P22105 (TENX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 159.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tenascin-X Short name=TN-X Alternative name(s): Hexabrachion-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 4289 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Appears to mediate interactions between cells and the extracellular matrix. Substrate-adhesion molecule that appears to inhibit cell migration. Accelerates collagen fibril formation. May play a role in supporting the growth of epithelial tumors. Ref.13 |
| Subunit structure | Homotrimer. Interacts with type I, III and V collagens and tropoelastin via its 29th fibronectin type-III domain. Ref.9 Ref.13 |
| Subcellular location | |
| Tissue specificity | Highly expressed in fetal adrenal, in fetal testis, fetal smooth, striated and cardiac muscle. Isoform XB-short is only expressed in the adrenal gland. |
| Developmental stage | Expression levels are lower in adults than in children. Ref.9 |
| Involvement in disease | Tenascin-X deficiency (TNXD) [MIM:606408]: TNXD leads to an Ehlers-Danlos-like syndrome characterized by hyperextensible skin, hypermobile joints, and tissue fragility. Tenascin-X-deficient patients, however, lack atrophic scars, a major diagnostic criteria for classic Ehlers-Danlos. Delayed wound healing, which is also common in classic EDS, is only present in a subset of patients. |
| Sequence similarities | Belongs to the tenascin family. Contains 19 EGF-like domains. Contains 1 fibrinogen C-terminal domain. Contains 32 fibronectin type-III domains. |
| Caution | There are two genes for TN-X: TNXA and TNXB. TNXA is a partial gene which can sometimes recombine with TNXB. |
| Sequence caution | The sequence AAH33740.1 differs from that shown. Reason: Erroneous initiation. The sequence CAB89296.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI17414.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI17471.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI18078.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI18332.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAQ09268.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform XB (identifier: P22105-1) Also known as: 1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform XB-short (identifier: P22105-2) Also known as: 2; The sequence of this isoform differs from the canonical sequence as follows: 1-3616: Missing. | ||||||
| Isoform 3 (identifier: P22105-3) The sequence of this isoform differs from the canonical sequence as follows: 747-747: E → EEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFT 878-1013: Missing. 1014-1030: GVRAGQTSKSYAFITTT → TGSSPLGLLGTTDEPPPS 1648-1648: A → APLPPA 2155-2155: T → TAAEEETPSPT 2353-2353: A → APGKDEEMAPA 2451-2451: T → TAA 2774-2774: T → TAA 2880-2880: T → TEDEAETTQA 2977-2977: T → TAA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 24 – 4289 | 4266 | Tenascin-X | PRO_0000007751 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 156 – 168 | 13 | EGF-like 1; incomplete | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 183 – 213 | 31 | EGF-like 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 214 – 244 | 31 | EGF-like 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 245 – 275 | 31 | EGF-like 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 276 – 306 | 31 | EGF-like 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 307 – 337 | 31 | EGF-like 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 338 – 368 | 31 | EGF-like 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 369 – 399 | 31 | EGF-like 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 400 – 430 | 31 | EGF-like 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 431 – 461 | 31 | EGF-like 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 462 – 492 | 31 | EGF-like 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 493 – 523 | 31 | EGF-like 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 524 – 554 | 31 | EGF-like 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 555 – 585 | 31 | EGF-like 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 586 – 616 | 31 | EGF-like 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 617 – 647 | 31 | EGF-like 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 648 – 679 | 32 | EGF-like 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 684 – 714 | 31 | EGF-like 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 715 – 746 | 32 | EGF-like 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 792 – 872 | 81 | Fibronectin type-III 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 941 – 1021 | 81 | Fibronectin type-III 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1047 – 1127 | 81 | Fibronectin type-III 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1149 – 1226 | 78 | Fibronectin type-III 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1246 – 1327 | 82 | Fibronectin type-III 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1348 – 1429 | 82 | Fibronectin type-III 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1459 – 1540 | 82 | Fibronectin type-III 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1561 – 1642 | 82 | Fibronectin type-III 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1659 – 1736 | 78 | Fibronectin type-III 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1756 – 1836 | 81 | Fibronectin type-III 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1856 – 1939 | 84 | Fibronectin type-III 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1962 – 2039 | 78 | Fibronectin type-III 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2069 – 2150 | 82 | Fibronectin type-III 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2167 – 2248 | 82 | Fibronectin type-III 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2266 – 2347 | 82 | Fibronectin type-III 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2365 – 2446 | 82 | Fibronectin type-III 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2471 – 2552 | 82 | Fibronectin type-III 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2582 – 2663 | 82 | Fibronectin type-III 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2688 – 2769 | 82 | Fibronectin type-III 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2794 – 2875 | 82 | Fibronectin type-III 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2889 – 2972 | 84 | Fibronectin type-III 21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2997 – 3078 | 82 | Fibronectin type-III 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3105 – 3186 | 82 | Fibronectin type-III 23 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3211 – 3292 | 82 | Fibronectin type-III 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3307 – 3384 | 78 | Fibronectin type-III 25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3399 – 3481 | 83 | Fibronectin type-III 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3494 – 3575 | 82 | Fibronectin type-III 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3601 – 3682 | 82 | Fibronectin type-III 28 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3699 – 3787 | 89 | Fibronectin type-III 29 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3801 – 3879 | 79 | Fibronectin type-III 30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3890 – 3971 | 82 | Fibronectin type-III 31 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 3978 – 4059 | 82 | Fibronectin type-III 32 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 4066 – 4281 | 216 | Fibrinogen C-terminal | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 901 – 922 | 22 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 1748 – 1750 | 3 | Cell attachment site Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 31 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 901 | 1 | N-linked (GlcNAc...) Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 930 | 1 | N-linked (GlcNAc...) Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 3900 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 3953 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 3965 | 1 | N-linked (GlcNAc...) Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 4140 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 187 ↔ 197 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 191 ↔ 202 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 204 ↔ 213 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 218 ↔ 228 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 222 ↔ 233 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 235 ↔ 244 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 249 ↔ 259 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 253 ↔ 264 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 266 ↔ 275 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 280 ↔ 290 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 284 ↔ 295 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 297 ↔ 306 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 311 ↔ 321 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 315 ↔ 326 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 328 ↔ 337 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 342 ↔ 352 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 346 ↔ 357 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 359 ↔ 368 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 373 ↔ 383 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 377 ↔ 388 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 390 ↔ 399 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 404 ↔ 414 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 408 ↔ 419 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 421 ↔ 430 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 435 ↔ 445 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 439 ↔ 450 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 452 ↔ 461 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 466 ↔ 476 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 470 ↔ 481 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 483 ↔ 492 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 497 ↔ 507 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 501 ↔ 512 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 514 ↔ 523 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 528 ↔ 538 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 532 ↔ 543 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 545 ↔ 554 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 559 ↔ 569 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 563 ↔ 574 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 576 ↔ 585 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 590 ↔ 600 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 594 ↔ 605 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 607 ↔ 616 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 621 ↔ 631 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 625 ↔ 636 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 638 ↔ 647 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 652 ↔ 662 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 656 ↔ 667 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 669 ↔ 678 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 688 ↔ 698 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 692 ↔ 703 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 705 ↔ 714 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 719 ↔ 729 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 723 ↔ 734 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 736 ↔ 745 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 4075 ↔ 4105 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 4227 ↔ 4240 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 3616 | 3616 | Missing in isoform XB-short. | VSP_001418 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 747 | 1 | E → EEVPTIEGMRMHLLEETTVR TEWTPAPGPVDAYEIQFIPT TEGASPPFT in isoform 3. | VSP_034569 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 878 – 1013 | 136 | Missing in isoform 3. | VSP_034570 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1014 – 1030 | 17 | GVRAG…FITTT → TGSSPLGLLGTTDEPPPS in isoform 3. | VSP_034571 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1648 | 1 | A → APLPPA in isoform 3. | VSP_034572 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2155 | 1 | T → TAAEEETPSPT in isoform 3. | VSP_034573 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2353 | 1 | A → APGKDEEMAPA in isoform 3. | VSP_034574 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2451 | 1 | T → TAA in isoform 3. | VSP_034575 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2774 | 1 | T → TAA in isoform 3. | VSP_034576 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2880 | 1 | T → TEDEAETTQA in isoform 3. | VSP_034578 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2977 | 1 | T → TAA in isoform 3. | VSP_034577 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 29 | 1 | R → W in EDS3. Ref.17 | VAR_046499 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 302 | 1 | T → A. Ref.3 Corresponds to variant rs1150752 [ dbSNP | Ensembl ]. | VAR_044347 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 511 | 1 | R → H. Corresponds to variant rs204896 [ dbSNP | Ensembl ]. | VAR_021908 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | G → C. Corresponds to variant rs17201609 [ dbSNP | Ensembl ]. | VAR_055781 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 650 | 1 | R → H. Corresponds to variant rs17201602 [ dbSNP | Ensembl ]. | VAR_055782 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 825 | 1 | S → A. Corresponds to variant rs204900 [ dbSNP | Ensembl ]. | VAR_055783 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1195 | 1 | V → M in EDS3. Ref.17 | VAR_046500 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1248 | 1 | H → R. Corresponds to variant rs185819 [ dbSNP | Ensembl ]. | VAR_024270 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1987 | 1 | E → K. Corresponds to variant rs17207923 [ dbSNP | Ensembl ]. | VAR_059276 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2363 | 1 | P → H. Corresponds to variant rs2269428 [ dbSNP | Ensembl ]. | VAR_020170 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2425 | 1 | P → H. Corresponds to variant rs2269428 [ dbSNP | Ensembl ]. | VAR_055784 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2472 | 1 | P → L. Corresponds to variant rs12524664 [ dbSNP | Ensembl ]. | VAR_059277 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2555 | 1 | G → S. Corresponds to variant rs2269429 [ dbSNP | Ensembl ]. | VAR_020171 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2578 | 1 | G → E. Ref.2 Ref.3 Corresponds to variant rs1009382 [ dbSNP | Ensembl ]. | VAR_020172 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4033 | 1 | L → I. Ref.17 | VAR_046501 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | G → GEQG in CAA50739. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2789 | 1 | P → R in AAB67981. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2789 | 1 | P → R in AAB47488. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3836 | 1 | Q → L in AAH33740. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3922 | 1 | V → I in AAI25115. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3922 | 1 | V → I in AAI25116. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3922 | 1 | V → I in BAD92249. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4019 | 1 | N → T in AAI25115. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4019 | 1 | N → T in AAI25116. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4019 | 1 | N → T in BAD92249. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4038 | 1 | P → G in AAB41287. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4038 | 1 | P → G in AAA35884. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4049 | 1 | M → T in AAI25116. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4049 | 1 | M → T in BAD92249. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4102 | 1 | N → I in AAI25115. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4163 | 1 | M → I in AAB41287. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4163 | 1 | M → I in AAA35884. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3707 – 3710 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3716 – 3719 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3728 – 3735 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3740 – 3742 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3752 – 3757 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3762 – 3765 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3773 – 3781 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3783 – 3795 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3894 – 3897 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3902 – 3904 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3906 – 3911 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3918 – 3925 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3927 – 3929 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3932 – 3937 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3941 – 3945 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3950 – 3962 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3970 – 3976 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 3981 – 3983 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3984 – 3986 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 3994 – 3999 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4006 – 4013 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4019 – 4024 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4029 – 4033 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4041 – 4050 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4058 – 4063 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequences promoting the transcription of the human XA gene overlapping P450c21A correctly predict the presence of a novel, adrenal-specific, truncated form of tenascin-X." Tee M.K., Thomson A.A., Bristow J., Miller W.L. Genomics 28:171-178(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM XB-SHORT). Tissue: Adrenal gland. |
| [2] | "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-2578. |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ALA-302 AND GLU-2578. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM XB-SHORT), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3455-4289 (ISOFORMS XB/3). |
| [6] | "Tenascin-X: a novel extracellular matrix protein encoded by the human XB gene overlapping P450c21B." Bristow J., Tee M.K., Gitelman S.E., Mellon S.H., Miller W.L. J. Cell Biol. 122:265-278(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-747 AND 1687-1944 (ISOFORMS XB/3). Tissue: Leukocyte. |
| [7] | "Alternate promoters and alternate splicing of human tenascin-X, a gene with 5' and 3' ends buried in other genes." Speek M., Barry F., Miller W.L. Hum. Mol. Genet. 5:1749-1758(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-23 (ISOFORMS XB/3). Tissue: Fetal adrenal gland. |
| [8] | "Cluster of fibronectin type III repeats found in the human major histocompatibility complex class III region shows the highest homology with the repeats in an extracellular matrix protein, tenascin." Matsumoto K., Arai M., Ishihara N., Ando A., Inoko H., Ikemura T. Genomics 12:485-491(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1148-1235; 2581-2668; 2687-2774 AND 2793-2880. Tissue: B-cell. |
| [9] | "Identification and characterization of multiple species of tenascin-X in human serum." Egging D.F., Peeters A.C.T.M., Grebenchtchikov N., Geurts-Moespot A., Sweep C.G.J., den Heijer M., Schalkwijk J. FEBS J. 274:1280-1289(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1486-1494; 1525-1535; 2194-2202; 2498-2506; 2609-2617; 2821-2829; 2840-2857; 3024-3032; 3063-3073; 3238-3246; 3257-3274; 3277-3287; 3654-3666 AND 3678-3710 (ISOFORMS XB/3), INTERACTION WITH TROPOELASTIN, DEVELOPMENTAL STAGE. |
| [10] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3406-4289 (ISOFORMS XB/3). Tissue: Brain. |
| [11] | "Transcript encoded on the opposite strand of the human steroid 21-hydroxylase/complement component C4 gene locus." Morel Y., Bristow J., Gitelman S.E., Miller W.L. Proc. Natl. Acad. Sci. U.S.A. 86:6582-6586(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3470-4289 (ISOFORMS XB/3). |
| [12] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-3965, MASS SPECTROMETRY. Tissue: Plasma. |
| [13] | "Interactions of human tenascin-X domains with dermal extracellular matrix molecules." Egging D.F., van den Berkmortel F., Taylor G., Bristow J., Schalkwijk J. Arch. Dermatol. Res. 298:389-396(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH COLLAGEN AND TROPOELASTIN. |
| [14] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-901 AND ASN-930, MASS SPECTROMETRY. Tissue: Liver. |
| [15] | "Solution structure of the 29th, 31st and 33rd fibronectin type-III domains of the human tenascin-X." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 3699-4069. |
| [16] | "A recessive form of the Ehlers-Danlos syndrome caused by tenascin-X deficiency." Schalkwijk J., Zweers M.C., Steijlen P.M., Dean W.B., Taylor G., van Vlijmen I.M., van Haren B., Miller W.L., Bristow J. N. Engl. J. Med. 345:1167-1175(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN EDSTNXD. |
| [17] | "Elastic fiber abnormalities in hypermobility type Ehlers-Danlos syndrome patients with tenascin-X mutations." Zweers M.C., Dean W.B., van Kuppevelt T.H., Bristow J., Schalkwijk J. Clin. Genet. 67:330-334(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDS3 TRP-29 AND MET-1195, VARIANT ILE-4033. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U24488 mRNA. Translation: AAB41287.1. AF019413 Genomic DNA. Translation: AAB67981.1. U89337 Genomic DNA. Translation: AAB47488.1. AL049547 Genomic DNA. Translation: CAB89296.1. Different initiation. AL049547 Genomic DNA. Translation: CAB89300.1. AL645922, AL662884, AL772248 Genomic DNA. Translation: CAQ09268.1. Sequence problems. AL662828, AL662849 Genomic DNA. Translation: CAI17414.1. Sequence problems. AL662849, AL662828 Genomic DNA. Translation: CAI17471.1. Sequence problems. AL662884, AL645922, AL772248 Genomic DNA. Translation: CAI18332.1. Sequence problems. AL772248, AL645922, AL662884 Genomic DNA. Translation: CAI18078.1. Sequence problems. CH471081 Genomic DNA. Translation: EAX03574.1. BC033740 mRNA. Translation: AAH33740.1. Different initiation. BC125114 mRNA. Translation: AAI25115.1. BC125115 mRNA. Translation: AAI25116.1. BC130037 mRNA. Translation: AAI30038.1. X71923 mRNA. Translation: CAA50739.1. Y13782 mRNA. Translation: CAA74109.1. Y13783 Genomic DNA. Translation: CAA74110.1. U52696 mRNA. Translation: AAC50889.1. AB209012 mRNA. Translation: BAD92249.1. M25813 mRNA. Translation: AAA35884.1. | ||||||||||||||||||||||||
| IPI | IPI00025276. IPI00218639. IPI00895929. | ||||||||||||||||||||||||
| PIR | A40701. A42175. B42175. D42175. | ||||||||||||||||||||||||
| RefSeq | NP_061978.6. NM_019105.6. NP_115859.2. NM_032470.3. | ||||||||||||||||||||||||
| UniGene | Hs.485104. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P22105. | ||||||||||||||||||||||||
| SMR | P22105. Positions 136-878, 983-4279. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P22105. 2 interactions. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P22105. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 290457668. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P22105. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 7148. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000375247; ENSP00000364396; ENSG00000168477. ENST00000451343; ENSP00000407685; ENSG00000168477. ENST00000546684; ENSP00000447694; ENSG00000236236. ENST00000550539; ENSP00000448326; ENSG00000229353. | ||||||||||||||||||||||||
| GeneID | 7148. | ||||||||||||||||||||||||
| KEGG | hsa:7148. | ||||||||||||||||||||||||
| UCSC | uc003nzg.1. human. uc003nzl.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 7148. | ||||||||||||||||||||||||
| GeneCards | GC06M032008. | ||||||||||||||||||||||||
| H-InvDB | HIX0165968. HIX0207682. | ||||||||||||||||||||||||
| HGNC | HGNC:11976. TNXB. | ||||||||||||||||||||||||
| HPA | CAB005373. | ||||||||||||||||||||||||
| MIM | 130020. phenotype. 600985. gene. 606408. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_P22105. | ||||||||||||||||||||||||
| Orphanet | 230839. Ehlers-Danlos syndrome, classic-like type. 285. Ehlers-Danlos syndrome, hypermobility type. | ||||||||||||||||||||||||
| PharmGKB | PA36662. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| HOVERGEN | HBG006855. | ||||||||||||||||||||||||
| InParanoid | P22105. | ||||||||||||||||||||||||
| KO | K06252. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P22105. | ||||||||||||||||||||||||
| Bgee | P22105. | ||||||||||||||||||||||||
| Genevestigator | P22105. | ||||||||||||||||||||||||
| GermOnline | ENSG00000168477. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 2.60.40.10. 32 hits. 3.90.215.10. 1 hit. 4.10.530.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR014716. Fibrinogen_a/b/g_C_1. IPR014715. Fibrinogen_a/b/g_C_2. IPR002181. Fibrinogen_a/b/g_C_dom. IPR020837. Fibrinogen_CS. IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00147. Fibrinogen_C. 1 hit. PF00041. fn3. 31 hits. PF12661. hEGF. 7 hits. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00181. EGF. 9 hits. SM00186. FBG. 1 hit. SM00060. FN3. 32 hits. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF56496. Fibrinogen_a/b/g_C. 1 hit. SSF49265. FN_III-like. 33 hits. | ||||||||||||||||||||||||
| PROSITE | PS00022. EGF_1. 18 hits. PS01186. EGF_2. 19 hits. PS50026. EGF_3. 8 hits. PS00514. FIBRINOGEN_C_1. 1 hit. PS51406. FIBRINOGEN_C_2. 1 hit. PS50853. FN3. 33 hits. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | TNXB. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P22105. | ||||||||||||||||||||||||
| GenomeRNAi | 7148. | ||||||||||||||||||||||||
| NextBio | 27974. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | TENX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P22105 Secondary accession number(s): P78530 Q9UMG7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
