Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium voltage-gated channel subfamily C member 2

Gene

Kcnc2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Contributes to the regulation of the fast action potential repolarization and in sustained high-frequency firing in neurons of the central nervous system (PubMed:10482766, PubMed:10414968, PubMed:11506885, PubMed:22831914). Homotetramer channels mediate delayed-rectifier voltage-dependent potassium currents that activate rapidly at high-threshold voltages and inactivate slowly (PubMed:2367536, PubMed:1879548, PubMed:8120636, PubMed:7643197, PubMed:10414303). Forms tetrameric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:2367536, PubMed:1879548, PubMed:8120636, PubMed:7643197). Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNC1, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel (PubMed:10482766, PubMed:14679187). Channel properties may be modulated either by the association with ancillary subunits, such as KCNE1, KCNE2 and KCNE3 or indirectly by nitric oxide (NO) through a cGMP- and PKG-mediated signaling cascade, slowing channel activation and deactivation of delayed rectifier potassium channels (PubMed:11281123, PubMed:14679187). Contributes to fire sustained trains of very brief action potentials at high frequency in retinal ganglion cells, thalamocortical and suprachiasmatic nucleus (SCN) neurons and in hippocampal and neocortical interneurons (PubMed:10482766, PubMed:10414968, PubMed:11506885, PubMed:22831914). Sustained maximal action potential firing frequency in inhibitory hippocampal interneurons is negatively modulated by histamine H2 receptor activation in a cAMP- and protein kinase (PKA) phosphorylation-dependent manner. Plays a role in maintaining the fidelity of synaptic transmission in neocortical GABAergic interneurons by generating action potential (AP) repolarization at nerve terminals, thus reducing spike-evoked calcium influx and GABA neurotransmitter release. Required for long-range synchronization of gamma oscillations over distance in the neocortex. Contributes to the modulation of the circadian rhythm of spontaneous action potential firing in suprachiasmatic nucleus (SCN) neurons in a light-dependent manner (By similarity).By similarity2 Publications10 Publications

Enzyme regulationi

Inhibited by Stichodactyla helianthus peptide ShK (By similarity). Inhibited by millimolar levels of tetraethylammonium (TEA). Contrary to other channels, inhibited only by millimolar levels of 4-aminopyridine (4-AP) (PubMed:2367536, PubMed:1879548, PubMed:7643197, PubMed:10482766, PubMed:10414303).By similarity1 Publication4 Publications

Kineticsi

Homotetrameric channels expressed in xenopus oocytes or in mammalian non-neuronal cells display delayed-rectifier voltage-dependent potassium currents, that are rapidly activated during membrane depolarization, i.e within a risetime of a few msec. After that, inactivates very slowly, i.e within about >800 msec. Their activation requires a threshold potential at about -10 mV, with a midpoint activation at about 12.1 mV and a steepness parameter of about 8.4 mV (PubMed:2367536, PubMed:1879548, PubMed:8120636, PubMed:7643197, PubMed:10414303, PubMed:11281123, PubMed:14679187). The voltage-dependence of activation and inactivation and other channel characteristics vary depending on the experimental conditions, the expression system, the presence or absence of ancillary subunits and post-translational modifications (PubMed:7643197, PubMed:10414303, PubMed:11281123, PubMed:14679187).1 Publication

Manual assertion inferred by curator fromi

6 Publications

      GO - Molecular functioni

      • delayed rectifier potassium channel activity Source: UniProtKB
      • ion channel binding Source: UniProtKB
      • voltage-gated potassium channel activity Source: UniProtKB

      GO - Biological processi

      • cellular response to ammonium ion Source: RGD
      • cellular response to nitric oxide Source: UniProtKB
      • cellular response to toxic substance Source: RGD
      • globus pallidus development Source: RGD
      • ion transmembrane transport Source: RGD
      • nitric oxide-cGMP-mediated signaling pathway Source: UniProtKB
      • positive regulation of potassium ion transmembrane transport Source: RGD
      • potassium ion transmembrane transport Source: UniProtKB
      • protein heterooligomerization Source: UniProtKB
      • protein homooligomerization Source: UniProtKB
      • response to amine Source: RGD
      • response to ethanol Source: RGD
      • response to light intensity Source: RGD
      • response to magnesium ion Source: RGD
      • response to nerve growth factor Source: RGD
      • response to organic cyclic compound Source: RGD
      • response to toxic substance Source: RGD
      Complete GO annotation...

      Keywords - Molecular functioni

      Ion channel, Potassium channel, Voltage-gated channel

      Keywords - Biological processi

      Ion transport, Potassium transport, Transport

      Keywords - Ligandi

      Potassium

      Enzyme and pathway databases

      ReactomeiR-RNO-1296072. Voltage gated Potassium channels.
      R-RNO-381676. Glucagon-like Peptide-1 (GLP1) regulates insulin secretion.

      Names & Taxonomyi

      Protein namesi
      Recommended name:
      Potassium voltage-gated channel subfamily C member 2Imported
      Alternative name(s):
      Potassium channel voltage-gated Shaw-related subfamily C member 2Imported
      Shaw-like potassium channel1 Publication
      Voltage-gated potassium channel subunit Kv3.21 Publication
      Gene namesi
      Name:Kcnc2Imported
      OrganismiRattus norvegicus (Rat)
      Taxonomic identifieri10116 [NCBI]
      Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
      Proteomesi
      • UP000002494 Componenti: Chromosome 7

      Organism-specific databases

      RGDi628829. Kcnc2.

      Subcellular locationi

      Isoform 1 :
      Isoform 2 :
      Isoform 3 :

      Topology

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Topological domaini1 – 229CytoplasmicSequence analysisAdd BLAST229
      Transmembranei230 – 248Helical; Name=Segment S1Sequence analysisAdd BLAST19
      Transmembranei284 – 303Helical; Name=Segment S2Sequence analysisAdd BLAST20
      Topological domaini304 – 314CytoplasmicSequence analysisAdd BLAST11
      Transmembranei315 – 337Helical; Name=Segment S3Sequence analysisAdd BLAST23
      Transmembranei346 – 368Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST23
      Topological domaini369 – 381CytoplasmicSequence analysisAdd BLAST13
      Transmembranei382 – 401Helical; Name=Segment S5Sequence analysisAdd BLAST20
      Transmembranei451 – 473Helical; Name=Segment S6Sequence analysisAdd BLAST23
      Topological domaini474 – 638CytoplasmicSequence analysisAdd BLAST165

      GO - Cellular componenti

      • apical plasma membrane Source: UniProtKB
      • axolemma Source: RGD
      • axon Source: UniProtKB
      • basolateral plasma membrane Source: RGD
      • cell junction Source: UniProtKB-KW
      • dendrite Source: RGD
      • integral component of plasma membrane Source: UniProtKB
      • intracellular Source: GOC
      • neuronal cell body Source: RGD
      • neuronal cell body membrane Source: UniProtKB
      • perikaryon Source: UniProtKB
      • plasma membrane Source: UniProtKB
      • postsynaptic membrane Source: UniProtKB
      • presynaptic membrane Source: UniProtKB
      • synapse Source: UniProtKB
      • terminal bouton Source: RGD
      • vesicle Source: RGD
      • voltage-gated potassium channel complex Source: UniProtKB
      Complete GO annotation...

      Keywords - Cellular componenti

      Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse, Synaptosome

      Pathology & Biotechi

      Mutagenesis

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Mutagenesisi563S → A: Does not abolish channel activity inhibition in presence of nitric oxide (NO); when associated with A-564. Absence of channel activity inhibition in presence of cAMP; when associated with A-564. 2 Publications1
      Mutagenesisi564S → A: Does not abolish channel activity inhibition in presence of nitric oxide (NO); when associated with A-564. Absence of channel activity inhibition in presence of cAMP; when associated with A-563. 2 Publications1

      Chemistry databases

      GuidetoPHARMACOLOGYi549.

      PTM / Processingi

      Molecule processing

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      ChainiPRO_00000540541 – 638Potassium voltage-gated channel subfamily C member 2Add BLAST638

      Amino acid modifications

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Glycosylationi259N-linked (GlcNAc...)Sequence analysis1
      Glycosylationi266N-linked (GlcNAc...)Sequence analysis1
      Modified residuei564Phosphoserine; by PKASequence analysis1
      Modified residuei600PhosphoserineBy similarity1

      Post-translational modificationi

      Phosphorylated by PKA in cortical synaptosomes (PubMed:7643197). cAMP-dependent phosphorylation inhibits channel activity (PubMed:7643197). Histamine H2 receptor- and PKA-induced phosphorylation extends action potential spike duration, reduces action potential spike amplitude, sustains maximum firing frequency in hippocampal interneurons; also reduces the incidence of high-frequency oscillations in hippocampal CA3 pyramidal cell layers (By similarity).By similarity1 Publication

      Keywords - PTMi

      Glycoprotein, Phosphoprotein

      Proteomic databases

      PaxDbiP22462.

      PTM databases

      PhosphoSitePlusiP22462.

      Expressioni

      Tissue specificityi

      Expressed in neurons of the visual cortex during postnatal development (PubMed:18708127). Expressed in neurons of the globus pallidus at postnatal age day 7 (P7), onward (PubMed:10482766). Expressed in thalamic relay neurons. Expressed in neurons in layer IV and deeper cortical layers of the neocortex. Expressed in hippocampal interneurons (PubMed:7643197). Expressed in nonpyramidal interneurons in the basolateral amygdala (PubMed:16413129). Expressed in retinal ganglion cells (at protein level) (PubMed:22831914). Widely expressed in the brain (PubMed:1879548, PubMed:8120636). Expressed in numerous thalamic relay neurons throughout the dorsal thalamus. Expressed in interneurons of the deep layers V-VI of the cerebral cortex, the CA1 and CA3 pyramidal and dentate gyrus (DG) granule cells of the hippocampus, in neurons of the caudate-putamen, globus pallidus and subthalamic nucleus. Also expressed in the optic layer of interior colliculus, the inferior colliculus, the red nucleus, the medial geniculate, the ventral lateral lemiscus, the reticulotegmental nucleus and in the deep cerebellar nuclei (PubMed:1374908, PubMed:8120636, PubMed:7643197, PubMed:18708127). Expressed in globus pallidus (GP) neurons (PubMed:10414968).9 Publications

      Inductioni

      Up-regulated in visual cortex during the second postnatal week from dark-reared animals (at protein level). Down-regulated in visual cortex by active visual experience until postnatal day P40 of dark-reared animals (PubMed:18708127). Down-regulated by chronic action potential activity deprivation in organotypic culture of the visual cortex (PubMed:18775767).2 Publications

      Gene expression databases

      BgeeiENSRNOG00000004077.
      GenevisibleiP22462. RN.

      Interactioni

      Subunit structurei

      Homotetramer and heterotetramer with other channel-forming alpha subunits, such as KCNC1. Interacts with KCNC1 (PubMed:10482766, PubMed:14679187). Homotetramer or heterotetramer channel activity is regulated by association with modulating ancillary subunits such as KCNE1, KCNE2 and KCNE3, creating a functionally diverse range of channel complexes. Interacts with KCNE1, KCNE2 and KCNE3 (PubMed:14679187).2 Publications

      GO - Molecular functioni

      • ion channel binding Source: UniProtKB

      Protein-protein interaction databases

      BioGridi251521. 1 interactor.
      STRINGi10116.ENSRNOP00000005773.

      Structurei

      3D structure databases

      ProteinModelPortaliP22462.
      ModBaseiSearch...
      MobiDBiSearch...

      Family & Domainsi

      Motif

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Motifi437 – 442Selectivity filterBy similarity6

      Compositional bias

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Compositional biasi56 – 99Gly/Pro-rich (insert)Add BLAST44

      Domaini

      The transmembrane segment S4 functions as voltage-sensor and is characterized by a series of positively charged amino acids at every third position. Channel opening and closing is effected by a conformation change that affects the position and orientation of the voltage-sensor paddle formed by S3 and S4 within the membrane. A transmembrane electric field that is positive inside would push the positively charged S4 segment outwards, thereby opening the pore, while a field that is negative inside would pull the S4 segment inwards and close the pore. Changes in the position and orientation of S4 are then transmitted to the activation gate formed by the inner helix bundle via the S4-S5 linker region.By similarity

      Sequence similaritiesi

      Keywords - Domaini

      Transmembrane, Transmembrane helix

      Phylogenomic databases

      eggNOGiKOG3713. Eukaryota.
      COG1226. LUCA.
      GeneTreeiENSGT00760000118846.
      HOGENOMiHOG000231012.
      HOVERGENiHBG105862.
      InParanoidiP22462.
      KOiK04888.
      OMAiNCSSHGG.
      OrthoDBiEOG091G0EJL.
      PhylomeDBiP22462.
      TreeFamiTF352511.

      Family and domain databases

      Gene3Di1.20.120.350. 1 hit.
      InterProiIPR000210. BTB/POZ_dom.
      IPR027359. Channel_four-helix_dom.
      IPR005821. Ion_trans_dom.
      IPR003968. K_chnl_volt-dep_Kv.
      IPR003974. K_chnl_volt-dep_Kv3.
      IPR011333. SKP1/BTB/POZ.
      IPR003131. T1-type_BTB.
      IPR028325. VG_K_chnl.
      [Graphical view]
      PANTHERiPTHR11537. PTHR11537. 2 hits.
      PfamiPF02214. BTB_2. 1 hit.
      PF00520. Ion_trans. 1 hit.
      [Graphical view]
      PRINTSiPR00169. KCHANNEL.
      PR01491. KVCHANNEL.
      PR01498. SHAWCHANNEL.
      SMARTiSM00225. BTB. 1 hit.
      [Graphical view]
      SUPFAMiSSF54695. SSF54695. 2 hits.

      Sequences (4)i

      Sequence statusi: Complete.

      This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

      Isoform 1 (identifier: P22462-1) [UniParc]FASTAAdd to basket
      Also known as: KV3.2B1 Publication

      This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

      « Hide

              10         20         30         40         50
      MGKIENNERV ILNVGGTRHE TYRSTLKTLP GTRLALLASS EPQGDCLTAA
      60 70 80 90 100
      GDKLQPLPPP LSPPPRPPPL SPVPSGCFEG GAGNCSSHGG NGSDHPGGGR
      110 120 130 140 150
      EFFFDRHPGV FAYVLNYYRT GKLHCPADVC GPLFEEELAF WGIDETDVEP
      160 170 180 190 200
      CCWMTYRQHR DAEEALDIFE TPDLIGGDPG DDEDLGGKRL GIEDAAGLGG
      210 220 230 240 250
      PDGKSGRWRK LQPRMWALFE DPYSSRAARF IAFASLFFIL VSITTFCLET
      260 270 280 290 300
      HEAFNIVKNK TEPVINGTSA VLQYEIETDP ALTYVEGVCV VWFTFEFLVR
      310 320 330 340 350
      IVFSPNKLEF IKNLLNIIDF VAILPFYLEV GLSGLSSKAA KDVLGFLRVV
      360 370 380 390 400
      RFVRILRIFK LTRHFVGLRV LGHTLRASTN EFLLLIIFLA LGVLIFATMI
      410 420 430 440 450
      YYAERVGAQP NDPSASEHTQ FKNIPIGFWW AVVTMTTLGY GDMYPQTWSG
      460 470 480 490 500
      MLVGALCALA GVLTIAMPVP VIVNNFGMYY SLAMAKQKLP RKRKKHIPPA
      510 520 530 540 550
      PLASSPTFCK TELNMACNST QSDTCLGKEN RLLEHNRSVL SGDDSTGSEP
      560 570 580 590 600
      PLSPPERLPI RRSSTRDKNR RGETCFLLTT GDYTCASDGG IRKGYEKSRS
      610 620 630
      LNNIAGLAGN ALRLSPVTSP YNSPCPLRRS RSPIPSIL
      Length:638
      Mass (Da):70,191
      Last modified:August 1, 1991 - v1
      Checksum:i25C102B4CCE53BF4
      GO
      Isoform 2 (identifier: P22462-2) [UniParc]FASTAAdd to basket
      Also known as: KV3.2C1 Publication

      The sequence of this isoform differs from the canonical sequence as follows:
           594-638: GYEKSRSLNN...RSRSPIPSIL → ASTLEPMEST...CPTGSSFPTL

      Show »
      Length:635
      Mass (Da):69,887
      Checksum:i3F3D0386C5EC0C23
      GO
      Isoform 3 (identifier: P22462-3) [UniParc]FASTAAdd to basket
      Also known as: KV3.2A, KShIIIA.11 Publication

      The sequence of this isoform differs from the canonical sequence as follows:
           594-638: GYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL → DNCKDVVITGYTQAEARSLT

      Show »
      Length:613
      Mass (Da):67,551
      Checksum:iEA2E740D2E95F7E1
      GO
      Isoform 4 (identifier: P22462-4) [UniParc]FASTAAdd to basket

      The sequence of this isoform differs from the canonical sequence as follows:
           594-638: GYEKSRSLNN...RSRSPIPSIL → VLYRIYHGFLPAENGTLRFSHSKDCTGNFCY

      Show »
      Length:624
      Mass (Da):68,976
      Checksum:iA29A2E25DC33E99A
      GO

      Experimental Info

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Sequence conflicti2G → S in CAA44643 (PubMed:1378392).Curated1

      Alternative sequence

      Feature keyPosition(s)DescriptionActionsGraphical viewLength
      Alternative sequenceiVSP_001018594 – 638GYEKS…IPSIL → ASTLEPMESTSQTKGDTRPE AHWNCAHLLNFGCPTGSSFP TL in isoform 2. 1 PublicationAdd BLAST45
      Alternative sequenceiVSP_001019594 – 638GYEKS…IPSIL → DNCKDVVITGYTQAEARSLT in isoform 3. 1 PublicationAdd BLAST45
      Alternative sequenceiVSP_001020594 – 638GYEKS…IPSIL → VLYRIYHGFLPAENGTLRFS HSKDCTGNFCY in isoform 4. 1 PublicationAdd BLAST45

      Sequence databases

      Select the link destinations:
      EMBLi
      GenBanki
      DDBJi
      Links Updated
      M34052 mRNA. Translation: AAA42142.1.
      M59211 mRNA. Translation: AAA41819.1.
      M59313 mRNA. Translation: AAA41820.1. Sequence problems.
      X62839 mRNA. Translation: CAA44643.1.
      M84203 mRNA. Translation: AAA42143.1.
      PIRiA39402.
      B45292.
      S22703.
      RefSeqiNP_631962.1. NM_139216.1. [P22462-3]
      NP_631963.1. NM_139217.1. [P22462-1]
      XP_006241389.1. XM_006241327.3. [P22462-1]
      XP_017450149.1. XM_017594660.1. [P22462-1]
      XP_017450150.1. XM_017594661.1. [P22462-2]
      XP_017450151.1. XM_017594662.1. [P22462-4]
      XP_017450152.1. XM_017594663.1. [P22462-3]
      UniGeneiRn.9733.

      Genome annotation databases

      EnsembliENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. [P22462-3]
      ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. [P22462-1]
      GeneIDi246153.
      KEGGirno:246153.
      UCSCiRGD:628829. rat. [P22462-1]

      Keywords - Coding sequence diversityi

      Alternative splicing

      Cross-referencesi

      Sequence databases

      Select the link destinations:
      EMBLi
      GenBanki
      DDBJi
      Links Updated
      M34052 mRNA. Translation: AAA42142.1.
      M59211 mRNA. Translation: AAA41819.1.
      M59313 mRNA. Translation: AAA41820.1. Sequence problems.
      X62839 mRNA. Translation: CAA44643.1.
      M84203 mRNA. Translation: AAA42143.1.
      PIRiA39402.
      B45292.
      S22703.
      RefSeqiNP_631962.1. NM_139216.1. [P22462-3]
      NP_631963.1. NM_139217.1. [P22462-1]
      XP_006241389.1. XM_006241327.3. [P22462-1]
      XP_017450149.1. XM_017594660.1. [P22462-1]
      XP_017450150.1. XM_017594661.1. [P22462-2]
      XP_017450151.1. XM_017594662.1. [P22462-4]
      XP_017450152.1. XM_017594663.1. [P22462-3]
      UniGeneiRn.9733.

      3D structure databases

      ProteinModelPortaliP22462.
      ModBaseiSearch...
      MobiDBiSearch...

      Protein-protein interaction databases

      BioGridi251521. 1 interactor.
      STRINGi10116.ENSRNOP00000005773.

      Chemistry databases

      GuidetoPHARMACOLOGYi549.

      PTM databases

      PhosphoSitePlusiP22462.

      Proteomic databases

      PaxDbiP22462.

      Protocols and materials databases

      Structural Biology KnowledgebaseSearch...

      Genome annotation databases

      EnsembliENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. [P22462-3]
      ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. [P22462-1]
      GeneIDi246153.
      KEGGirno:246153.
      UCSCiRGD:628829. rat. [P22462-1]

      Organism-specific databases

      CTDi3747.
      RGDi628829. Kcnc2.

      Phylogenomic databases

      eggNOGiKOG3713. Eukaryota.
      COG1226. LUCA.
      GeneTreeiENSGT00760000118846.
      HOGENOMiHOG000231012.
      HOVERGENiHBG105862.
      InParanoidiP22462.
      KOiK04888.
      OMAiNCSSHGG.
      OrthoDBiEOG091G0EJL.
      PhylomeDBiP22462.
      TreeFamiTF352511.

      Enzyme and pathway databases

      ReactomeiR-RNO-1296072. Voltage gated Potassium channels.
      R-RNO-381676. Glucagon-like Peptide-1 (GLP1) regulates insulin secretion.

      Miscellaneous databases

      PROiP22462.

      Gene expression databases

      BgeeiENSRNOG00000004077.
      GenevisibleiP22462. RN.

      Family and domain databases

      Gene3Di1.20.120.350. 1 hit.
      InterProiIPR000210. BTB/POZ_dom.
      IPR027359. Channel_four-helix_dom.
      IPR005821. Ion_trans_dom.
      IPR003968. K_chnl_volt-dep_Kv.
      IPR003974. K_chnl_volt-dep_Kv3.
      IPR011333. SKP1/BTB/POZ.
      IPR003131. T1-type_BTB.
      IPR028325. VG_K_chnl.
      [Graphical view]
      PANTHERiPTHR11537. PTHR11537. 2 hits.
      PfamiPF02214. BTB_2. 1 hit.
      PF00520. Ion_trans. 1 hit.
      [Graphical view]
      PRINTSiPR00169. KCHANNEL.
      PR01491. KVCHANNEL.
      PR01498. SHAWCHANNEL.
      SMARTiSM00225. BTB. 1 hit.
      [Graphical view]
      SUPFAMiSSF54695. SSF54695. 2 hits.
      ProtoNetiSearch...

      Entry informationi

      Entry nameiKCNC2_RAT
      AccessioniPrimary (citable) accession number: P22462
      Secondary accession number(s): P22461, P22463, Q63735
      Entry historyi
      Integrated into UniProtKB/Swiss-Prot: August 1, 1991
      Last sequence update: August 1, 1991
      Last modified: November 30, 2016
      This is version 148 of the entry and version 1 of the sequence. [Complete history]
      Entry statusiReviewed (UniProtKB/Swiss-Prot)
      Annotation programChordata Protein Annotation Program

      Miscellaneousi

      Keywords - Technical termi

      Complete proteome, Reference proteome

      Documents

      1. SIMILARITY comments
        Index of protein domains and families

      Similar proteinsi

      Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
      100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
      90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
      50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.