Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P22462

- KCNC2_RAT

UniProt

P22462 - KCNC2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Potassium voltage-gated channel subfamily C member 2

Gene

Kcnc2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Channel properties are modulated by subunit assembly.

GO - Molecular functioni

  1. delayed rectifier potassium channel activity Source: RefGenome

GO - Biological processi

  1. action potential Source: Ensembl
  2. protein homooligomerization Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

ReactomeiREACT_199159. Voltage gated Potassium channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily C member 2
Alternative name(s):
KSHIIIA
Voltage-gated potassium channel subunit Kv3.2
Gene namesi
Name:Kcnc2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 7

Organism-specific databases

RGDi628829. Kcnc2.

Subcellular locationi

GO - Cellular componenti

  1. voltage-gated potassium channel complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 638638Potassium voltage-gated channel subfamily C member 2PRO_0000054054Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi266 – 2661N-linked (GlcNAc...)Sequence Analysis
Modified residuei564 – 5641Phosphoserine; by PKASequence Analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP22462.

Expressioni

Gene expression databases

GenevestigatoriP22462.

Interactioni

Subunit structurei

The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming subunits that can associate with modulating accessory subunits. Interacts with KCNC1, KCNE1, KCNE2 and KCNE3.1 Publication

Protein-protein interaction databases

BioGridi251521. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP22462.
SMRiP22462. Positions 101-160.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 229229CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini304 – 31411CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini369 – 38113CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini474 – 638165CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei230 – 24819Helical; Name=Segment S1Sequence AnalysisAdd
BLAST
Transmembranei284 – 30320Helical; Name=Segment S2Sequence AnalysisAdd
BLAST
Transmembranei315 – 33723Helical; Name=Segment S3Sequence AnalysisAdd
BLAST
Transmembranei346 – 36823Helical; Voltage-sensor; Name=Segment S4Sequence AnalysisAdd
BLAST
Transmembranei382 – 40120Helical; Name=Segment S5Sequence AnalysisAdd
BLAST
Transmembranei451 – 47323Helical; Name=Segment S6Sequence AnalysisAdd
BLAST

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi437 – 4426Selectivity filterBy similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi56 – 9944Gly/Pro-rich (insert)Add
BLAST

Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00760000118846.
HOGENOMiHOG000231012.
HOVERGENiHBG105862.
InParanoidiP22462.
KOiK04888.
OMAiMCLGKDN.
OrthoDBiEOG7CRTPP.
PhylomeDBiP22462.
TreeFamiTF352511.

Family and domain databases

Gene3Di1.20.120.350. 1 hit.
3.30.710.10. 2 hits.
InterProiIPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003968. K_chnl_volt-dep_Kv.
IPR003974. K_chnl_volt-dep_Kv3.
IPR003131. T1-type_BTB.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiPF02214. BTB_2. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR00169. KCHANNEL.
PR01491. KVCHANNEL.
PR01498. SHAWCHANNEL.
SMARTiSM00225. BTB. 1 hit.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 2 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform KV3.2B (identifier: P22462-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKIENNERV ILNVGGTRHE TYRSTLKTLP GTRLALLASS EPQGDCLTAA
60 70 80 90 100
GDKLQPLPPP LSPPPRPPPL SPVPSGCFEG GAGNCSSHGG NGSDHPGGGR
110 120 130 140 150
EFFFDRHPGV FAYVLNYYRT GKLHCPADVC GPLFEEELAF WGIDETDVEP
160 170 180 190 200
CCWMTYRQHR DAEEALDIFE TPDLIGGDPG DDEDLGGKRL GIEDAAGLGG
210 220 230 240 250
PDGKSGRWRK LQPRMWALFE DPYSSRAARF IAFASLFFIL VSITTFCLET
260 270 280 290 300
HEAFNIVKNK TEPVINGTSA VLQYEIETDP ALTYVEGVCV VWFTFEFLVR
310 320 330 340 350
IVFSPNKLEF IKNLLNIIDF VAILPFYLEV GLSGLSSKAA KDVLGFLRVV
360 370 380 390 400
RFVRILRIFK LTRHFVGLRV LGHTLRASTN EFLLLIIFLA LGVLIFATMI
410 420 430 440 450
YYAERVGAQP NDPSASEHTQ FKNIPIGFWW AVVTMTTLGY GDMYPQTWSG
460 470 480 490 500
MLVGALCALA GVLTIAMPVP VIVNNFGMYY SLAMAKQKLP RKRKKHIPPA
510 520 530 540 550
PLASSPTFCK TELNMACNST QSDTCLGKEN RLLEHNRSVL SGDDSTGSEP
560 570 580 590 600
PLSPPERLPI RRSSTRDKNR RGETCFLLTT GDYTCASDGG IRKGYEKSRS
610 620 630
LNNIAGLAGN ALRLSPVTSP YNSPCPLRRS RSPIPSIL
Length:638
Mass (Da):70,191
Last modified:August 1, 1991 - v1
Checksum:i25C102B4CCE53BF4
GO
Isoform KV3.2C (identifier: P22462-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNN...RSRSPIPSIL → ASTLEPMEST...CPTGSSFPTL

Show »
Length:635
Mass (Da):69,887
Checksum:i3F3D0386C5EC0C23
GO
Isoform KSHIIIA.1 (identifier: P22462-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL → DNCKDVVITGYTQAEARSLT

Show »
Length:613
Mass (Da):67,551
Checksum:iEA2E740D2E95F7E1
GO
Isoform GT10 (identifier: P22462-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNN...RSRSPIPSIL → VLYRIYHGFLPAENGTLRFSHSKDCTGNFCY

Show »
Length:624
Mass (Da):68,976
Checksum:iA29A2E25DC33E99A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21G → S in CAA44643. (PubMed:1378392)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei594 – 63845GYEKS…IPSIL → VLYRIYHGFLPAENGTLRFS HSKDCTGNFCY in isoform GT10. 1 PublicationVSP_001020Add
BLAST
Alternative sequencei594 – 63845GYEKS…IPSIL → DNCKDVVITGYTQAEARSLT in isoform KSHIIIA.1. 1 PublicationVSP_001019Add
BLAST
Alternative sequencei594 – 63845GYEKS…IPSIL → ASTLEPMESTSQTKGDTRPE AHWNCAHLLNFGCPTGSSFP TL in isoform KV3.2C. 1 PublicationVSP_001018Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M59211 mRNA. Translation: AAA41819.1.
M59313 mRNA. Translation: AAA41820.1. Sequence problems.
M84203 mRNA. Translation: AAA42143.1.
M34052 mRNA. Translation: AAA42142.1.
X62839 mRNA. Translation: CAA44643.1.
PIRiA39402.
B45292.
S22703.
RefSeqiNP_631962.1. NM_139216.1. [P22462-3]
NP_631963.1. NM_139217.1. [P22462-1]
XP_006241389.1. XM_006241327.2. [P22462-1]
UniGeneiRn.9733.

Genome annotation databases

EnsembliENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. [P22462-3]
ENSRNOT00000005700; ENSRNOP00000005700; ENSRNOG00000004077. [P22462-4]
ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. [P22462-1]
ENSRNOT00000049943; ENSRNOP00000049641; ENSRNOG00000004077. [P22462-2]
GeneIDi246153.
KEGGirno:246153.
UCSCiRGD:628829. rat. [P22462-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M59211 mRNA. Translation: AAA41819.1 .
M59313 mRNA. Translation: AAA41820.1 . Sequence problems.
M84203 mRNA. Translation: AAA42143.1 .
M34052 mRNA. Translation: AAA42142.1 .
X62839 mRNA. Translation: CAA44643.1 .
PIRi A39402.
B45292.
S22703.
RefSeqi NP_631962.1. NM_139216.1. [P22462-3 ]
NP_631963.1. NM_139217.1. [P22462-1 ]
XP_006241389.1. XM_006241327.2. [P22462-1 ]
UniGenei Rn.9733.

3D structure databases

ProteinModelPortali P22462.
SMRi P22462. Positions 101-160.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 251521. 1 interaction.

Chemistry

GuidetoPHARMACOLOGYi 549.

Proteomic databases

PaxDbi P22462.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000005690 ; ENSRNOP00000005690 ; ENSRNOG00000004077 . [P22462-3 ]
ENSRNOT00000005700 ; ENSRNOP00000005700 ; ENSRNOG00000004077 . [P22462-4 ]
ENSRNOT00000005773 ; ENSRNOP00000005773 ; ENSRNOG00000004077 . [P22462-1 ]
ENSRNOT00000049943 ; ENSRNOP00000049641 ; ENSRNOG00000004077 . [P22462-2 ]
GeneIDi 246153.
KEGGi rno:246153.
UCSCi RGD:628829. rat. [P22462-1 ]

Organism-specific databases

CTDi 3747.
RGDi 628829. Kcnc2.

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00760000118846.
HOGENOMi HOG000231012.
HOVERGENi HBG105862.
InParanoidi P22462.
KOi K04888.
OMAi MCLGKDN.
OrthoDBi EOG7CRTPP.
PhylomeDBi P22462.
TreeFami TF352511.

Enzyme and pathway databases

Reactomei REACT_199159. Voltage gated Potassium channels.

Miscellaneous databases

NextBioi 623450.
PROi P22462.

Gene expression databases

Genevestigatori P22462.

Family and domain databases

Gene3Di 1.20.120.350. 1 hit.
3.30.710.10. 2 hits.
InterProi IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003968. K_chnl_volt-dep_Kv.
IPR003974. K_chnl_volt-dep_Kv3.
IPR003131. T1-type_BTB.
IPR028325. VG_K_chnl.
[Graphical view ]
PANTHERi PTHR11537. PTHR11537. 1 hit.
Pfami PF02214. BTB_2. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view ]
PRINTSi PR00169. KCHANNEL.
PR01491. KVCHANNEL.
PR01498. SHAWCHANNEL.
SMARTi SM00225. BTB. 1 hit.
[Graphical view ]
SUPFAMi SSF54695. SSF54695. 2 hits.
ProtoNeti Search...

Publicationsi

  1. "Shaw-like rat brain potassium channel cDNA's with divergent 3' ends."
    Luneau C.J., Wiedmann R., Smith J.S., Williams J.B.
    FEBS Lett. 288:163-167(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KV3.2B AND KV3.2C).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KV3.2B).
  3. "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
    McCormack T., de Miera E.C.V.-S., Rudy B.
    Proc. Natl. Acad. Sci. U.S.A. 87:5227-5231(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KSHIIIA.1).
    Tissue: Brain.
  4. "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
    McCormack T., de Miera E.C.V.-S., Rudy B.
    Proc. Natl. Acad. Sci. U.S.A. 88:4060-4060(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  5. "Characterization of a Shaw-related potassium channel family in rat brain."
    Rettig J., Wunder F., Stocker M., Lichtinghagen R., Mastiaux F., Beckh S., Kues W., Pedarzani P., Schroeter K.H., Ruppersberg J.P., Veh R., Pongs O.
    EMBO J. 11:2473-2486(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GT10).
  6. "MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating."
    Lewis A., McCrossan Z.A., Abbott G.W.
    J. Biol. Chem. 279:7884-7892(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KCNC1; KCNE1; KCNE2 AND KCNE3.

Entry informationi

Entry nameiKCNC2_RAT
AccessioniPrimary (citable) accession number: P22462
Secondary accession number(s): P22461, P22463, Q63735
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: August 1, 1991
Last modified: October 29, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3