SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P21956

- MFGM_MOUSE

UniProt

P21956 - MFGM_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Lactadherin
Gene
Mfge8
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction By similarity. Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization.2 Publications

GO - Molecular functioni

  1. integrin binding Source: BHF-UCL
  2. phosphatidylethanolamine binding Source: MGI
  3. phosphatidylserine binding Source: MGI
Complete GO annotation...

GO - Biological processi

  1. angiogenesis Source: UniProtKB-KW
  2. cell adhesion Source: UniProtKB-KW
  3. phagocytosis, engulfment Source: MGI
  4. phagocytosis, recognition Source: MGI
  5. positive regulation of apoptotic cell clearance Source: BHF-UCL
  6. positive regulation of phagocytosis Source: MGI
  7. single fertilization Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Angiogenesis, Cell adhesion, Fertilization

Enzyme and pathway databases

ReactomeiREACT_198563. Amyloids.

Names & Taxonomyi

Protein namesi
Recommended name:
Lactadherin
Alternative name(s):
MFGM
Milk fat globule-EGF factor 8
Short name:
MFG-E8
SED1
Sperm surface protein SP47
Short name:
MP47
Gene namesi
Name:Mfge8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:102768. Mfge8.

Subcellular locationi

Membrane; Peripheral membrane protein. Secreted 1 Publication

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. extracellular matrix Source: Ensembl
  3. extracellular space Source: MGI
  4. extracellular vesicular exosome Source: Ensembl
  5. extrinsic component of plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 22221 Publication
Add
BLAST
Chaini23 – 463441Lactadherin
PRO_0000007653Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi28 ↔ 39 By similarity
Disulfide bondi33 ↔ 49 By similarity
Disulfide bondi51 ↔ 60 By similarity
Glycosylationi61 – 611N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi68 ↔ 79 By similarity
Disulfide bondi73 ↔ 96 By similarity
Disulfide bondi98 ↔ 107 By similarity
Disulfide bondi148 ↔ 303 By similarity
Glycosylationi266 – 2661N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi290 ↔ 294 By similarity
Disulfide bondi308 ↔ 4631 Publication
Glycosylationi316 – 3161N-linked (GlcNAc...) Reviewed prediction
Glycosylationi426 – 4261N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N-glycosylated. Isoform 1 also exists in both an O-glycosylated and a non-O-glycosylated form.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP21956.
PaxDbiP21956.
PRIDEiP21956.

PTM databases

PhosphoSiteiP21956.

Expressioni

Tissue specificityi

Mammary epithelial cell surfaces and spermatozoan. Isoform 2 is present in brain, heart, kidney and spleen and at low levels in lung, liver, small intestine and testis.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are detectable in mammary tissue from non-pregnant animals, with isoform 2 being predominant. Levels of isoform 1 increase during gestation and lactation while levels of isoform 2 decrease.2 Publications

Inductioni

Isoform 1 is induced by insulin, prolactin and hydrocortisone in mammary epithelial cells. Expression of isoform 2 is repressed by the same treatment.1 Publication

Gene expression databases

ArrayExpressiP21956.
BgeeiP21956.
CleanExiMM_MFGE8.
GenevestigatoriP21956.

Interactioni

Protein-protein interaction databases

IntActiP21956. 1 interaction.
MINTiMINT-4101815.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi312 – 3165
Beta strandi323 – 3275
Beta strandi346 – 3483
Beta strandi350 – 3523
Beta strandi355 – 3573
Beta strandi359 – 3624
Beta strandi367 – 38418
Beta strandi393 – 40614
Beta strandi414 – 4163
Turni425 – 4273
Beta strandi430 – 4323
Beta strandi434 – 4363
Beta strandi438 – 45316
Beta strandi455 – 4628

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2L9LNMR-A306-463[»]
ProteinModelPortaliP21956.
SMRiP21956. Positions 28-112, 145-463.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 6138EGF-like 1
Add
BLAST
Domaini64 – 10845EGF-like 2
Add
BLAST
Domaini148 – 303156F5/8 type C 1
Add
BLAST
Domaini308 – 463156F5/8 type C 2
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi87 – 893Cell attachment site

Domaini

The F5/8 type C 2 domain mediates high-affinity binding to phosphatidylserine-containing membranes.

Sequence similaritiesi

Contains 2 EGF-like domains.
Contains 2 F5/8 type C domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG151024.
GeneTreeiENSGT00740000114988.
HOGENOMiHOG000236278.
HOVERGENiHBG002385.
InParanoidiQ3U8S9.
KOiK17253.
OMAiVAWHNRI.
OrthoDBiEOG7ZWD1D.
TreeFamiTF330156.

Family and domain databases

Gene3Di2.60.120.260. 2 hits.
InterProiIPR000421. Coagulation_fac_5/8-C_type_dom.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR008979. Galactose-bd-like.
IPR027060. Lactadherin.
[Graphical view]
PANTHERiPTHR10127:SF303. PTHR10127:SF303. 1 hit.
PfamiPF00008. EGF. 2 hits.
PF00754. F5_F8_type_C. 2 hits.
PF12661. hEGF. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00231. FA58C. 2 hits.
[Graphical view]
SUPFAMiSSF49785. SSF49785. 2 hits.
PROSITEiPS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01285. FA58C_1. 2 hits.
PS01286. FA58C_2. 2 hits.
PS50022. FA58C_3. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P21956-1) [UniParc]FASTAAdd to Basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQVSRVLAAL CGMLLCASGL FAASGDFCDS SLCLNGGTCL TGQDNDIYCL    50
CPEGFTGLVC NETERGPCSP NPCYNDAKCL VTLDTQRGDI FTEYICQCPV 100
GYSGIHCETE TNYYNLDGEY MFTTAVPNTA VPTPAPTPDL SNNLASRCST 150
QLGMEGGAIA DSQISASSVY MGFMGLQRWG PELARLYRTG IVNAWTASNY 200
DSKPWIQVNL LRKMRVSGVM TQGASRAGRA EYLKTFKVAY SLDGRKFEFI 250
QDESGGDKEF LGNLDNNSLK VNMFNPTLEA QYIKLYPVSC HRGCTLRFEL 300
LGCELHGCSE PLGLKNNTIP DSQMSASSSY KTWNLRAFGW YPHLGRLDNQ 350
GKINAWTAQS NSAKEWLQVD LGTQRQVTGI ITQGARDFGH IQYVASYKVA 400
HSDDGVQWTV YEEQGSSKVF QGNLDNNSHK KNIFEKPFMA RYVRVLPVSW 450
HNRITLRLEL LGC 463
Length:463
Mass (Da):51,241
Last modified:July 27, 2011 - v3
Checksum:i6E19CBB494B22878
GO
Isoform 2 (identifier: P21956-2) [UniParc]FASTAAdd to Basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     110-147: ETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASR → G

Show »
Length:426
Mass (Da):47,169
Checksum:i0882EDA89B95C445
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei110 – 14738ETNYY…NLASR → G in isoform 2.
VSP_009880Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti35 – 351N → D AA sequence 1 Publication
Sequence conflicti168 – 1681S → Y in AAA39534. 1 Publication
Sequence conflicti196 – 1961T → H in AAA39534. 1 Publication
Sequence conflicti284 – 2841K → R in AAA39534. 1 Publication
Sequence conflicti284 – 2841K → R in CAA72380. 1 Publication
Sequence conflicti284 – 2841K → R in BAA35180. 1 Publication
Sequence conflicti284 – 2841K → R in BAA76386. 1 Publication
Sequence conflicti284 – 2841K → R in BAC40794. 1 Publication
Sequence conflicti284 – 2841K → R in BAE42274. 1 Publication
Sequence conflicti284 – 2841K → R in AAH03892. 1 Publication
Sequence conflicti284 – 2841K → R in AAH03904. 1 Publication
Sequence conflicti309 – 3091S → L in AAA39534. 1 Publication
Sequence conflicti395 – 3951A → E in AAA39534. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M38337 mRNA. Translation: AAA39534.1.
Y11684 mRNA. Translation: CAA72380.2.
AB021130 mRNA. Translation: BAA35180.1.
AB025280 mRNA. Translation: BAA76386.1.
AK089211 mRNA. Translation: BAC40794.1.
AK152088 mRNA. Translation: BAE30938.1.
AK171143 mRNA. Translation: BAE42274.1.
BC003892 mRNA. Translation: AAH03892.1.
BC003904 mRNA. Translation: AAH03904.1.
CCDSiCCDS21379.1. [P21956-1]
CCDS39989.1. [P21956-2]
PIRiA36479.
RefSeqiNP_032620.2. NM_008594.2. [P21956-1]
UniGeneiMm.1451.

Genome annotation databases

EnsembliENSMUST00000032825; ENSMUSP00000032825; ENSMUSG00000030605. [P21956-1]
ENSMUST00000107409; ENSMUSP00000103032; ENSMUSG00000030605. [P21956-2]
GeneIDi17304.
KEGGimmu:17304.
UCSCiuc009hxz.1. mouse. [P21956-1]
uc009hyb.1. mouse. [P21956-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M38337 mRNA. Translation: AAA39534.1 .
Y11684 mRNA. Translation: CAA72380.2 .
AB021130 mRNA. Translation: BAA35180.1 .
AB025280 mRNA. Translation: BAA76386.1 .
AK089211 mRNA. Translation: BAC40794.1 .
AK152088 mRNA. Translation: BAE30938.1 .
AK171143 mRNA. Translation: BAE42274.1 .
BC003892 mRNA. Translation: AAH03892.1 .
BC003904 mRNA. Translation: AAH03904.1 .
CCDSi CCDS21379.1. [P21956-1 ]
CCDS39989.1. [P21956-2 ]
PIRi A36479.
RefSeqi NP_032620.2. NM_008594.2. [P21956-1 ]
UniGenei Mm.1451.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2L9L NMR - A 306-463 [» ]
ProteinModelPortali P21956.
SMRi P21956. Positions 28-112, 145-463.
ModBasei Search...

Protein-protein interaction databases

IntActi P21956. 1 interaction.
MINTi MINT-4101815.

PTM databases

PhosphoSitei P21956.

Proteomic databases

MaxQBi P21956.
PaxDbi P21956.
PRIDEi P21956.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000032825 ; ENSMUSP00000032825 ; ENSMUSG00000030605 . [P21956-1 ]
ENSMUST00000107409 ; ENSMUSP00000103032 ; ENSMUSG00000030605 . [P21956-2 ]
GeneIDi 17304.
KEGGi mmu:17304.
UCSCi uc009hxz.1. mouse. [P21956-1 ]
uc009hyb.1. mouse. [P21956-2 ]

Organism-specific databases

CTDi 4240.
MGIi MGI:102768. Mfge8.

Phylogenomic databases

eggNOGi NOG151024.
GeneTreei ENSGT00740000114988.
HOGENOMi HOG000236278.
HOVERGENi HBG002385.
InParanoidi Q3U8S9.
KOi K17253.
OMAi VAWHNRI.
OrthoDBi EOG7ZWD1D.
TreeFami TF330156.

Enzyme and pathway databases

Reactomei REACT_198563. Amyloids.

Miscellaneous databases

ChiTaRSi MFGE8. mouse.
NextBioi 291842.
PROi P21956.
SOURCEi Search...

Gene expression databases

ArrayExpressi P21956.
Bgeei P21956.
CleanExi MM_MFGE8.
Genevestigatori P21956.

Family and domain databases

Gene3Di 2.60.120.260. 2 hits.
InterProi IPR000421. Coagulation_fac_5/8-C_type_dom.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR008979. Galactose-bd-like.
IPR027060. Lactadherin.
[Graphical view ]
PANTHERi PTHR10127:SF303. PTHR10127:SF303. 1 hit.
Pfami PF00008. EGF. 2 hits.
PF00754. F5_F8_type_C. 2 hits.
PF12661. hEGF. 1 hit.
[Graphical view ]
SMARTi SM00181. EGF. 2 hits.
SM00231. FA58C. 2 hits.
[Graphical view ]
SUPFAMi SSF49785. SSF49785. 2 hits.
PROSITEi PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01285. FA58C_1. 2 hits.
PS01286. FA58C_2. 2 hits.
PS50022. FA58C_3. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning of a mouse mammary epithelial cell surface protein reveals the existence of epidermal growth factor-like domains linked to factor VIII-like sequences."
    Stubbs J.D., Lekutis C., Singer K.L., Bui A., Yuzuki D., Srinivasan U., Parry G.
    Proc. Natl. Acad. Sci. U.S.A. 87:8417-8421(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 23-35, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
    Strain: BALB/c.
    Tissue: Mammary gland.
  2. Ensslin M.A.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Molecular cloning and characterization of P47, a novel boar sperm-associated zona pellucida-binding protein homologous to a family of mammalian secretory proteins."
    Ensslin M.A., Vogel T., Calvete J.J., Thole H.H., Schmidtke J., Matsuda T., Toepfer-Petersen E.
    Biol. Reprod. 58:1057-1064(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 23-463 (ISOFORM 2).
    Tissue: Testis.
  4. "Lactation-dependent expression of an mRNA splice variant with an exon for a multiply O-glycosylated domain of mouse milk fat globule glycoprotein MFG-E8."
    Oshima K., Aoki N., Negi M., Kishi M., Kitajima K., Matsuda T.
    Biochem. Biophys. Res. Commun. 254:522-528(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION, GLYCOSYLATION.
    Strain: BALB/c.
    Tissue: Mammary gland.
  5. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow and Dendritic cell.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary gland.
  7. Cited for: INTERACTION WITH ITGB3 AND ITGB5, FUNCTION IN NEOVASCULARIZATION.
  8. "Milk fat globule-EGF factor 8/lactadherin plays a crucial role in maintenance and repair of murine intestinal epithelium."
    Bu H.F., Zuo X.L., Wang X., Ensslin M.A., Koti V., Hsueh W., Raymond A.S., Shur B.D., Tan X.D.
    J. Clin. Invest. 117:3673-3683(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN GUT EPITHELIAL REPAIR.
  9. "NMR solution structure of C2 domain of MFG-E8 and insights into its molecular recognition with phosphatidylserine."
    Ye H., Li B., Subramanian V., Choi B.H., Liang Y., Harikishore A., Chakraborty G., Baek K., Yoon H.S.
    Biochim. Biophys. Acta 1828:1083-1093(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 306-463, DISULFIDE BOND.

Entry informationi

Entry nameiMFGM_MOUSE
AccessioniPrimary (citable) accession number: P21956
Secondary accession number(s): P97800
, Q3TBN5, Q3U8S9, Q9R1X9, Q9WTS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1991
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi