Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P22570

- ADRO_HUMAN

UniProt

P22570 - ADRO_HUMAN

Protein

NADPH:adrenodoxin oxidoreductase, mitochondrial

Gene

FDXR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 3 (24 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.

    Catalytic activityi

    2 reduced adrenodoxin + NADP+ = 2 oxidized adrenodoxin + NADPH.

    Cofactori

    FAD.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei49 – 491FAD; via amide nitrogenBy similarity
    Binding sitei69 – 691FADBy similarity
    Binding sitei77 – 771FAD; via amide nitrogenBy similarity
    Binding sitei113 – 1131FAD; via amide nitrogen and carbonyl oxygenBy similarity
    Binding sitei240 – 2401NADPBy similarity
    Binding sitei398 – 3981FAD; via amide nitrogenBy similarity
    Binding sitei405 – 4051NADP; via amide nitrogenBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi184 – 1874NADPBy similarity
    Nucleotide bindingi228 – 2292NADPBy similarity
    Nucleotide bindingi405 – 4073FADBy similarity

    GO - Molecular functioni

    1. ferredoxin-NADP+ reductase activity Source: ProtInc
    2. NADPH-adrenodoxin reductase activity Source: Ensembl
    3. NADPH binding Source: Ensembl
    4. protein binding Source: IntAct

    GO - Biological processi

    1. cholesterol metabolic process Source: UniProtKB-UniPathway
    2. generation of precursor metabolites and energy Source: ProtInc
    3. NADPH oxidation Source: Ensembl
    4. oxidation-reduction process Source: ProtInc
    5. small molecule metabolic process Source: Reactome
    6. steroid biosynthetic process Source: ProtInc

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Cholesterol metabolism, Electron transport, Lipid metabolism, Steroid metabolism, Sterol metabolism, Transport

    Keywords - Ligandi

    FAD, Flavoprotein, NADP

    Enzyme and pathway databases

    BioCyciMetaCyc:HS08587-MONOMER.
    ReactomeiREACT_150128. Electron transport from NADPH to Ferredoxin.
    UniPathwayiUPA00296.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NADPH:adrenodoxin oxidoreductase, mitochondrial (EC:1.18.1.6)
    Short name:
    AR
    Short name:
    Adrenodoxin reductase
    Alternative name(s):
    Ferredoxin--NADP(+) reductase
    Short name:
    Ferredoxin reductase
    Gene namesi
    Name:FDXR
    Synonyms:ADXR
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:3642. FDXR.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrial inner membrane Source: Ensembl
    2. mitochondrial matrix Source: Reactome
    3. mitochondrion Source: HPA

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28086.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 3232MitochondrionAdd
    BLAST
    Chaini33 – 491459NADPH:adrenodoxin oxidoreductase, mitochondrialPRO_0000019420Add
    BLAST

    Proteomic databases

    MaxQBiP22570.
    PaxDbiP22570.
    PeptideAtlasiP22570.
    PRIDEiP22570.

    2D gel databases

    REPRODUCTION-2DPAGEIPI00026958.

    PTM databases

    PhosphoSiteiP22570.

    Expressioni

    Gene expression databases

    ArrayExpressiP22570.
    BgeeiP22570.
    CleanExiHS_FDXR.
    GenevestigatoriP22570.

    Organism-specific databases

    HPAiCAB008597.
    HPA044393.

    Interactioni

    Subunit structurei

    Monomer. Interacts directly with FDX1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    FHITP497894EBI-1751533,EBI-741760

    Protein-protein interaction databases

    BioGridi108523. 2 interactions.
    IntActiP22570. 2 interactions.
    STRINGi9606.ENSP00000293195.

    Structurei

    3D structure databases

    ProteinModelPortaliP22570.
    SMRiP22570. Positions 38-491.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0493.
    HOGENOMiHOG000249250.
    HOVERGENiHBG002132.
    InParanoidiP22570.
    KOiK00528.
    OMAiFTTKEFR.
    PhylomeDBiP22570.
    TreeFamiTF314193.

    Family and domain databases

    Gene3Di3.40.50.720. 2 hits.
    InterProiIPR021163. Adrenodoxin_Rdtase.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view]
    PIRSFiPIRSF000362. FNR. 1 hit.

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform Short (identifier: P22570-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASRCWRWWG WSAWPRTRLP PAGSTPSFCH HFSTQEKTPQ ICVVGSGPAG    50
    FYTAQHLLKH PQAHVDIYEK QPVPFGLVRF GVAPDHPEVK NVINTFTQTA 100
    HSGRCAFWGN VEVGRDVTVP ELREAYHAVV LSYGAEDHRA LEIPGEELPG 150
    VCSARAFVGW YNGLPENQEL EPDLSCDTAV ILGQGNVALD VARILLTPPE 200
    HLERTDITKA ALGVLRQSRV KTVWLVGRRG PLQVAFTIKE LREMIQLPGA 250
    RPILDPVDFL GLQDKIKEVP RPRKRLTELL LRTATEKPGP AEAARQASAS 300
    RAWGLRFFRS PQQVLPSPDG RRAAGVRLAV TRLEGVDEAT RAVPTGDMED 350
    LPCGLVLSSI GYKSRPVDPS VPFDSKLGVI PNVEGRVMDV PGLYCSGWVK 400
    RGPTGVIATT MTDSFLTGQM LLQDLKAGLL PSGPRPGYAA IQALLSSRGV 450
    RPVSFSDWEK LDAEEVARGQ GTGKPREKLV DPQEMLRLLG H 491
    Length:491
    Mass (Da):53,837
    Last modified:January 24, 2006 - v3
    Checksum:i15D07E714F592C9D
    GO
    Isoform Long (identifier: P22570-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         203-203: E → EALLLCQ

    Note: Represents 10-20% of all adrenodoxin reductase mRNAs and seems to be inactive.

    Show »
    Length:497
    Mass (Da):54,479
    Checksum:i08C3D3F2C86564DA
    GO
    Isoform 3 (identifier: P22570-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: K → KRVEALCSQPRVLNSPALSGEGEDLGASQPLSLDPTSCHPVPQQ

    Show »
    Length:534
    Mass (Da):58,304
    Checksum:i755B0612AAD29612
    GO
    Isoform 4 (identifier: P22570-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-59: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLK → MEDKDRE

    Show »
    Length:439
    Mass (Da):48,056
    Checksum:i20D88F1A91909900
    GO
    Isoform 5 (identifier: P22570-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         91-98: Missing.

    Show »
    Length:483
    Mass (Da):52,919
    Checksum:i8AD11CAC35C3E4C1
    GO
    Isoform 6 (identifier: P22570-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: K → KQ
         91-131: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:451
    Mass (Da):49,425
    Checksum:i367CE00CA673D9E2
    GO
    Isoform 7 (identifier: P22570-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         27-34: SFCHHFST → TFGGSDEVRDPANAKALRNKRRRMQVRVKLGKFQLLLDI

    Note: No experimental confirmation available.

    Show »
    Length:522
    Mass (Da):57,370
    Checksum:i1D82107E5C08C814
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti223 – 2231V → G in BAG56748. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti7 – 71R → L.1 Publication
    Corresponds to variant rs28365947 [ dbSNP | Ensembl ].
    VAR_025192
    Natural varianti123 – 1231R → Q.3 Publications
    Corresponds to variant rs690514 [ dbSNP | Ensembl ].
    VAR_004624
    Natural varianti213 – 2131G → V.1 Publication
    Corresponds to variant rs35692345 [ dbSNP | Ensembl ].
    VAR_025193
    Natural varianti248 – 2481P → L.1 Publication
    Corresponds to variant rs35072974 [ dbSNP | Ensembl ].
    VAR_025194
    Natural varianti251 – 2511R → W.1 Publication
    Corresponds to variant rs34038065 [ dbSNP | Ensembl ].
    VAR_025195
    Natural varianti301 – 3011R → C.1 Publication
    Corresponds to variant rs34118765 [ dbSNP | Ensembl ].
    VAR_025196
    Natural varianti345 – 3451T → M.1 Publication
    Corresponds to variant rs35660143 [ dbSNP | Ensembl ].
    VAR_025197
    Natural varianti352 – 3521P → S.1 Publication
    Corresponds to variant rs35696549 [ dbSNP | Ensembl ].
    VAR_025198
    Natural varianti472 – 4721T → A.1 Publication
    Corresponds to variant rs35769464 [ dbSNP | Ensembl ].
    VAR_025199

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5959MASRC…QHLLK → MEDKDRE in isoform 4. 1 PublicationVSP_046669Add
    BLAST
    Alternative sequencei27 – 348SFCHHFST → TFGGSDEVRDPANAKALRNK RRRMQVRVKLGKFQLLLDI in isoform 7. 1 PublicationVSP_046670
    Alternative sequencei59 – 591K → KRVEALCSQPRVLNSPALSG EGEDLGASQPLSLDPTSCHP VPQQ in isoform 3. 1 PublicationVSP_045135
    Alternative sequencei59 – 591K → KQ in isoform 6. 1 PublicationVSP_046671
    Alternative sequencei91 – 13141Missing in isoform 6. 1 PublicationVSP_046672Add
    BLAST
    Alternative sequencei91 – 988Missing in isoform 5. 1 PublicationVSP_046673
    Alternative sequencei203 – 2031E → EALLLCQ in isoform Long. 1 PublicationVSP_003416

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03826 mRNA. Translation: AAB59498.1.
    J03826 mRNA. Translation: AAB59497.1.
    M58509, M58508 Genomic DNA. Translation: AAA51668.1.
    M58509, M58508 Genomic DNA. Translation: AAA51669.1.
    DQ085780 Genomic DNA. Translation: AAY68215.1.
    AK293208 mRNA. Translation: BAG56748.1.
    AK295307 mRNA. Translation: BAG58287.1.
    AK298908 mRNA. Translation: BAG61016.1.
    AK301779 mRNA. Translation: BAG63236.1.
    AK301977 mRNA. Translation: BAH13598.1.
    AC068874 Genomic DNA. No translation available.
    BC002960 mRNA. Translation: AAH02960.1.
    CCDSiCCDS11707.1. [P22570-2]
    CCDS58591.1. [P22570-4]
    CCDS58592.1. [P22570-5]
    CCDS58593.1. [P22570-1]
    CCDS58594.1. [P22570-6]
    CCDS58595.1. [P22570-3]
    CCDS58596.1. [P22570-7]
    PIRiA40487.
    RefSeqiNP_001244941.1. NM_001258012.2. [P22570-3]
    NP_001244942.1. NM_001258013.2. [P22570-7]
    NP_001244943.1. NM_001258014.2. [P22570-5]
    NP_001244944.1. NM_001258015.2. [P22570-6]
    NP_001244945.1. NM_001258016.2. [P22570-4]
    NP_004101.2. NM_004110.4. [P22570-2]
    NP_077728.2. NM_024417.3. [P22570-1]
    UniGeneiHs.69745.

    Genome annotation databases

    EnsembliENST00000293195; ENSP00000293195; ENSG00000161513. [P22570-1]
    ENST00000413947; ENSP00000408595; ENSG00000161513. [P22570-7]
    ENST00000420580; ENSP00000414172; ENSG00000161513. [P22570-6]
    ENST00000442102; ENSP00000416515; ENSG00000161513. [P22570-3]
    ENST00000544854; ENSP00000445432; ENSG00000161513. [P22570-4]
    ENST00000581530; ENSP00000462972; ENSG00000161513. [P22570-2]
    ENST00000582944; ENSP00000462183; ENSG00000161513. [P22570-5]
    GeneIDi2232.
    KEGGihsa:2232.
    UCSCiuc002jlx.3. human. [P22570-2]
    uc002jly.3. human. [P22570-1]
    uc010wrl.2. human.

    Polymorphism databases

    DMDMi85681283.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03826 mRNA. Translation: AAB59498.1 .
    J03826 mRNA. Translation: AAB59497.1 .
    M58509 , M58508 Genomic DNA. Translation: AAA51668.1 .
    M58509 , M58508 Genomic DNA. Translation: AAA51669.1 .
    DQ085780 Genomic DNA. Translation: AAY68215.1 .
    AK293208 mRNA. Translation: BAG56748.1 .
    AK295307 mRNA. Translation: BAG58287.1 .
    AK298908 mRNA. Translation: BAG61016.1 .
    AK301779 mRNA. Translation: BAG63236.1 .
    AK301977 mRNA. Translation: BAH13598.1 .
    AC068874 Genomic DNA. No translation available.
    BC002960 mRNA. Translation: AAH02960.1 .
    CCDSi CCDS11707.1. [P22570-2 ]
    CCDS58591.1. [P22570-4 ]
    CCDS58592.1. [P22570-5 ]
    CCDS58593.1. [P22570-1 ]
    CCDS58594.1. [P22570-6 ]
    CCDS58595.1. [P22570-3 ]
    CCDS58596.1. [P22570-7 ]
    PIRi A40487.
    RefSeqi NP_001244941.1. NM_001258012.2. [P22570-3 ]
    NP_001244942.1. NM_001258013.2. [P22570-7 ]
    NP_001244943.1. NM_001258014.2. [P22570-5 ]
    NP_001244944.1. NM_001258015.2. [P22570-6 ]
    NP_001244945.1. NM_001258016.2. [P22570-4 ]
    NP_004101.2. NM_004110.4. [P22570-2 ]
    NP_077728.2. NM_024417.3. [P22570-1 ]
    UniGenei Hs.69745.

    3D structure databases

    ProteinModelPortali P22570.
    SMRi P22570. Positions 38-491.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108523. 2 interactions.
    IntActi P22570. 2 interactions.
    STRINGi 9606.ENSP00000293195.

    PTM databases

    PhosphoSitei P22570.

    Polymorphism databases

    DMDMi 85681283.

    2D gel databases

    REPRODUCTION-2DPAGE IPI00026958.

    Proteomic databases

    MaxQBi P22570.
    PaxDbi P22570.
    PeptideAtlasi P22570.
    PRIDEi P22570.

    Protocols and materials databases

    DNASUi 2232.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000293195 ; ENSP00000293195 ; ENSG00000161513 . [P22570-1 ]
    ENST00000413947 ; ENSP00000408595 ; ENSG00000161513 . [P22570-7 ]
    ENST00000420580 ; ENSP00000414172 ; ENSG00000161513 . [P22570-6 ]
    ENST00000442102 ; ENSP00000416515 ; ENSG00000161513 . [P22570-3 ]
    ENST00000544854 ; ENSP00000445432 ; ENSG00000161513 . [P22570-4 ]
    ENST00000581530 ; ENSP00000462972 ; ENSG00000161513 . [P22570-2 ]
    ENST00000582944 ; ENSP00000462183 ; ENSG00000161513 . [P22570-5 ]
    GeneIDi 2232.
    KEGGi hsa:2232.
    UCSCi uc002jlx.3. human. [P22570-2 ]
    uc002jly.3. human. [P22570-1 ]
    uc010wrl.2. human.

    Organism-specific databases

    CTDi 2232.
    GeneCardsi GC17M072858.
    HGNCi HGNC:3642. FDXR.
    HPAi CAB008597.
    HPA044393.
    MIMi 103270. gene.
    neXtProti NX_P22570.
    PharmGKBi PA28086.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0493.
    HOGENOMi HOG000249250.
    HOVERGENi HBG002132.
    InParanoidi P22570.
    KOi K00528.
    OMAi FTTKEFR.
    PhylomeDBi P22570.
    TreeFami TF314193.

    Enzyme and pathway databases

    UniPathwayi UPA00296 .
    BioCyci MetaCyc:HS08587-MONOMER.
    Reactomei REACT_150128. Electron transport from NADPH to Ferredoxin.

    Miscellaneous databases

    GeneWikii Adrenodoxin_reductase.
    GenomeRNAii 2232.
    NextBioi 9037.
    PROi P22570.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P22570.
    Bgeei P22570.
    CleanExi HS_FDXR.
    Genevestigatori P22570.

    Family and domain databases

    Gene3Di 3.40.50.720. 2 hits.
    InterProi IPR021163. Adrenodoxin_Rdtase.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view ]
    PIRSFi PIRSF000362. FNR. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human adrenodoxin reductase: two mRNAs encoded by a single gene on chromosome 17cen-->q25 are expressed in steroidogenic tissues."
      Solish S.B., Picado-Leonard J., Morel Y., Kuhn R.W., Mohandas T.K., Hanukoglu I., Miller W.L.
      Proc. Natl. Acad. Sci. U.S.A. 85:7104-7108(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT AND LONG), VARIANT GLN-123.
    2. "Cloning and sequence of the human adrenodoxin reductase gene."
      Lin D., Shi Y., Miller W.L.
      Proc. Natl. Acad. Sci. U.S.A. 87:8516-8520(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. NIEHS SNPs program
      Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-7; GLN-123; VAL-213; LEU-248; TRP-251; CYS-301; MET-345; SER-352 AND ALA-472.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6 AND 7), VARIANT GLN-123.
      Tissue: Adrenal gland, Caudate nucleus and Testis.
    5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
      Tissue: Lung.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiADRO_HUMAN
    AccessioniPrimary (citable) accession number: P22570
    Secondary accession number(s): B4DDI7
    , B4DHX5, B4DQQ4, B4DX24, B7Z7G2, E7EQC1, Q13716, Q4PJI0, Q9BU12
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1991
    Last sequence update: January 24, 2006
    Last modified: October 1, 2014
    This is version 150 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3