Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lactadherin

Gene

Mfge8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction (By similarity). Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization.By similarity2 Publications

GO - Molecular functioni

  • integrin binding Source: BHF-UCL
  • phosphatidylethanolamine binding Source: MGI
  • phosphatidylserine binding Source: MGI

GO - Biological processi

  • angiogenesis Source: UniProtKB-KW
  • cell adhesion Source: UniProtKB-KW
  • phagocytosis, engulfment Source: MGI
  • phagocytosis, recognition Source: MGI
  • positive regulation of apoptotic cell clearance Source: BHF-UCL
  • positive regulation of phagocytosis Source: MGI
  • single fertilization Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Angiogenesis, Cell adhesion, Fertilization

Names & Taxonomyi

Protein namesi
Recommended name:
Lactadherin
Alternative name(s):
MFGM
Milk fat globule-EGF factor 8
Short name:
MFG-E8
SED1
Sperm surface protein SP47
Short name:
MP47
Gene namesi
Name:Mfge8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:102768. Mfge8.

Subcellular locationi

GO - Cellular componenti

  • external side of plasma membrane Source: MGI
  • extracellular exosome Source: MGI
  • extracellular matrix Source: Ensembl
  • extracellular space Source: MGI
  • extracellular vesicle Source: MGI
  • extrinsic component of plasma membrane Source: MGI
  • membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 221 PublicationAdd BLAST22
ChainiPRO_000000765323 – 463LactadherinAdd BLAST441

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi28 ↔ 39By similarity
Disulfide bondi33 ↔ 49By similarity
Disulfide bondi51 ↔ 60By similarity
Glycosylationi61N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi68 ↔ 79By similarity
Disulfide bondi73 ↔ 96By similarity
Disulfide bondi98 ↔ 107By similarity
Disulfide bondi148 ↔ 303By similarity
Glycosylationi266N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi290 ↔ 294By similarity
Disulfide bondi308 ↔ 4631 Publication
Glycosylationi316N-linked (GlcNAc...)Sequence analysis1
Glycosylationi426N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated. Isoform 1 also exists in both an O-glycosylated and a non-O-glycosylated form.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP21956.
PaxDbiP21956.
PeptideAtlasiP21956.
PRIDEiP21956.

PTM databases

PhosphoSitePlusiP21956.

Expressioni

Tissue specificityi

Mammary epithelial cell surfaces and spermatozoan. Isoform 2 is present in brain, heart, kidney and spleen and at low levels in lung, liver, small intestine and testis.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are detectable in mammary tissue from non-pregnant animals, with isoform 2 being predominant. Levels of isoform 1 increase during gestation and lactation while levels of isoform 2 decrease.2 Publications

Inductioni

Isoform 1 is induced by insulin, prolactin and hydrocortisone in mammary epithelial cells. Expression of isoform 2 is repressed by the same treatment.1 Publication

Gene expression databases

BgeeiENSMUSG00000030605.
CleanExiMM_MFGE8.
ExpressionAtlasiP21956. baseline and differential.
GenevisibleiP21956. MM.

Interactioni

GO - Molecular functioni

  • integrin binding Source: BHF-UCL

Protein-protein interaction databases

IntActiP21956. 1 interactor.
MINTiMINT-4101815.
STRINGi10090.ENSMUSP00000032825.

Structurei

Secondary structure

1463
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi312 – 316Combined sources5
Beta strandi323 – 327Combined sources5
Beta strandi346 – 348Combined sources3
Beta strandi350 – 352Combined sources3
Beta strandi355 – 357Combined sources3
Beta strandi359 – 362Combined sources4
Beta strandi367 – 384Combined sources18
Beta strandi393 – 406Combined sources14
Beta strandi414 – 416Combined sources3
Turni425 – 427Combined sources3
Beta strandi430 – 432Combined sources3
Beta strandi434 – 436Combined sources3
Beta strandi438 – 453Combined sources16
Beta strandi455 – 462Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L9LNMR-A306-463[»]
ProteinModelPortaliP21956.
SMRiP21956.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 61EGF-like 1PROSITE-ProRule annotationAdd BLAST38
Domaini64 – 108EGF-like 2PROSITE-ProRule annotationAdd BLAST45
Domaini148 – 303F5/8 type C 1PROSITE-ProRule annotationAdd BLAST156
Domaini308 – 463F5/8 type C 2PROSITE-ProRule annotationAdd BLAST156

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi87 – 89Cell attachment site3

Domaini

The F5/8 type C 2 domain mediates high-affinity binding to phosphatidylserine-containing membranes.

Sequence similaritiesi

Contains 2 EGF-like domains.PROSITE-ProRule annotation
Contains 2 F5/8 type C domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IFBC. Eukaryota.
ENOG41114BV. LUCA.
GeneTreeiENSGT00760000119073.
HOGENOMiHOG000236278.
HOVERGENiHBG002385.
InParanoidiP21956.
KOiK17253.
OMAiLDNNSHK.
OrthoDBiEOG091G071G.
TreeFamiTF330156.

Family and domain databases

Gene3Di2.60.120.260. 2 hits.
InterProiIPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000421. FA58C.
IPR008979. Galactose-bd-like.
IPR027060. Lactadherin.
[Graphical view]
PANTHERiPTHR10127:SF303. PTHR10127:SF303. 2 hits.
PfamiPF00008. EGF. 2 hits.
PF00754. F5_F8_type_C. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00231. FA58C. 2 hits.
[Graphical view]
SUPFAMiSSF49785. SSF49785. 2 hits.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01285. FA58C_1. 2 hits.
PS01286. FA58C_2. 2 hits.
PS50022. FA58C_3. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P21956-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQVSRVLAAL CGMLLCASGL FAASGDFCDS SLCLNGGTCL TGQDNDIYCL
60 70 80 90 100
CPEGFTGLVC NETERGPCSP NPCYNDAKCL VTLDTQRGDI FTEYICQCPV
110 120 130 140 150
GYSGIHCETE TNYYNLDGEY MFTTAVPNTA VPTPAPTPDL SNNLASRCST
160 170 180 190 200
QLGMEGGAIA DSQISASSVY MGFMGLQRWG PELARLYRTG IVNAWTASNY
210 220 230 240 250
DSKPWIQVNL LRKMRVSGVM TQGASRAGRA EYLKTFKVAY SLDGRKFEFI
260 270 280 290 300
QDESGGDKEF LGNLDNNSLK VNMFNPTLEA QYIKLYPVSC HRGCTLRFEL
310 320 330 340 350
LGCELHGCSE PLGLKNNTIP DSQMSASSSY KTWNLRAFGW YPHLGRLDNQ
360 370 380 390 400
GKINAWTAQS NSAKEWLQVD LGTQRQVTGI ITQGARDFGH IQYVASYKVA
410 420 430 440 450
HSDDGVQWTV YEEQGSSKVF QGNLDNNSHK KNIFEKPFMA RYVRVLPVSW
460
HNRITLRLEL LGC
Length:463
Mass (Da):51,241
Last modified:July 27, 2011 - v3
Checksum:i6E19CBB494B22878
GO
Isoform 2 (identifier: P21956-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     110-147: ETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASR → G

Show »
Length:426
Mass (Da):47,169
Checksum:i0882EDA89B95C445
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti35N → D AA sequence (PubMed:2122462).Curated1
Sequence conflicti168S → Y in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti196T → H in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti284K → R in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti284K → R in CAA72380 (PubMed:9546740).Curated1
Sequence conflicti284K → R in BAA35180 (PubMed:9920772).Curated1
Sequence conflicti284K → R in BAA76386 (PubMed:9920772).Curated1
Sequence conflicti284K → R in BAC40794 (PubMed:16141072).Curated1
Sequence conflicti284K → R in BAE42274 (PubMed:16141072).Curated1
Sequence conflicti284K → R in AAH03892 (PubMed:15489334).Curated1
Sequence conflicti284K → R in AAH03904 (PubMed:15489334).Curated1
Sequence conflicti309S → L in AAA39534 (PubMed:2122462).Curated1
Sequence conflicti395A → E in AAA39534 (PubMed:2122462).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009880110 – 147ETNYY…NLASR → G in isoform 2. 5 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M38337 mRNA. Translation: AAA39534.1.
Y11684 mRNA. Translation: CAA72380.2.
AB021130 mRNA. Translation: BAA35180.1.
AB025280 mRNA. Translation: BAA76386.1.
AK089211 mRNA. Translation: BAC40794.1.
AK152088 mRNA. Translation: BAE30938.1.
AK171143 mRNA. Translation: BAE42274.1.
BC003892 mRNA. Translation: AAH03892.1.
BC003904 mRNA. Translation: AAH03904.1.
CCDSiCCDS21379.1. [P21956-1]
CCDS39989.1. [P21956-2]
PIRiA36479.
RefSeqiNP_032620.2. NM_008594.2. [P21956-1]
UniGeneiMm.1451.

Genome annotation databases

EnsembliENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605. [P21956-1]
ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605. [P21956-2]
GeneIDi17304.
KEGGimmu:17304.
UCSCiuc009hxz.1. mouse. [P21956-1]
uc009hyb.1. mouse. [P21956-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M38337 mRNA. Translation: AAA39534.1.
Y11684 mRNA. Translation: CAA72380.2.
AB021130 mRNA. Translation: BAA35180.1.
AB025280 mRNA. Translation: BAA76386.1.
AK089211 mRNA. Translation: BAC40794.1.
AK152088 mRNA. Translation: BAE30938.1.
AK171143 mRNA. Translation: BAE42274.1.
BC003892 mRNA. Translation: AAH03892.1.
BC003904 mRNA. Translation: AAH03904.1.
CCDSiCCDS21379.1. [P21956-1]
CCDS39989.1. [P21956-2]
PIRiA36479.
RefSeqiNP_032620.2. NM_008594.2. [P21956-1]
UniGeneiMm.1451.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L9LNMR-A306-463[»]
ProteinModelPortaliP21956.
SMRiP21956.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP21956. 1 interactor.
MINTiMINT-4101815.
STRINGi10090.ENSMUSP00000032825.

PTM databases

PhosphoSitePlusiP21956.

Proteomic databases

MaxQBiP21956.
PaxDbiP21956.
PeptideAtlasiP21956.
PRIDEiP21956.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605. [P21956-1]
ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605. [P21956-2]
GeneIDi17304.
KEGGimmu:17304.
UCSCiuc009hxz.1. mouse. [P21956-1]
uc009hyb.1. mouse. [P21956-2]

Organism-specific databases

CTDi4240.
MGIiMGI:102768. Mfge8.

Phylogenomic databases

eggNOGiENOG410IFBC. Eukaryota.
ENOG41114BV. LUCA.
GeneTreeiENSGT00760000119073.
HOGENOMiHOG000236278.
HOVERGENiHBG002385.
InParanoidiP21956.
KOiK17253.
OMAiLDNNSHK.
OrthoDBiEOG091G071G.
TreeFamiTF330156.

Miscellaneous databases

ChiTaRSiMfge8. mouse.
PROiP21956.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030605.
CleanExiMM_MFGE8.
ExpressionAtlasiP21956. baseline and differential.
GenevisibleiP21956. MM.

Family and domain databases

Gene3Di2.60.120.260. 2 hits.
InterProiIPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000421. FA58C.
IPR008979. Galactose-bd-like.
IPR027060. Lactadherin.
[Graphical view]
PANTHERiPTHR10127:SF303. PTHR10127:SF303. 2 hits.
PfamiPF00008. EGF. 2 hits.
PF00754. F5_F8_type_C. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00231. FA58C. 2 hits.
[Graphical view]
SUPFAMiSSF49785. SSF49785. 2 hits.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01285. FA58C_1. 2 hits.
PS01286. FA58C_2. 2 hits.
PS50022. FA58C_3. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMFGM_MOUSE
AccessioniPrimary (citable) accession number: P21956
Secondary accession number(s): P97800
, Q3TBN5, Q3U8S9, Q9R1X9, Q9WTS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: July 27, 2011
Last modified: November 30, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.