P22462 (KCNC2_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium voltage-gated channel subfamily C member 2 Alternative name(s): KSHIIIA Voltage-gated potassium channel subunit Kv3.2 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 638 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Channel properties are modulated by subunit assembly. |
| Subunit structure | The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming subunits that can associate with modulating accessory subunits. Interacts with KCNC1, KCNE1, KCNE2 and KCNE3. Ref.6 |
| Subcellular location | |
| Domain | The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position. The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments. |
| Sequence similarities | Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.2/KCNC2 sub-subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| Molecular function | Ion channel Potassium channel Voltage-gated channel |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein homooligomerization Inferred from electronic annotation. Source: InterPro regulation of action potentialInferred from electronic annotation. Source: Compara |
| Cellular_component | voltage-gated potassium channel complex Inferred from electronic annotation. Source: InterPro |
| Molecular_function | delayed rectifier potassium channel activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform KV3.2B (identifier: P22462-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform KV3.2C (identifier: P22462-2) The sequence of this isoform differs from the canonical sequence as follows: 594-638: GYEKSRSLNN...RSRSPIPSIL → ASTLEPMEST...CPTGSSFPTL | ||||||
| Isoform KSHIIIA.1 (identifier: P22462-3) The sequence of this isoform differs from the canonical sequence as follows: 594-638: GYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL → DNCKDVVITGYTQAEARSLT | ||||||
| Isoform GT10 (identifier: P22462-4) The sequence of this isoform differs from the canonical sequence as follows: 594-638: GYEKSRSLNN...RSRSPIPSIL → VLYRIYHGFLPAENGTLRFSHSKDCTGNFCY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 638 | 638 | Potassium voltage-gated channel subfamily C member 2 | PRO_0000054054 | |||||
Regions | |||||||||
| Topological domain | 1 – 229 | 229 | Cytoplasmic Potential | ||||||
| Transmembrane | 230 – 248 | 19 | Helical; Name=Segment S1; Potential | ||||||
| Transmembrane | 284 – 303 | 20 | Helical; Name=Segment S2; Potential | ||||||
| Topological domain | 304 – 314 | 11 | Cytoplasmic Potential | ||||||
| Transmembrane | 315 – 337 | 23 | Helical; Name=Segment S3; Potential | ||||||
| Transmembrane | 346 – 368 | 23 | Helical; Voltage-sensor; Name=Segment S4; Potential | ||||||
| Topological domain | 369 – 381 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 382 – 401 | 20 | Helical; Name=Segment S5; Potential | ||||||
| Transmembrane | 451 – 473 | 23 | Helical; Name=Segment S6; Potential | ||||||
| Topological domain | 474 – 638 | 165 | Cytoplasmic Potential | ||||||
| Motif | 437 – 442 | 6 | Selectivity filter By similarity | ||||||
| Compositional bias | 56 – 99 | 44 | Gly/Pro-rich (insert) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 564 | 1 | Phosphoserine; by PKA Potential | ||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 266 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 594 – 638 | 45 | GYEKS…IPSIL → VLYRIYHGFLPAENGTLRFS HSKDCTGNFCY in isoform GT10. | VSP_001020 | |||||
| Alternative sequence | 594 – 638 | 45 | GYEKS…IPSIL → DNCKDVVITGYTQAEARSLT in isoform KSHIIIA.1. | VSP_001019 | |||||
| Alternative sequence | 594 – 638 | 45 | GYEKS…IPSIL → ASTLEPMESTSQTKGDTRPE AHWNCAHLLNFGCPTGSSFP TL in isoform KV3.2C. | VSP_001018 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | G → S in CAA44643. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Shaw-like rat brain potassium channel cDNA's with divergent 3' ends." Luneau C.J., Wiedmann R., Smith J.S., Williams J.B. FEBS Lett. 288:163-167(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KV3.2B AND KV3.2C). Tissue: Brain. |
| [2] | "Region-specific expression of a K+ channel gene in brain." Baker H., Pollock J., Ellisman M., Kentros C., Miera E., Serodio P., Weiser M., Rudy B., Fruhling D. Proc. Natl. Acad. Sci. U.S.A. 89:4603-4607(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KV3.2B). |
| [3] | "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals." McCormack T., de Miera E.C.V.-S., Rudy B. Proc. Natl. Acad. Sci. U.S.A. 87:5227-5231(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KSHIIIA.1). Tissue: Brain. |
| [4] | "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals." McCormack T., de Miera E.C.V.-S., Rudy B. Proc. Natl. Acad. Sci. U.S.A. 88:4060-4060(1991) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [5] | "Characterization of a Shaw-related potassium channel family in rat brain." Rettig J., Wunder F., Stocker M., Lichtinghagen R., Mastiaux F., Beckh S., Kues W., Pedarzani P., Schroeter K.H., Ruppersberg J.P., Veh R., Pongs O. EMBO J. 11:2473-2486(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GT10). |
| [6] | "MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating." Lewis A., McCrossan Z.A., Abbott G.W. J. Biol. Chem. 279:7884-7892(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KCNC1; KCNE1; KCNE2 AND KCNE3. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M59211 mRNA. Translation: AAA41819.1. M59313 mRNA. Translation: AAA41820.1. Sequence problems. M84203 mRNA. Translation: AAA42143.1. M34052 mRNA. Translation: AAA42142.1. X62839 mRNA. Translation: CAA44643.1. |
| IPI | IPI00207175. IPI00231437. IPI00231438. IPI00231440. |
| PIR | A39402. B45292. S22703. |
| RefSeq | NP_631962.1. NM_139216.1. NP_631963.1. NM_139217.1. |
| UniGene | Rn.9733. |
3D structure databases | |
| ProteinModelPortal | P22462. |
| SMR | P22462. Positions 101-160. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | P22462. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. ENSRNOT00000005700; ENSRNOP00000005700; ENSRNOG00000004077. ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. ENSRNOT00000049943; ENSRNOP00000049641; ENSRNOG00000004077. |
| GeneID | 246153. |
| KEGG | rno:246153. |
| UCSC | RGD:628829. rat. |
Organism-specific databases | |
| CTD | 3747. |
| RGD | 628829. Kcnc2. |
Phylogenomic databases | |
| eggNOG | COG1226. |
| GeneTree | ENSGT00630000089518. |
| HOGENOM | HOG000231012. |
| HOVERGEN | HBG105862. |
| InParanoid | P22462. |
| KO | K04888. |
| OMA | MCLGKDN. |
Gene expression databases | |
| ArrayExpress | P22462. |
| Genevestigator | P22462. |
| GermOnline | ENSRNOG00000004077. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 3.30.710.10. 2 hits. |
| InterPro | IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR005821. Ion_trans_dom. IPR003091. K_chnl. IPR003968. K_chnl_volt-dep_Kv. IPR003974. K_chnl_volt-dep_Kv3. IPR003131. T1-type_BTB. [Graphical view] |
| PANTHER | PTHR11537. PTHR11537. 1 hit. |
| Pfam | PF00520. Ion_trans. 1 hit. PF02214. K_tetra. 1 hit. [Graphical view] |
| PRINTS | PR00169. KCHANNEL. PR01491. KVCHANNEL. PR01498. SHAWCHANNEL. |
| SMART | SM00225. BTB. 1 hit. [Graphical view] |
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 623450. |
Entry information
| Entry name | KCNC2_RAT | ||||||||
| Accession | Primary (citable) accession number: P22462 Secondary accession number(s): P22461, P22463, Q63735 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
