P21956 (MFGM_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lactadherin Alternative name(s): MFGM Milk fat globule-EGF factor 8 Short name=MFG-E8 SED1 Sperm surface protein SP47 Short name=MP47 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 463 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction By similarity. Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Ref.7 Ref.8 |
| Subcellular location | |
| Tissue specificity | Mammary epithelial cell surfaces and spermatozoan. Isoform 2 is present in brain, heart, kidney and spleen and at low levels in lung, liver, small intestine and testis. Ref.1 Ref.4 |
| Developmental stage | Isoform 1 and isoform 2 are detectable in mammary tissue from non-pregnant animals, with isoform 2 being predominant. Levels of isoform 1 increase during gestation and lactation while levels of isoform 2 decrease. Ref.1 Ref.4 |
| Induction | Isoform 1 is induced by insulin, prolactin and hydrocortisone in mammary epithelial cells. Expression of isoform 2 is repressed by the same treatment. Ref.4 |
| Post-translational modification | N-glycosylated. Isoform 1 also exists in both an O-glycosylated and a non-O-glycosylated form. Ref.4 |
| Sequence similarities | Contains 2 EGF-like domains. Contains 2 F5/8 type C domains. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P21956-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P21956-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 110-147: ETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASR → G |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Ref.1 | ||||||||||||||||||||||||||||||||||
| Chain | 23 – 463 | 441 | Lactadherin | PRO_0000007653 | |||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||
| Domain | 24 – 61 | 38 | EGF-like 1 | ||||||||||||||||||||||||||||||||||
| Domain | 64 – 108 | 45 | EGF-like 2 | ||||||||||||||||||||||||||||||||||
| Domain | 148 – 303 | 156 | F5/8 type C 1 | ||||||||||||||||||||||||||||||||||
| Domain | 308 – 463 | 156 | F5/8 type C 2 | ||||||||||||||||||||||||||||||||||
| Motif | 87 – 89 | 3 | Cell attachment site | ||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 61 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||
| Glycosylation | 266 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||
| Glycosylation | 316 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||
| Glycosylation | 426 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||
| Disulfide bond | 28 ↔ 39 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 33 ↔ 49 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 51 ↔ 60 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 68 ↔ 79 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 73 ↔ 96 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 98 ↔ 107 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 148 ↔ 303 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 290 ↔ 294 | By similarity | |||||||||||||||||||||||||||||||||||
| Disulfide bond | 308 ↔ 463 | By similarity | |||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 110 – 147 | 38 | ETNYY…NLASR → G in isoform 2. | VSP_009880 | |||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 35 | 1 | N → D AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 168 | 1 | S → Y in AAA39534. Ref.1 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 196 | 1 | T → H in AAA39534. Ref.1 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in AAA39534. Ref.1 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in CAA72380. Ref.3 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in BAA35180. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in BAA76386. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in BAC40794. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in BAE42274. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in AAH03892. Ref.6 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 284 | 1 | K → R in AAH03904. Ref.6 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | S → L in AAA39534. Ref.1 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 395 | 1 | A → E in AAA39534. Ref.1 | ||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 316 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 323 – 327 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 346 – 348 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 352 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 355 – 357 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 359 – 362 | 4 | |||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 384 | 18 | |||||||||||||||||||||||||||||||||||
| Beta strand | 393 – 406 | 14 | |||||||||||||||||||||||||||||||||||
| Beta strand | 414 – 416 | 3 | |||||||||||||||||||||||||||||||||||
| Turn | 425 – 427 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 430 – 432 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 434 – 436 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 438 – 453 | 16 | |||||||||||||||||||||||||||||||||||
| Beta strand | 455 – 462 | 8 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of a mouse mammary epithelial cell surface protein reveals the existence of epidermal growth factor-like domains linked to factor VIII-like sequences." Stubbs J.D., Lekutis C., Singer K.L., Bui A., Yuzuki D., Srinivasan U., Parry G. Proc. Natl. Acad. Sci. U.S.A. 87:8417-8421(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 23-35, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE. Strain: BALB/c. Tissue: Mammary gland. |
| [2] | Ensslin M.A. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Molecular cloning and characterization of P47, a novel boar sperm-associated zona pellucida-binding protein homologous to a family of mammalian secretory proteins." Ensslin M.A., Vogel T., Calvete J.J., Thole H.H., Schmidtke J., Matsuda T., Toepfer-Petersen E. Biol. Reprod. 58:1057-1064(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 23-463 (ISOFORM 2). Tissue: Testis. |
| [4] | "Lactation-dependent expression of an mRNA splice variant with an exon for a multiply O-glycosylated domain of mouse milk fat globule glycoprotein MFG-E8." Oshima K., Aoki N., Negi M., Kishi M., Kitajima K., Matsuda T. Biochem. Biophys. Res. Commun. 254:522-528(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION, GLYCOSYLATION. Strain: BALB/c. Tissue: Mammary gland. |
| [5] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J and NOD. Tissue: Bone marrow and Dendritic cell. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Mammary gland. |
| [7] | "Lactadherin promotes VEGF-dependent neovascularization." Silvestre J.S., Thery C., Hamard G., Boddaert J., Aguilar B., Delcayre A., Houbron C., Tamarat R., Blanc-Brude O., Heeneman S., Clergue M., Duriez M., Merval R., Levy B., Tedgui A., Amigorena S., Mallat Z. Nat. Med. 11:499-506(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ITGB3 AND ITGB5, FUNCTION IN NEOVASCULARIZATION. |
| [8] | "Milk fat globule-EGF factor 8/lactadherin plays a crucial role in maintenance and repair of murine intestinal epithelium." Bu H.F., Zuo X.L., Wang X., Ensslin M.A., Koti V., Hsueh W., Raymond A.S., Shur B.D., Tan X.D. J. Clin. Invest. 117:3673-3683(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN GUT EPITHELIAL REPAIR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M38337 mRNA. Translation: AAA39534.1. Y11684 mRNA. Translation: CAA72380.2. AB021130 mRNA. Translation: BAA35180.1. AB025280 mRNA. Translation: BAA76386.1. AK089211 mRNA. Translation: BAC40794.1. AK152088 mRNA. Translation: BAE30938.1. AK171143 mRNA. Translation: BAE42274.1. BC003892 mRNA. Translation: AAH03892.1. BC003904 mRNA. Translation: AAH03904.1. | ||||||||||||
| IPI | IPI00322712. IPI00411071. | ||||||||||||
| PIR | A36479. | ||||||||||||
| RefSeq | NP_032620.2. NM_008594.2. | ||||||||||||
| UniGene | Mm.1451. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P21956. | ||||||||||||
| SMR | P21956. Positions 28-463. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P21956. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P21956. | ||||||||||||
| PRIDE | P21956. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605. ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605. | ||||||||||||
| GeneID | 17304. | ||||||||||||
| KEGG | mmu:17304. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 4240. | ||||||||||||
| MGI | MGI:102768. Mfge8. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG151024. | ||||||||||||
| GeneTree | ENSGT00670000097729. | ||||||||||||
| HOGENOM | HOG000236278. | ||||||||||||
| HOVERGEN | HBG002385. | ||||||||||||
| InParanoid | Q3U8S9. | ||||||||||||
| OMA | QYVAAYK. | ||||||||||||
| OrthoDB | EOG47D9G6. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P21956. | ||||||||||||
| Bgee | P21956. | ||||||||||||
| CleanEx | MM_MFGE8. | ||||||||||||
| Genevestigator | P21956. | ||||||||||||
| GermOnline | ENSMUSG00000030605. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000421. Coagulation_fac_5/8-C_type_dom. IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR008979. Galactose-bd-like. IPR027060. Lactadherin. [Graphical view] | ||||||||||||
| PANTHER | PTHR10127:SF303. PTHR10127:SF303. 1 hit. | ||||||||||||
| Pfam | PF00008. EGF. 1 hit. PF00754. F5_F8_type_C. 2 hits. PF12661. hEGF. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00181. EGF. 2 hits. SM00231. FA58C. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF49785. Gal_bind_like. 2 hits. | ||||||||||||
| PROSITE | PS00022. EGF_1. 2 hits. PS01186. EGF_2. 2 hits. PS50026. EGF_3. 2 hits. PS01285. FA58C_1. 2 hits. PS01286. FA58C_2. 2 hits. PS50022. FA58C_3. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | MFGE8. mouse. | ||||||||||||
| NextBio | 291842. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MFGM_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P21956 Secondary accession number(s): P97800 Q9WTS3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
