P22002 (CAC1C_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit alpha-1C Alternative name(s): Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle Rat brain class C Short name=RBC Voltage-gated calcium channel subunit alpha Cav1.2 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 2169 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1C gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1C subunit play an important role in excitation-contraction coupling in the heart. Binding of calmodulin or CABP1 at the same regulatory sites results in an opposit effects on the channel function. |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interacts (via C-terminal C and IQ motifs) with CABP1. The binding via the C motif is calcium independent whereas the binding via IQ requires the presence of calcium and is mutually exclusive with calmodulin binding. Interacts with CACNA2D4 By similarity. Interacts (via C-terminal CDB motif) with CABP5; in a calcium-dependent manner By similarity. Ref.8 |
| Subcellular location | Membrane; Multi-pass membrane protein. Cell membrane By similarity. Note: The interaction between RRAD and CACNB2 regulates its trafficking to the cell membrane By similarity. |
| Tissue specificity | Isoforms 4 and 5 are expressed throughout the central nervous system, with highest levels in the olfactory bulb and cerebellum. Also expressed in heart, pituitary, adrenal gland, liver, kidney, and in a much lesser extent in testes and spleen. |
| Developmental stage | Expressed from embryonic day 16 until the adult stage. |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. Binding of intracellular calcium through the EF-hand motif inhibits the opening of the channel By similarity. |
| Post-translational modification | Phosphorylation by PKA activates the channel Probable. Is also phosphorylated in vitro by CaM-kinase II, PKC and CGPK. Ref.7 |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1C subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 2 (identifier: P22002-1) Also known as: S3B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P22002-2) Also known as: S3A; The sequence of this isoform differs from the canonical sequence as follows: 1306-1333: HYFCDAWNTFDALIVVGSIVDIAITEVH → GYFSDPSNVFDFLIVIGSIIAVILSETN | ||||||
| Isoform 3 (identifier: P22002-3) Also known as: D1; ROB2; The sequence of this isoform differs from the canonical sequence as follows: 1334-1344: Missing. | ||||||
| Isoform 4 (identifier: P22002-4) Also known as: rbC-I; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MIRAFAQPSTPPYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPG → MVNENTRMYVPEENHQ 964-979: FYFDIVFTTIFTIEIA → GNADYVFTSIFTLEII 1306-1333: HYFCDAWNTFDALIVVGSIVDIAITEVH → GYFSDPSNVFDFLIVIGSIIAVILSETN | ||||||
| Isoform 5 (identifier: P22002-5) Also known as: rbC-II; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MIRAFAQPSTPPYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPG → MVNENTRMYVPEENHQ 810-810: R → RPAR 964-979: FYFDIVFTTIFTIEIA → GNADYVFTSIFTLEII |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2169 | 2169 | Voltage-dependent L-type calcium channel subunit alpha-1C | PRO_0000053931 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 154 | 154 | Cytoplasmic Potential | ||||||||
| Transmembrane | 155 – 173 | 19 | Helical; Name=S1 of repeat I; Potential | ||||||||
| Topological domain | 174 – 190 | 17 | Extracellular Potential | ||||||||
| Transmembrane | 191 – 211 | 21 | Helical; Name=S2 of repeat I; Potential | ||||||||
| Topological domain | 212 – 223 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 224 – 242 | 19 | Helical; Name=S3 of repeat I; Potential | ||||||||
| Topological domain | 243 – 262 | 20 | Extracellular Potential | ||||||||
| Transmembrane | 263 – 281 | 19 | Helical; Name=S4 of repeat I; Potential | ||||||||
| Topological domain | 282 – 300 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 301 – 320 | 20 | Helical; Name=S5 of repeat I; Potential | ||||||||
| Topological domain | 321 – 410 | 90 | Extracellular Potential | ||||||||
| Transmembrane | 411 – 435 | 25 | Helical; Name=S6 of repeat I; Potential | ||||||||
| Topological domain | 436 – 554 | 119 | Cytoplasmic Potential | ||||||||
| Transmembrane | 555 – 573 | 19 | Helical; Name=S1 of repeat II; Potential | ||||||||
| Topological domain | 574 – 588 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 589 – 608 | 20 | Helical; Name=S2 of repeat II; Potential | ||||||||
| Topological domain | 609 – 616 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 617 – 635 | 19 | Helical; Name=S3 of repeat II; Potential | ||||||||
| Topological domain | 636 – 645 | 10 | Extracellular Potential | ||||||||
| Transmembrane | 646 – 664 | 19 | Helical; Name=S4 of repeat II; Potential | ||||||||
| Topological domain | 665 – 683 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 684 – 703 | 20 | Helical; Name=S5 of repeat II; Potential | ||||||||
| Topological domain | 704 – 758 | 55 | Extracellular Potential | ||||||||
| Transmembrane | 759 – 783 | 25 | Helical; Name=S6 of repeat II; Potential | ||||||||
| Topological domain | 784 – 930 | 147 | Cytoplasmic Potential | ||||||||
| Transmembrane | 931 – 949 | 19 | Helical; Name=S1 of repeat III; Potential | ||||||||
| Topological domain | 950 – 965 | 16 | Extracellular Potential | ||||||||
| Transmembrane | 966 – 985 | 20 | Helical; Name=S2 of repeat III; Potential | ||||||||
| Topological domain | 986 – 997 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 998 – 1016 | 19 | Helical; Name=S3 of repeat III; Potential | ||||||||
| Topological domain | 1017 – 1023 | 7 | Extracellular Potential | ||||||||
| Transmembrane | 1024 – 1041 | 18 | Helical; Name=S4 of repeat III; Potential | ||||||||
| Topological domain | 1042 – 1060 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1061 – 1080 | 20 | Helical; Name=S5 of repeat III; Potential | ||||||||
| Topological domain | 1081 – 1170 | 90 | Extracellular Potential | ||||||||
| Transmembrane | 1171 – 1195 | 25 | Helical; Name=S6 of repeat III; Potential | ||||||||
| Topological domain | 1196 – 1248 | 53 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1249 – 1267 | 19 | Helical; Name=S1 of repeat IV; Potential | ||||||||
| Topological domain | 1268 – 1282 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 1283 – 1302 | 20 | Helical; Name=S2 of repeat IV; Potential | ||||||||
| Topological domain | 1303 – 1310 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1311 – 1329 | 19 | Helical; Name=S3 of repeat IV; Potential | ||||||||
| Topological domain | 1330 – 1353 | 24 | Extracellular Potential | ||||||||
| Transmembrane | 1354 – 1372 | 19 | Helical; Name=S4 of repeat IV; Potential | ||||||||
| Topological domain | 1373 – 1391 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1392 – 1411 | 20 | Helical; Name=S5 of repeat IV; Potential | ||||||||
| Topological domain | 1412 – 1480 | 69 | Extracellular Potential | ||||||||
| Transmembrane | 1481 – 1505 | 25 | Helical; Name=S6 of repeat IV; Potential | ||||||||
| Topological domain | 1506 – 2169 | 664 | Cytoplasmic Potential | ||||||||
| Repeat | 141 – 438 | 298 | I | ||||||||
| Repeat | 540 – 786 | 247 | II | ||||||||
| Repeat | 917 – 1198 | 282 | III | ||||||||
| Repeat | 1235 – 1508 | 274 | IV | ||||||||
| Calcium binding | 1534 – 1545 | 12 | By similarity | ||||||||
| Region | 458 – 475 | 18 | Binding to the beta subunit By similarity | ||||||||
| Region | 1118 – 1208 | 91 | Dihydropyridine binding By similarity | ||||||||
| Region | 1459 – 1527 | 69 | Dihydropyridine binding By similarity | ||||||||
| Region | 1473 – 1516 | 44 | Phenylalkylamine binding By similarity | ||||||||
| Compositional bias | 684 – 690 | 7 | Poly-Leu | ||||||||
| Compositional bias | 798 – 804 | 7 | Poly-Glu | ||||||||
| Compositional bias | 1176 – 1182 | 7 | Poly-Ile | ||||||||
Sites | |||||||||||
| Site | 393 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 736 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1116 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1445 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 845 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 1516 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Modified residue | 1919 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Modified residue | 1927 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Glycosylation | 183 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 358 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1417 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1468 | 1 | N-linked (GlcNAc...) Potential | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 46 | 46 | MIRAF…YISPG → MVNENTRMYVPEENHQ in isoform 4 and isoform 5. | VSP_000908 | |||||||
| Alternative sequence | 810 | 1 | R → RPAR in isoform 5. | VSP_000909 | |||||||
| Alternative sequence | 964 – 979 | 16 | FYFDI…TIEIA → GNADYVFTSIFTLEII in isoform 4 and isoform 5. | VSP_000910 | |||||||
| Alternative sequence | 1306 – 1333 | 28 | HYFCD…ITEVH → GYFSDPSNVFDFLIVIGSII AVILSETN in isoform 1 and isoform 4. | VSP_000911 | |||||||
| Alternative sequence | 1334 – 1344 | 11 | Missing in isoform 3. | VSP_000912 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 83 | 1 | L → Q in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 83 | 1 | L → Q in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 87 | 1 | D → G in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 520 | 1 | G → R in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 648 – 649 | 2 | CW → VL in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 648 – 649 | 2 | CW → VL in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 678 | 1 | L → V in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 678 | 1 | L → V in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 769 – 770 | 2 | SP → CG in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 769 – 770 | 2 | SP → CG in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 777 | 1 | L → V in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 777 | 1 | L → V in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 871 | 1 | D → N in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1037 | 1 | R → RA in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1037 | 1 | R → RA in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 1098 | 1 | S → C in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1098 | 1 | S → C in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 1107 | 1 | T → D in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1107 | 1 | T → D in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 1229 | 1 | P → R in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1229 | 1 | P → R in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 1229 | 1 | P → R no nucleotide entry Ref.3 | ||||||||
| Sequence conflict | 1229 | 1 | P → R in AAA89157. Ref.6 | ||||||||
| Sequence conflict | 1306 | 1 | H → D in AAB35528. Ref.5 | ||||||||
| Sequence conflict | 1306 | 1 | H → G in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 1306 | 1 | H → G in AAA89157. Ref.6 | ||||||||
| Sequence conflict | 1329 | 1 | I → L in AAB35528. Ref.5 | ||||||||
| Sequence conflict | 1471 | 1 | E → K in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1911 | 1 | C → S in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 1911 | 1 | C → S in AAA42016. Ref.2 | ||||||||
| Sequence conflict | 2084 | 1 | K → N in AAA18905. Ref.2 | ||||||||
| Sequence conflict | 2154 | 1 | R → Q in AAA42016. Ref.2 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 454 – 474 | 21 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "cDNA cloning of a dihydropyridine-sensitive calcium channel from rat aorta. Evidence for the existence of alternatively spliced forms." Koch W.J., Ellinor P.T., Schwartz A. J. Biol. Chem. 265:17786-17791(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Aorta. |
| [2] | "Distinct calcium channels are generated by alternative splicing and are differentially expressed in the mammalian CNS." Snutch T.P., Tomlinson W.J., Leonard J.P., Gilbert M.M. Neuron 7:45-57(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5). Tissue: Brain. |
| [3] | "Rat brain expresses a heterogeneous family of calcium channels." Snutch T.P., Leonard J.P., Gilbert M.M., Lester H.A., Davidson N. Proc. Natl. Acad. Sci. U.S.A. 87:3391-3395(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1168-1413 (ISOFORM 1). |
| [4] | "Mutually exclusive exon splicing of the cardiac calcium channel a1 subunit generates developmentally regulated isoforms in the rat heart." Diebold R.J., Koch W.J., Ellinor P.T., Wang J.-J., Muthuchamy M., Wieczorek D.F., Schwartz A. Proc. Natl. Acad. Sci. U.S.A. 89:1497-1501(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1269-1415 (ISOFORMS 1; 2 AND 3). |
| [5] | "Changes in transcripts encoding calcium channel subunits of rat myometrium during pregnancy." Tezuka N., Ali M., Chwalisz K., Garfield R.E. Am. J. Physiol. 269:C1008-C1017(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1269-1387. Tissue: Myometrium. |
| [6] | "Multiple calcium channel transcripts in rat osteosarcoma cells: selective activation of alpha 1D isoform by parathyroid hormone." Barry E.L.R., Gesek F.A., Froehner S.C., Friedman P.A. Proc. Natl. Acad. Sci. U.S.A. 92:10914-10918(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1202-1495 (ISOFORM 3). Tissue: Osteosarcoma. |
| [7] | "Differential phosphorylation of two size forms of the neuronal class C L-type calcium channel alpha 1 subunit." Hell J.W., Yokoyama C.T., Wong S.T., Warner C., Snutch T.P., Catterall W.A. J. Biol. Chem. 268:19451-19457(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [8] | "Ca2+-binding protein-1 facilitates and forms a postsynaptic complex with Cav1.2 (L-type) Ca2+ channels." Zhou H., Kim S.-A., Kirk E.A., Tippens A.L., Sun H., Haeseleer F., Lee A. J. Neurosci. 24:4698-4708(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CABP1. |
| [9] | "Structural basis of the alpha1-beta subunit interaction of voltage-gated Ca2+ channels." Chen Y.H., Li M.H., Zhang Y., He L.L., Yamada Y., Fitzmaurice A., Shen Y., Zhang H., Tong L., Yang J. Nature 429:675-680(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 452-476. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M59786 mRNA. Translation: AAA85463.1. M67515 mRNA. Translation: AAA18905.1. M67516 mRNA. Translation: AAA42016.1. M91242 M91241 Genomic DNA. Translation: AAA41460.1.S80558 mRNA. Translation: AAB35528.1. U31815 mRNA. Translation: AAA89157.1. | ||||||||||||
| IPI | IPI00231323. IPI00392650. IPI00476992. IPI00948183. IPI00949968. | ||||||||||||
| RefSeq | NP_036649.2. NM_012517.2. | ||||||||||||
| UniGene | Rn.9827. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P22002. | ||||||||||||
| SMR | P22002. Positions 1641-1669. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P22002. 2 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P22002. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P22002. | ||||||||||||
| PRIDE | P22002. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 24239. | ||||||||||||
| KEGG | rno:24239. | ||||||||||||
| UCSC | RGD:2245. rat. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 775. | ||||||||||||
| RGD | 2245. Cacna1c. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG1226. | ||||||||||||
| HOVERGEN | HBG050763. | ||||||||||||
| InParanoid | P22002. | ||||||||||||
| KO | K04850. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_113568. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P22002. | ||||||||||||
| Genevestigator | P22002. | ||||||||||||
| GermOnline | ENSRNOG00000007090. Rattus norvegicus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005821. Ion_trans_dom. IPR014873. VDCC_a1su_IQ. IPR005451. VDCC_L_a1csu. IPR005446. VDCC_L_a1su. IPR002077. VDCCAlpha1. [Graphical view] | ||||||||||||
| PANTHER | PTHR10037:SF47. PTHR10037:SF47. 1 hit. | ||||||||||||
| Pfam | PF08763. Ca_chan_IQ. 1 hit. PF00520. Ion_trans. 4 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00167. CACHANNEL. PR01630. LVDCCALPHA1. PR01635. LVDCCALPHA1C. | ||||||||||||
| SMART | SM01062. Ca_chan_IQ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P22002. | ||||||||||||
| ChEMBL | CHEMBL3762. | ||||||||||||
| EvolutionaryTrace | P22002. | ||||||||||||
| NextBio | 602705. | ||||||||||||
Entry information
| Entry name | CAC1C_RAT | ||||||||
| Accession | Primary (citable) accession number: P22002 Secondary accession number(s): P27733 Q64178 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
