Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P22462

- KCNC2_RAT

UniProt

P22462 - KCNC2_RAT

Protein

Potassium voltage-gated channel subfamily C member 2

Gene

Kcnc2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 1 (01 Aug 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Channel properties are modulated by subunit assembly.

    GO - Molecular functioni

    1. delayed rectifier potassium channel activity Source: RefGenome

    GO - Biological processi

    1. action potential Source: Ensembl
    2. protein homooligomerization Source: InterPro

    Keywords - Molecular functioni

    Ion channel, Potassium channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Potassium transport, Transport

    Keywords - Ligandi

    Potassium

    Enzyme and pathway databases

    ReactomeiREACT_199159. Voltage gated Potassium channels.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Potassium voltage-gated channel subfamily C member 2
    Alternative name(s):
    KSHIIIA
    Voltage-gated potassium channel subunit Kv3.2
    Gene namesi
    Name:Kcnc2
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 7

    Organism-specific databases

    RGDi628829. Kcnc2.

    Subcellular locationi

    GO - Cellular componenti

    1. voltage-gated potassium channel complex Source: InterPro

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 638638Potassium voltage-gated channel subfamily C member 2PRO_0000054054Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi266 – 2661N-linked (GlcNAc...)Sequence Analysis
    Modified residuei564 – 5641Phosphoserine; by PKASequence Analysis

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP22462.

    Expressioni

    Gene expression databases

    GenevestigatoriP22462.

    Interactioni

    Subunit structurei

    The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming subunits that can associate with modulating accessory subunits. Interacts with KCNC1, KCNE1, KCNE2 and KCNE3.1 Publication

    Protein-protein interaction databases

    BioGridi251521. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP22462.
    SMRiP22462. Positions 101-160.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 229229CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini304 – 31411CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini369 – 38113CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini474 – 638165CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei230 – 24819Helical; Name=Segment S1Sequence AnalysisAdd
    BLAST
    Transmembranei284 – 30320Helical; Name=Segment S2Sequence AnalysisAdd
    BLAST
    Transmembranei315 – 33723Helical; Name=Segment S3Sequence AnalysisAdd
    BLAST
    Transmembranei346 – 36823Helical; Voltage-sensor; Name=Segment S4Sequence AnalysisAdd
    BLAST
    Transmembranei382 – 40120Helical; Name=Segment S5Sequence AnalysisAdd
    BLAST
    Transmembranei451 – 47323Helical; Name=Segment S6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi437 – 4426Selectivity filterBy similarity

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi56 – 9944Gly/Pro-rich (insert)Add
    BLAST

    Domaini

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
    The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1226.
    GeneTreeiENSGT00740000115365.
    HOGENOMiHOG000231012.
    HOVERGENiHBG105862.
    InParanoidiP22462.
    KOiK04888.
    OMAiMCLGKDN.
    OrthoDBiEOG7CRTPP.
    PhylomeDBiP22462.
    TreeFamiTF352511.

    Family and domain databases

    Gene3Di1.20.120.350. 1 hit.
    3.30.710.10. 2 hits.
    InterProiIPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR027359. Channel_four-helix_dom.
    IPR005821. Ion_trans_dom.
    IPR003091. K_chnl.
    IPR003968. K_chnl_volt-dep_Kv.
    IPR003974. K_chnl_volt-dep_Kv3.
    IPR003131. T1-type_BTB.
    IPR028325. VG_K_chnl.
    [Graphical view]
    PANTHERiPTHR11537. PTHR11537. 1 hit.
    PfamiPF02214. BTB_2. 1 hit.
    PF00520. Ion_trans. 1 hit.
    [Graphical view]
    PRINTSiPR00169. KCHANNEL.
    PR01491. KVCHANNEL.
    PR01498. SHAWCHANNEL.
    SMARTiSM00225. BTB. 1 hit.
    [Graphical view]
    SUPFAMiSSF54695. SSF54695. 2 hits.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform KV3.2B (identifier: P22462-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGKIENNERV ILNVGGTRHE TYRSTLKTLP GTRLALLASS EPQGDCLTAA    50
    GDKLQPLPPP LSPPPRPPPL SPVPSGCFEG GAGNCSSHGG NGSDHPGGGR 100
    EFFFDRHPGV FAYVLNYYRT GKLHCPADVC GPLFEEELAF WGIDETDVEP 150
    CCWMTYRQHR DAEEALDIFE TPDLIGGDPG DDEDLGGKRL GIEDAAGLGG 200
    PDGKSGRWRK LQPRMWALFE DPYSSRAARF IAFASLFFIL VSITTFCLET 250
    HEAFNIVKNK TEPVINGTSA VLQYEIETDP ALTYVEGVCV VWFTFEFLVR 300
    IVFSPNKLEF IKNLLNIIDF VAILPFYLEV GLSGLSSKAA KDVLGFLRVV 350
    RFVRILRIFK LTRHFVGLRV LGHTLRASTN EFLLLIIFLA LGVLIFATMI 400
    YYAERVGAQP NDPSASEHTQ FKNIPIGFWW AVVTMTTLGY GDMYPQTWSG 450
    MLVGALCALA GVLTIAMPVP VIVNNFGMYY SLAMAKQKLP RKRKKHIPPA 500
    PLASSPTFCK TELNMACNST QSDTCLGKEN RLLEHNRSVL SGDDSTGSEP 550
    PLSPPERLPI RRSSTRDKNR RGETCFLLTT GDYTCASDGG IRKGYEKSRS 600
    LNNIAGLAGN ALRLSPVTSP YNSPCPLRRS RSPIPSIL 638
    Length:638
    Mass (Da):70,191
    Last modified:August 1, 1991 - v1
    Checksum:i25C102B4CCE53BF4
    GO
    Isoform KV3.2C (identifier: P22462-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         594-638: GYEKSRSLNN...RSRSPIPSIL → ASTLEPMEST...CPTGSSFPTL

    Show »
    Length:635
    Mass (Da):69,887
    Checksum:i3F3D0386C5EC0C23
    GO
    Isoform KSHIIIA.1 (identifier: P22462-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         594-638: GYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL → DNCKDVVITGYTQAEARSLT

    Show »
    Length:613
    Mass (Da):67,551
    Checksum:iEA2E740D2E95F7E1
    GO
    Isoform GT10 (identifier: P22462-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         594-638: GYEKSRSLNN...RSRSPIPSIL → VLYRIYHGFLPAENGTLRFSHSKDCTGNFCY

    Show »
    Length:624
    Mass (Da):68,976
    Checksum:iA29A2E25DC33E99A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21G → S in CAA44643. (PubMed:1378392)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei594 – 63845GYEKS…IPSIL → VLYRIYHGFLPAENGTLRFS HSKDCTGNFCY in isoform GT10. 1 PublicationVSP_001020Add
    BLAST
    Alternative sequencei594 – 63845GYEKS…IPSIL → DNCKDVVITGYTQAEARSLT in isoform KSHIIIA.1. 1 PublicationVSP_001019Add
    BLAST
    Alternative sequencei594 – 63845GYEKS…IPSIL → ASTLEPMESTSQTKGDTRPE AHWNCAHLLNFGCPTGSSFP TL in isoform KV3.2C. 1 PublicationVSP_001018Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M59211 mRNA. Translation: AAA41819.1.
    M59313 mRNA. Translation: AAA41820.1. Sequence problems.
    M84203 mRNA. Translation: AAA42143.1.
    M34052 mRNA. Translation: AAA42142.1.
    X62839 mRNA. Translation: CAA44643.1.
    PIRiA39402.
    B45292.
    S22703.
    RefSeqiNP_631962.1. NM_139216.1. [P22462-3]
    NP_631963.1. NM_139217.1. [P22462-1]
    XP_006241389.1. XM_006241327.1. [P22462-1]
    XP_006241390.1. XM_006241328.1. [P22462-1]
    XP_006241391.1. XM_006241329.1. [P22462-2]
    XP_006241392.1. XM_006241330.1. [P22462-4]
    XP_006241393.1. XM_006241331.1. [P22462-3]
    XP_006241394.1. XM_006241332.1. [P22462-3]
    UniGeneiRn.9733.

    Genome annotation databases

    EnsembliENSRNOT00000005690; ENSRNOP00000005690; ENSRNOG00000004077. [P22462-3]
    ENSRNOT00000005700; ENSRNOP00000005700; ENSRNOG00000004077. [P22462-4]
    ENSRNOT00000005773; ENSRNOP00000005773; ENSRNOG00000004077. [P22462-1]
    ENSRNOT00000049943; ENSRNOP00000049641; ENSRNOG00000004077. [P22462-2]
    GeneIDi246153.
    KEGGirno:246153.
    UCSCiRGD:628829. rat. [P22462-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M59211 mRNA. Translation: AAA41819.1 .
    M59313 mRNA. Translation: AAA41820.1 . Sequence problems.
    M84203 mRNA. Translation: AAA42143.1 .
    M34052 mRNA. Translation: AAA42142.1 .
    X62839 mRNA. Translation: CAA44643.1 .
    PIRi A39402.
    B45292.
    S22703.
    RefSeqi NP_631962.1. NM_139216.1. [P22462-3 ]
    NP_631963.1. NM_139217.1. [P22462-1 ]
    XP_006241389.1. XM_006241327.1. [P22462-1 ]
    XP_006241390.1. XM_006241328.1. [P22462-1 ]
    XP_006241391.1. XM_006241329.1. [P22462-2 ]
    XP_006241392.1. XM_006241330.1. [P22462-4 ]
    XP_006241393.1. XM_006241331.1. [P22462-3 ]
    XP_006241394.1. XM_006241332.1. [P22462-3 ]
    UniGenei Rn.9733.

    3D structure databases

    ProteinModelPortali P22462.
    SMRi P22462. Positions 101-160.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 251521. 1 interaction.

    Chemistry

    GuidetoPHARMACOLOGYi 549.

    Proteomic databases

    PaxDbi P22462.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000005690 ; ENSRNOP00000005690 ; ENSRNOG00000004077 . [P22462-3 ]
    ENSRNOT00000005700 ; ENSRNOP00000005700 ; ENSRNOG00000004077 . [P22462-4 ]
    ENSRNOT00000005773 ; ENSRNOP00000005773 ; ENSRNOG00000004077 . [P22462-1 ]
    ENSRNOT00000049943 ; ENSRNOP00000049641 ; ENSRNOG00000004077 . [P22462-2 ]
    GeneIDi 246153.
    KEGGi rno:246153.
    UCSCi RGD:628829. rat. [P22462-1 ]

    Organism-specific databases

    CTDi 3747.
    RGDi 628829. Kcnc2.

    Phylogenomic databases

    eggNOGi COG1226.
    GeneTreei ENSGT00740000115365.
    HOGENOMi HOG000231012.
    HOVERGENi HBG105862.
    InParanoidi P22462.
    KOi K04888.
    OMAi MCLGKDN.
    OrthoDBi EOG7CRTPP.
    PhylomeDBi P22462.
    TreeFami TF352511.

    Enzyme and pathway databases

    Reactomei REACT_199159. Voltage gated Potassium channels.

    Miscellaneous databases

    NextBioi 623450.
    PROi P22462.

    Gene expression databases

    Genevestigatori P22462.

    Family and domain databases

    Gene3Di 1.20.120.350. 1 hit.
    3.30.710.10. 2 hits.
    InterProi IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR027359. Channel_four-helix_dom.
    IPR005821. Ion_trans_dom.
    IPR003091. K_chnl.
    IPR003968. K_chnl_volt-dep_Kv.
    IPR003974. K_chnl_volt-dep_Kv3.
    IPR003131. T1-type_BTB.
    IPR028325. VG_K_chnl.
    [Graphical view ]
    PANTHERi PTHR11537. PTHR11537. 1 hit.
    Pfami PF02214. BTB_2. 1 hit.
    PF00520. Ion_trans. 1 hit.
    [Graphical view ]
    PRINTSi PR00169. KCHANNEL.
    PR01491. KVCHANNEL.
    PR01498. SHAWCHANNEL.
    SMARTi SM00225. BTB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54695. SSF54695. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Shaw-like rat brain potassium channel cDNA's with divergent 3' ends."
      Luneau C.J., Wiedmann R., Smith J.S., Williams J.B.
      FEBS Lett. 288:163-167(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KV3.2B AND KV3.2C).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KV3.2B).
    3. "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
      McCormack T., de Miera E.C.V.-S., Rudy B.
      Proc. Natl. Acad. Sci. U.S.A. 87:5227-5231(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KSHIIIA.1).
      Tissue: Brain.
    4. "Molecular cloning of a member of a third class of Shaker-family K+ channel genes in mammals."
      McCormack T., de Miera E.C.V.-S., Rudy B.
      Proc. Natl. Acad. Sci. U.S.A. 88:4060-4060(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    5. "Characterization of a Shaw-related potassium channel family in rat brain."
      Rettig J., Wunder F., Stocker M., Lichtinghagen R., Mastiaux F., Beckh S., Kues W., Pedarzani P., Schroeter K.H., Ruppersberg J.P., Veh R., Pongs O.
      EMBO J. 11:2473-2486(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GT10).
    6. "MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating."
      Lewis A., McCrossan Z.A., Abbott G.W.
      J. Biol. Chem. 279:7884-7892(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KCNC1; KCNE1; KCNE2 AND KCNE3.

    Entry informationi

    Entry nameiKCNC2_RAT
    AccessioniPrimary (citable) accession number: P22462
    Secondary accession number(s): P22461, P22463, Q63735
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1991
    Last sequence update: August 1, 1991
    Last modified: October 1, 2014
    This is version 128 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3