Transport

Keywords - Ligandi

FAD, Flavoprotein, NADP

Enzyme and pathway databases

BioCyciMetaCyc:HS08587-MONOMER.
ReactomeiREACT_11038. Pregnenolone biosynthesis.
REACT_13812. Endogenous sterols.
REACT_150128. Electron transport from NADPH to Ferredoxin.
UniPathwayiUPA00296.

Names & Taxonomyi

Protein namesi
Recommended name:
NADPH:adrenodoxin oxidoreductase, mitochondrial (EC:1.18.1.6)
Short name:
AR
Short name:
Adrenodoxin reductase
Alternative name(s):
Ferredoxin--NADP(+) reductase
Short name:
Ferredoxin reductase
Gene namesi
Name:FDXR
Synonyms:ADXR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:3642. FDXR.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrial inner membrane Source: Ensembl
  2. mitochondrial matrix Source: Reactome
  3. mitochondrion Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28086.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3232MitochondrionAdd
BLAST
Chaini33 – 491459NADPH:adrenodoxin oxidoreductase, mitochondrialPRO_0000019420Add
BLAST

Proteomic databases

MaxQBiP22570.
PaxDbiP22570.
PeptideAtlasiP22570.
PRIDEiP22570.

2D gel databases

REPRODUCTION-2DPAGEIPI00026958.

PTM databases

PhosphoSiteiP22570.

Expressioni

Gene expression databases

BgeeiP22570.
CleanExiHS_FDXR.
ExpressionAtlasiP22570. baseline and differential.
GenevestigatoriP22570.

Organism-specific databases

HPAiCAB008597.
HPA044393.

Interactioni

Subunit structurei

Monomer. Interacts directly with FDX1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
FHITP497894EBI-1751533,EBI-741760

Protein-protein interaction databases

BioGridi108523. 7 interactions.
IntActiP22570. 2 interactions.
STRINGi9606.ENSP00000293195.

Structurei

3D structure databases

ProteinModelPortaliP22570.
SMRiP22570. Positions 38-491.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0493.
GeneTreeiENSGT00390000013574.
HOGENOMiHOG000249250.
HOVERGENiHBG002132.
InParanoidiP22570.
KOiK00528.
OMAiFTTKEFR.
PhylomeDBiP22570.
TreeFamiTF314193.

Family and domain databases

Gene3Di3.40.50.720. 2 hits.
InterProiIPR021163. Adrenodoxin_Rdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PIRSFiPIRSF000362. FNR. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform Short (identifier: P22570-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASRCWRWWG WSAWPRTRLP PAGSTPSFCH HFSTQEKTPQ ICVVGSGPAG
60 70 80 90 100
FYTAQHLLKH PQAHVDIYEK QPVPFGLVRF GVAPDHPEVK NVINTFTQTA
110 120 130 140 150
HSGRCAFWGN VEVGRDVTVP ELREAYHAVV LSYGAEDHRA LEIPGEELPG
160 170 180 190 200
VCSARAFVGW YNGLPENQEL EPDLSCDTAV ILGQGNVALD VARILLTPPE
210 220 230 240 250
HLERTDITKA ALGVLRQSRV KTVWLVGRRG PLQVAFTIKE LREMIQLPGA
260 270 280 290 300
RPILDPVDFL GLQDKIKEVP RPRKRLTELL LRTATEKPGP AEAARQASAS
310 320 330 340 350
RAWGLRFFRS PQQVLPSPDG RRAAGVRLAV TRLEGVDEAT RAVPTGDMED
360 370 380 390 400
LPCGLVLSSI GYKSRPVDPS VPFDSKLGVI PNVEGRVMDV PGLYCSGWVK
410 420 430 440 450
RGPTGVIATT MTDSFLTGQM LLQDLKAGLL PSGPRPGYAA IQALLSSRGV
460 470 480 490
RPVSFSDWEK LDAEEVARGQ GTGKPREKLV DPQEMLRLLG H
Length:491
Mass (Da):53,837
Last modified:January 24, 2006 - v3
Checksum:i15D07E714F592C9D
GO
Isoform Long (identifier: P22570-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-203: E → EALLLCQ

Note: Represents 10-20% of all adrenodoxin reductase mRNAs and seems to be inactive.

Show »
Length:497
Mass (Da):54,479
Checksum:i08C3D3F2C86564DA
GO
Isoform 3 (identifier: P22570-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: K → KRVEALCSQPRVLNSPALSGEGEDLGASQPLSLDPTSCHPVPQQ

Show »
Length:534
Mass (Da):58,304
Checksum:i755B0612AAD29612
GO
Isoform 4 (identifier: P22570-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLK → MEDKDRE

Show »
Length:439
Mass (Da):48,056
Checksum:i20D88F1A91909900
GO
Isoform 5 (identifier: P22570-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-98: Missing.

Show »
Length:483
Mass (Da):52,919
Checksum:i8AD11CAC35C3E4C1
GO
Isoform 6 (identifier: P22570-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: K → KQ
     91-131: Missing.

Note: No experimental confirmation available.

Show »
Length:451
Mass (Da):49,425
Checksum:i367CE00CA673D9E2
GO
Isoform 7 (identifier: P22570-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-34: SFCHHFST → TFGGSDEVRDPANAKALRNKRRRMQVRVKLGKFQLLLDI

Note: No experimental confirmation available.

Show »
Length:522
Mass (Da):57,370
Checksum:i1D82107E5C08C814
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti223 – 2231V → G in BAG56748. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71R → L.1 Publication
Corresponds to variant rs28365947 [ dbSNP | Ensembl ].
VAR_025192
Natural varianti123 – 1231R → Q.3 Publications
Corresponds to variant rs690514 [ dbSNP | Ensembl ].
VAR_004624
Natural varianti213 – 2131G → V.1 Publication
Corresponds to variant rs35692345 [ dbSNP | Ensembl ].
VAR_025193
Natural varianti248 – 2481P → L.1 Publication
Corresponds to variant rs35072974 [ dbSNP | Ensembl ].
VAR_025194
Natural varianti251 – 2511R → W.1 Publication
Corresponds to variant rs34038065 [ dbSNP | Ensembl ].
VAR_025195
Natural varianti301 – 3011R → C.1 Publication
Corresponds to variant rs34118765 [ dbSNP | Ensembl ].
VAR_025196
Natural varianti345 – 3451T → M.1 Publication
Corresponds to variant rs35660143 [ dbSNP | Ensembl ].
VAR_025197
Natural varianti352 – 3521P → S.1 Publication
Corresponds to variant rs35696549 [ dbSNP | Ensembl ].
VAR_025198
Natural varianti472 – 4721T → A.1 Publication
Corresponds to variant rs35769464 [ dbSNP | Ensembl ].
VAR_025199

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5959MASRC…QHLLK → MEDKDRE in isoform 4. 1 PublicationVSP_046669Add
BLAST
Alternative sequencei27 – 348SFCHHFST → TFGGSDEVRDPANAKALRNK RRRMQVRVKLGKFQLLLDI in isoform 7. 1 PublicationVSP_046670
Alternative sequencei59 – 591K → KRVEALCSQPRVLNSPALSG EGEDLGASQPLSLDPTSCHP VPQQ in isoform 3. 1 PublicationVSP_045135
Alternative sequencei59 – 591K → KQ in isoform 6. 1 PublicationVSP_046671
Alternative sequencei91 – 13141Missing in isoform 6. 1 PublicationVSP_046672Add
BLAST
Alternative sequencei91 – 988Missing in isoform 5. 1 PublicationVSP_046673
Alternative sequencei203 – 2031E → EALLLCQ in isoform Long. 1 PublicationVSP_003416

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03826 mRNA. Translation: AAB59498.1.
J03826 mRNA. Translation: AAB59497.1.
M58509, M58508 Genomic DNA. Translation: AAA51668.1.
M58509, M58508 Genomic DNA. Translation: AAA51669.1.
DQ085780 Genomic DNA. Translation: AAY68215.1.
AK293208 mRNA. Translation: BAG56748.1.
AK295307 mRNA. Translation: BAG58287.1.
AK298908 mRNA. Translation: BAG61016.1.
AK301779 mRNA. Translation: BAG63236.1.
AK301977 mRNA. Translation: BAH13598.1.
AC068874 Genomic DNA. No translation available.
BC002960 mRNA. Translation: AAH02960.1.
CCDSiCCDS11707.1. [P22570-2]
CCDS58591.1. [P22570-4]
CCDS58592.1. [P22570-5]
CCDS58593.1. [P22570-1]
CCDS58594.1. [P22570-6]
CCDS58595.1. [P22570-3]
CCDS58596.1. [P22570-7]
PIRiA40487.
RefSeqiNP_001244941.1. NM_001258012.2. [P22570-3]
NP_001244942.1. NM_001258013.2. [P22570-7]
NP_001244943.1. NM_001258014.2. [P22570-5]
NP_001244944.1. NM_001258015.2. [P22570-6]
NP_001244945.1. NM_001258016.2. [P22570-4]
NP_004101.2. NM_004110.4. [P22570-2]
NP_077728.2. NM_024417.3. [P22570-1]
UniGeneiHs.69745.

Genome annotation databases

EnsembliENST00000293195; ENSP00000293195; ENSG00000161513.
ENST00000420580; ENSP00000414172; ENSG00000161513. [P22570-6]
ENST00000581530; ENSP00000462972; ENSG00000161513.
GeneIDi2232.
KEGGihsa:2232.
UCSCiuc002jlx.3. human. [P22570-2]
uc002jly.3. human. [P22570-1]
uc002jlz.3. human.
uc010wri.2. human.
uc010wrl.2. human.
uc010wrm.2. human.

Polymorphism databases

DMDMi85681283.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03826 mRNA. Translation: AAB59498.1 .
J03826 mRNA. Translation: AAB59497.1 .
M58509 , M58508 Genomic DNA. Translation: AAA51668.1 .
M58509 , M58508 Genomic DNA. Translation: AAA51669.1 .
DQ085780 Genomic DNA. Translation: AAY68215.1 .
AK293208 mRNA. Translation: BAG56748.1 .
AK295307 mRNA. Translation: BAG58287.1 .
AK298908 mRNA. Translation: BAG61016.1 .
AK301779 mRNA. Translation: BAG63236.1 .
AK301977 mRNA. Translation: BAH13598.1 .
AC068874 Genomic DNA. No translation available.
BC002960 mRNA. Translation: AAH02960.1 .
CCDSi CCDS11707.1. [P22570-2 ]
CCDS58591.1. [P22570-4 ]
CCDS58592.1. [P22570-5 ]
CCDS58593.1. [P22570-1 ]
CCDS58594.1. [P22570-6 ]
CCDS58595.1. [P22570-3 ]
CCDS58596.1. [P22570-7 ]
PIRi A40487.
RefSeqi NP_001244941.1. NM_001258012.2. [P22570-3 ]
NP_001244942.1. NM_001258013.2. [P22570-7 ]
NP_001244943.1. NM_001258014.2. [P22570-5 ]
NP_001244944.1. NM_001258015.2. [P22570-6 ]
NP_001244945.1. NM_001258016.2. [P22570-4 ]
NP_004101.2. NM_004110.4. [P22570-2 ]
NP_077728.2. NM_024417.3. [P22570-1 ]
UniGenei Hs.69745.

3D structure databases

ProteinModelPortali P22570.
SMRi P22570. Positions 38-491.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108523. 7 interactions.
IntActi P22570. 2 interactions.
STRINGi 9606.ENSP00000293195.

Chemistry

DrugBanki DB03147. Flavin adenine dinucleotide.

PTM databases

PhosphoSitei P22570.

Polymorphism databases

DMDMi 85681283.

2D gel databases

REPRODUCTION-2DPAGE IPI00026958.

Proteomic databases

MaxQBi P22570.
PaxDbi P22570.
PeptideAtlasi P22570.
PRIDEi P22570.

Protocols and materials databases

DNASUi 2232.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000293195 ; ENSP00000293195 ; ENSG00000161513 .
ENST00000420580 ; ENSP00000414172 ; ENSG00000161513 . [P22570-6 ]
ENST00000581530 ; ENSP00000462972 ; ENSG00000161513 .
GeneIDi 2232.
KEGGi hsa:2232.
UCSCi uc002jlx.3. human. [P22570-2 ]
uc002jly.3. human. [P22570-1 ]
uc002jlz.3. human.
uc010wri.2. human.
uc010wrl.2. human.
uc010wrm.2. human.

Organism-specific databases

CTDi 2232.
GeneCardsi GC17M072858.
HGNCi HGNC:3642. FDXR.
HPAi CAB008597.
HPA044393.
MIMi 103270. gene.
neXtProti NX_P22570.
PharmGKBi PA28086.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0493.
GeneTreei ENSGT00390000013574.
HOGENOMi HOG000249250.
HOVERGENi HBG002132.
InParanoidi P22570.
KOi K00528.
OMAi FTTKEFR.
PhylomeDBi P22570.
TreeFami TF314193.

Enzyme and pathway databases

UniPathwayi UPA00296 .
BioCyci MetaCyc:HS08587-MONOMER.
Reactomei REACT_11038. Pregnenolone biosynthesis.
REACT_13812. Endogenous sterols.
REACT_150128. Electron transport from NADPH to Ferredoxin.

Miscellaneous databases

GeneWikii Adrenodoxin_reductase.
GenomeRNAii 2232.
NextBioi 9037.
PROi P22570.
SOURCEi Search...

Gene expression databases

Bgeei P22570.
CleanExi HS_FDXR.
ExpressionAtlasi P22570. baseline and differential.
Genevestigatori P22570.

Family and domain databases

Gene3Di 3.40.50.720. 2 hits.
InterProi IPR021163. Adrenodoxin_Rdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view ]
PIRSFi PIRSF000362. FNR. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human adrenodoxin reductase: two mRNAs encoded by a single gene on chromosome 17cen-->q25 are expressed in steroidogenic tissues."
    Solish S.B., Picado-Leonard J., Morel Y., Kuhn R.W., Mohandas T.K., Hanukoglu I., Miller W.L.
    Proc. Natl. Acad. Sci. U.S.A. 85:7104-7108(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT AND LONG), VARIANT GLN-123.
  2. "Cloning and sequence of the human adrenodoxin reductase gene."
    Lin D., Shi Y., Miller W.L.
    Proc. Natl. Acad. Sci. U.S.A. 87:8516-8520(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. NIEHS SNPs program
    Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-7; GLN-123; VAL-213; LEU-248; TRP-251; CYS-301; MET-345; SER-352 AND ALA-472.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6 AND 7), VARIANT GLN-123.
    Tissue: Adrenal gland, Caudate nucleus and Testis.
  5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
    Tissue: Lung.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiADRO_HUMAN
AccessioniPrimary (citable) accession number: P22570
Secondary accession number(s): B4DDI7
, B4DHX5, B4DQQ4, B4DX24, B7Z7G2, E7EQC1, Q13716, Q4PJI0, Q9BU12
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: January 24, 2006
Last modified: November 26, 2014
This is version 152 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3