Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P22462 (KCNC2_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 124. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Potassium voltage-gated channel subfamily C member 2
Alternative name(s):
KSHIIIA
Voltage-gated potassium channel subunit Kv3.2
Gene names
Name:Kcnc2
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length638 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Channel properties are modulated by subunit assembly.

Subunit structure

The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming subunits that can associate with modulating accessory subunits. Interacts with KCNC1, KCNE1, KCNE2 and KCNE3. Ref.6

Subcellular location

Membrane; Multi-pass membrane protein.

Domain

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.

The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.

Sequence similarities

Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.2/KCNC2 sub-subfamily. [View classification]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform KV3.2B (identifier: P22462-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform KV3.2C (identifier: P22462-2)

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNN...RSRSPIPSIL → ASTLEPMEST...CPTGSSFPTL
Isoform KSHIIIA.1 (identifier: P22462-3)

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL → DNCKDVVITGYTQAEARSLT
Isoform GT10 (identifier: P22462-4)

The sequence of this isoform differs from the canonical sequence as follows:
     594-638: GYEKSRSLNN...RSRSPIPSIL → VLYRIYHGFLPAENGTLRFSHSKDCTGNFCY

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 638638Potassium voltage-gated channel subfamily C member 2
PRO_0000054054

Regions

Topological domain1 – 229229Cytoplasmic Potential
Transmembrane230 – 24819Helical; Name=Segment S1; Potential
Transmembrane284 – 30320Helical; Name=Segment S2; Potential
Topological domain304 – 31411Cytoplasmic Potential
Transmembrane315 – 33723Helical; Name=Segment S3; Potential
Transmembrane346 – 36823Helical; Voltage-sensor; Name=Segment S4; Potential
Topological domain369 – 38113Cytoplasmic Potential
Transmembrane382 – 40120Helical; Name=Segment S5; Potential
Transmembrane451 – 47323Helical; Name=Segment S6; Potential
Topological domain474 – 638165Cytoplasmic Potential
Motif437 – 4426Selectivity filter By similarity
Compositional bias56 – 9944Gly/Pro-rich (insert)

Amino acid modifications

Modified residue5641Phosphoserine; by PKA Potential
Glycosylation2591N-linked (GlcNAc...) Potential
Glycosylation2661N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence594 – 63845GYEKS…IPSIL → VLYRIYHGFLPAENGTLRFS HSKDCTGNFCY in isoform GT10.
VSP_001020
Alternative sequence594 – 63845GYEKS…IPSIL → DNCKDVVITGYTQAEARSLT in isoform KSHIIIA.1.
VSP_001019
Alternative sequence594 – 63845GYEKS…IPSIL → ASTLEPMESTSQTKGDTRPE AHWNCAHLLNFGCPTGSSFP TL in isoform KV3.2C.
VSP_001018

Experimental info

Sequence conflict21G → S in CAA44643. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform KV3.2B [UniParc].

Last modified August 1, 1991. Version 1.
Checksum: 25C102B4CCE53BF4

FASTA63870,191
        10         20         30         40         50         60 
MGKIENNERV ILNVGGTRHE TYRSTLKTLP GTRLALLASS EPQGDCLTAA GDKLQPLPPP 

        70         80         90        100        110        120 
LSPPPRPPPL SPVPSGCFEG GAGNCSSHGG NGSDHPGGGR EFFFDRHPGV FAYVLNYYRT 

       130        140        150        160        170        180 
GKLHCPADVC GPLFEEELAF WGIDETDVEP CCWMTYRQHR DAEEALDIFE TPDLIGGDPG 

       190        200        210        220        230        240 
DDEDLGGKRL GIEDAAGLGG PDGKSGRWRK LQPRMWALFE DPYSSRAARF IAFASLFFIL 

       250        260        270        280        290        300 
VSITTFCLET HEAFNIVKNK TEPVINGTSA VLQYEIETDP ALTYVEGVCV VWFTFEFLVR 

       310        320        330        340        350        360 
IVFSPNKLEF IKNLLNIIDF VAILPFYLEV GLSGLSSKAA KDVLGFLRVV RFVRILRIFK 

       370        380        390        400        410        420 
LTRHFVGLRV LGHTLRASTN EFLLLIIFLA LGVLIFATMI YYAERVGAQP NDPSASEHTQ 

       430        440        450        460        470        480 
FKNIPIGFWW AVVTMTTLGY GDMYPQTWSG MLVGALCALA GVLTIAMPVP VIVNNFGMYY 

       490        500        510        520        530        540 
SLAMAKQKLP RKRKKHIPPA PLASSPTFCK TELNMACNST QSDTCLGKEN RLLEHNRSVL 

       550        560        570        580        590        600 
SGDDSTGSEP PLSPPERLPI RRSSTRDKNR RGETCFLLTT GDYTCASDGG IRKGYEKSRS 

       610        620        630 
LNNIAGLAGN ALRLSPVTSP YNSPCPLRRS RSPIPSIL 

« Hide

Isoform KV3.2C [UniParc].

Checksum: 3F3D0386C5EC0C23
Show »

FASTA63569,887
Isoform KSHIIIA.1 [UniParc].

Checksum: EA2E740D2E95F7E1
Show »

FASTA61367,551
Isoform GT10 [UniParc].

Checksum: A29A2E25DC33E99A
Show »

FASTA62468,976

References

[1]"Shaw-like rat brain potassium channel cDNA's with divergent 3' ends."
Luneau C.J., Wiedmann R., Smith J.S., Williams J.B.
FEBS Lett. 288:163-167(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KV3.2B AND KV3.2C).
Tissue: Brain.
[2]"Region-specific expression of a K+ channel gene in brain."
Baker H., Pollock J., Ellisman M., Kentros C., Miera E., Serodio P., Weiser M., Rudy B., Fruhling D.
Proc. Natl. Acad. Sci. U.S.A. 89:4603-4607(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KV3.2B).
[3]"Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
McCormack T., de Miera E.C.V.-S., Rudy B.
Proc. Natl. Acad. Sci. U.S.A. 87:5227-5231(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KSHIIIA.1).
Tissue: Brain.
[4]"Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
McCormack T., de Miera E.C.V.-S., Rudy B.
Proc. Natl. Acad. Sci. U.S.A. 88:4060-4060(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[5]"Characterization of a Shaw-related potassium channel family in rat brain."
Rettig J., Wunder F., Stocker M., Lichtinghagen R., Mastiaux F., Beckh S., Kues W., Pedarzani P., Schroeter K.H., Ruppersberg J.P., Veh R., Pongs O.
EMBO J. 11:2473-2486(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GT10).
[6]"MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating."
Lewis A., McCrossan Z.A., Abbott G.W.
J. Biol. Chem. 279:7884-7892(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH KCNC1; KCNE1; KCNE2 AND KCNE3.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M59211 mRNA. Translation: AAA41819.1.
M59313 mRNA. Translation: AAA41820.1. Sequence problems.
M84203 mRNA. Translation: AAA42143.1.
M34052 mRNA. Translation: AAA42142.1.
X62839 mRNA. Translation: CAA44643.1.
PIRA39402.
B45292.
S22703.
RefSeqNP_631962.1. NM_139216.1.
NP_631963.1. NM_139217.1.
XP_006241389.1. XM_006241327.1.
XP_006241390.1. XM_006241328.1.
XP_006241391.1. XM_006241329.1.
XP_006241392.1. XM_006241330.1.
XP_006241393.1. XM_006241331.1.
XP_006241394.1. XM_006241332.1.
UniGeneRn.9733.

3D structure databases

ProteinModelPortalP22462.
SMRP22462. Positions 101-160.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid251521. 1 interaction.

Chemistry

GuidetoPHARMACOLOGY549.

Proteomic databases

PaxDbP22462.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. [P22462-3]
ENSRNOT00000005700; ENSRNOP00000005700; ENSRNOG00000004077. [P22462-4]
ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. [P22462-1]
ENSRNOT00000049943; ENSRNOP00000049641; ENSRNOG00000004077. [P22462-2]
GeneID246153.
KEGGrno:246153.
UCSCRGD:628829. rat. [P22462-1]

Organism-specific databases

CTD3747.
RGD628829. Kcnc2.

Phylogenomic databases

eggNOGCOG1226.
GeneTreeENSGT00740000115365.
HOGENOMHOG000231012.
HOVERGENHBG105862.
InParanoidP22462.
KOK04888.
OMAGNCSSHG.
OrthoDBEOG7CRTPP.
PhylomeDBP22462.
TreeFamTF352511.

Gene expression databases

GenevestigatorP22462.

Family and domain databases

Gene3D1.20.120.350. 1 hit.
3.30.710.10. 2 hits.
InterProIPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003968. K_chnl_volt-dep_Kv.
IPR003974. K_chnl_volt-dep_Kv3.
IPR003131. T1-type_BTB.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERPTHR11537. PTHR11537. 1 hit.
PfamPF02214. BTB_2. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSPR00169. KCHANNEL.
PR01491. KVCHANNEL.
PR01498. SHAWCHANNEL.
SMARTSM00225. BTB. 1 hit.
[Graphical view]
SUPFAMSSF54695. SSF54695. 2 hits.
ProtoNetSearch...

Other

NextBio623450.
PROP22462.

Entry information

Entry nameKCNC2_RAT
AccessionPrimary (citable) accession number: P22462
Secondary accession number(s): P22461, P22463, Q63735
Entry history
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: August 1, 1991
Last modified: April 16, 2014
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families