P21802 (FGFR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 166.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibroblast growth factor receptor 2 Short name=FGFR-2 EC=2.7.10.1 Alternative name(s): K-sam Short name=KGFR Keratinocyte growth factor receptor CD_antigen=CD332 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 821 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation, migration and apoptosis, and in the regulation of embryonic development. Required for normal embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis and skin development. Plays an essential role in the regulation of osteoblast differentiation, proliferation and apoptosis, and is required for normal skeleton development. Promotes cell proliferation in keratinocytes and imature osteoblasts, but promotes apoptosis in differentiated osteoblasts. Phosphorylates PLCG1, FRS2 and PAK4. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. FGFR2 signaling is down-regulated by ubiquitination, internalization and degradation. Mutations that lead to constitutive kinase activation or impair normal FGFR2 maturation, internalization and degradation lead to aberrant signaling. Over-expressed FGFR2 promotes activation of STAT1. Ref.25 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.32 Ref.33 Ref.34 Ref.35 Ref.36 Ref.38 Ref.40 Ref.47 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.31 Ref.35 Ref.49 Ref.51 |
| Enzyme regulation | Present in an inactive conformation in the absence of bound ligand. Ligand binding leads to dimerization and activation by autophosphorylation on tyrosine residues. Inhibited by ARQ 523 and ARQ 069; these compounds maintain the kinase in an inactive conformation and inhibit autophosphorylation. Ref.48 Ref.51 |
| Subunit structure | Monomer. Homodimer after ligand binding. Interacts predominantly with FGF1 and FGF2, but can also interact with FGF3, FGF4, FGF6, FGF7, FGF8, FGF9, FGF10, FGF17, FGF18 and FGF22 (in vitro). Ligand specificity is determined by tissue-specific expression of isoforms, and differences in the third Ig-like domain are crucial for ligand specificity. Isoform 1 has high affinity for FGF1 and FGF2, but low affinity for FGF7. Isoform 3 has high affinity for FGF1 and FGF7, and has much higher affinity for FGF7 than isoform 1 (in vitro). Affinity for fibroblast growth factors (FGFs) is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Likewise, KLB increases the affinity for FGF19 and FGF21. Interacts with PLCG1, GRB2 and PAK4. Ref.6 Ref.7 Ref.25 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.32 Ref.36 Ref.43 Ref.47 Ref.49 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Golgi apparatus. Cytoplasmic vesicle. Note: Detected on osteoblast plasma membrane lipid rafts. After ligand binding, the activated receptor is rapidly internalized and degraded. Ref.31 Ref.33 Ref.34 Ref.36 Isoform 1: Cell membrane; Single-pass type I membrane protein. Note: After ligand binding, the activated receptor is rapidly internalized and degraded. Ref.31 Ref.33 Ref.34 Ref.36 Isoform 3: Cell membrane; Single-pass type I membrane protein. Note: After ligand binding, the activated receptor is rapidly internalized and degraded. Ref.31 Ref.33 Ref.34 Ref.36 |
| Domain | The second and third Ig-like domains directly interact with fibroblast growth factors (FGF) and heparan sulfate proteoglycans. Alternative splicing events affecting the third Ig-like domain are crucial for ligand selectivity. Ref.6 Ref.7 Ref.25 |
| Post-translational modification | Autophosphorylated. Binding of FGF family members together with heparan sulfate proteoglycan or heparin promotes receptor dimerization and autophosphorylation on several tyrosine residues. Autophosphorylation occurs in trans between the two FGFR molecules present in the dimer. Phosphorylation at Tyr-769 is essential for interaction with PLCG1. Ref.27 Ref.28 Ref.29 Ref.31 Ref.32 Ref.33 Ref.35 Ref.36 Ref.37 Ref.48 Ref.49 Ref.50 Ref.51 N-glycosylated in the endoplasmic reticulum. The N-glycan chains undergo further maturation to an Endo H-resistant form in the Golgi apparatus. Ref.31 Ref.33 Ubiquitinated. FGFR2 is rapidly ubiquitinated after autophosphorylation, leading to internalization and degradation. Subject to degradation both in lysosomes and by the proteasome. Ref.28 Ref.31 Ref.38 |
| Involvement in disease | Defects in FGFR2 are the cause of Crouzon syndrome (CS) [MIM:123500]; also called craniofacial dysostosis type I (CFD1). CS is an autosomal dominant syndrome characterized by craniosynostosis (premature fusion of the skull sutures), hypertelorism, exophthalmos and external strabismus, parrot-beaked nose, short upper lip, hypoplastic maxilla, and a relative mandibular prognathism. Ref.10 Ref.24 Ref.40 Ref.48 Ref.52 Ref.53 Ref.54 Ref.55 Ref.59 Ref.60 Ref.61 Ref.65 Ref.66 Ref.67 Ref.68 Ref.72 Ref.75 Ref.78 Ref.79 Defects in FGFR2 are a cause of Jackson-Weiss syndrome (JWS) [MIM:123150]. JWS is an autosomal dominant craniosynostosis syndrome characterized by craniofacial abnormalities and abnormality of the feet: broad great toes with medial deviation and tarsal-metatarsal coalescence. Ref.40 Ref.53 Ref.55 Ref.59 Ref.64 Ref.67 Defects in FGFR2 are a cause of Apert syndrome (APRS) [MIM:101200]; also known as acrocephalosyndactyly type 1 (ACS1). APRS is a syndrome characterized by facio-cranio-synostosis, osseous and membranous syndactyly of the four extremities, and midface hypoplasia. The craniosynostosis is bicoronal and results in acrocephaly of brachysphenocephalic type. Syndactyly of the fingers and toes may be total (mitten hands and sock feet) or partial affecting the second, third, and fourth digits. Intellectual deficit is frequent and often severe, usually being associated with cerebral malformations. Ref.21 Ref.28 Ref.40 Ref.45 Ref.57 Ref.65 Ref.67 Ref.69 Ref.79 Defects in FGFR2 are a cause of Pfeiffer syndrome (PS) [MIM:101600]; also known as acrocephalosyndactyly type V (ACS5). PS is characterized by craniosynostosis (premature fusion of the skull sutures) with deviation and enlargement of the thumbs and great toes, brachymesophalangy, with phalangeal ankylosis and a varying degree of soft tissue syndactyly. Three subtypes of Pfeiffer syndrome have been described: mild autosomal dominant form (type 1); cloverleaf skull, elbow ankylosis, early death, sporadic (type 2); craniosynostosis, early demise, sporadic (type 3). Ref.31 Ref.40 Ref.48 Ref.56 Ref.58 Ref.59 Ref.63 Ref.65 Ref.70 Ref.71 Ref.73 Ref.74 Ref.75 Ref.79 Defects in FGFR2 are the cause of Beare-Stevenson cutis gyrata syndrome (BSCGS) [MIM:123790]. BSCGS is an autosomal dominant condition is characterized by the furrowed skin disorder of cutis gyrata, acanthosis nigricans, craniosynostosis, craniofacial dysmorphism, digital anomalies, umbilical and anogenital abnormalities and early death. Ref.40 Ref.62 Ref.80 Defects in FGFR2 are the cause of familial scaphocephaly syndrome (FSPC) [MIM:609579]; also known as scaphocephaly with maxillary retrusion and mental retardation. FSPC is an autosomal dominant craniosynostosis syndrome characterized by scaphocephaly, macrocephaly, hypertelorism, maxillary retrusion, and mild intellectual disability. Scaphocephaly is the most common of the craniosynostosis conditions and is characterized by a long, narrow head. It is due to premature fusion of the sagittal suture or from external deformation. Ref.40 Ref.48 Ref.81 Defects in FGFR2 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS) [MIM:149730]; also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system and abnormal genitalia have been reported. Craniosynostosis and severe syndactyly are not observed. Ref.40 Ref.49 Ref.82 Defects in FGFR2 are the cause of Antley-Bixler syndrome without genital anomalies or disordered steroidogenesis (ABS2) [MIM:207410]. A rare syndrome characterized by craniosynostosis, radiohumeral synostosis present from the perinatal period, midface hypoplasia, choanal stenosis or atresia, femoral bowing and multiple joint contractures. Arachnodactyly and/or camptodactyly have also been reported. Ref.40 Ref.77 |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAG57383.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FGF1 | P05230 | 2 | EBI-1028658,EBI-698068 | |
| FGF2 | P09038 | 3 | EBI-1028658,EBI-977447 |
Alternative products
| This entry describes 23 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P21802-1) Also known as: BEK; FGFR2IIIc; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: P21802-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 768-821: EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → I | |||||||||
| Isoform 3 (identifier: P21802-3) Also known as: BFR-1; FGFR2IIIb; KGFR; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ | |||||||||
| Isoform 4 (identifier: P21802-4) Also known as: K-sam; The sequence of this isoform differs from the canonical sequence as follows: 37-125: Missing. 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 428-429: Missing. 761-821: LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → PPNPSLMSIFRK | |||||||||
| Isoform 5 (identifier: P21802-5) Also known as: K-sam-I; BEK; IgIIIc; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. | |||||||||
| Isoform 6 (identifier: P21802-6) Also known as: K-sam-IIC2; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. 778-821: QYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → PYSPCYPDPR | |||||||||
| Isoform 7 (identifier: P21802-7) Also known as: K-sam-IIO2; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLE...YPHINGSVKT → RYKLLPCPDK...RVRQEKISTG | |||||||||
| Isoform 8 (identifier: P21802-8) Also known as: K-sam-IIC3; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. 768-821: EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → I | |||||||||
| Isoform 9 (identifier: P21802-9) Also known as: K-sam-IIH1; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLE...YPHINGSVKT → RILTLTTNEN...LADTGSKVPN | |||||||||
| Isoform 10 (identifier: P21802-10) Also known as: K-sam-IIH2; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLE...YPHINGSVKT → SFQSSLKSSS...CAGSKKIYDI | |||||||||
| Isoform 11 (identifier: P21802-11) Also known as: K-sam-IIH3; K-sam-IIO4; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLE...YPHINGSVKT → GRLPAWASQE...SQGLPQSVVP | |||||||||
| Isoform 12 (identifier: P21802-12) Also known as: K-sam-IIO1; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → PLS | |||||||||
| Isoform 13 (identifier: P21802-13) Also known as: K-sam-IIO3; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: Missing. | |||||||||
| Isoform 14 (identifier: P21802-14) Also known as: K-sam-IV; Soluble KGFR; The sequence of this isoform differs from the canonical sequence as follows: 250-254: ERSPH → GSQGL 255-821: Missing. | |||||||||
| Isoform 15 (identifier: P21802-15) Also known as: K-sam-III; The sequence of this isoform differs from the canonical sequence as follows: 314-429: Missing. | |||||||||
| Isoform 16 (identifier: P21802-16) Also known as: TK14; The sequence of this isoform differs from the canonical sequence as follows: 313-313: K → KVTK 428-429: Missing. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 315 | 1 | T → L in AAA61188. Ref.2 | ||||||
| Isoform 17 (identifier: P21802-17) The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → I | |||||||||
| Isoform 18 (identifier: P21802-18) Also known as: K-sam-IIC1; KGFR; IgIIIb; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 428-429: Missing. | |||||||||
| Isoform 19 (identifier: P21802-19) Also known as: Soluble KGFR; The sequence of this isoform differs from the canonical sequence as follows: 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 362-365: APGR → GRRC 366-821: Missing. | |||||||||
| Isoform 20 (identifier: P21802-20) The sequence of this isoform differs from the canonical sequence as follows: 37-152: EPPTKYQISQ...FVSENSNNKR → G 429-430: Missing. | |||||||||
| Isoform 21 (identifier: P21802-21) The sequence of this isoform differs from the canonical sequence as follows: 37-125: Missing. 769-821: YLDLSQPLEQ...YPHINGSVKT → EKKVSGAVDCHKPPCNPSHLPCVLAVDQ | |||||||||
| Isoform 22 (identifier: P21802-22) The sequence of this isoform differs from the canonical sequence as follows: 37-125: Missing. 314-330: AAGVNTTDKEIEVLYIR → HSGINSSNAEVLALF 334-335: FE → EA 341-353: TCLAGNSIGISFH → ICKVSNYIGQANQ 361-361: P → PKQQ 768-821: EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT → I | |||||||||
| Isoform 23 (identifier: P21802-23) The sequence of this isoform differs from the canonical sequence as follows: 250-361: Missing. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 22 – 821 | 800 | Fibroblast growth factor receptor 2 | PRO_0000016783 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 22 – 377 | 356 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 378 – 398 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 399 – 821 | 423 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 25 – 125 | 101 | Ig-like C2-type 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 154 – 247 | 94 | Ig-like C2-type 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 256 – 358 | 103 | Ig-like C2-type 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 481 – 770 | 290 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 487 – 495 | 9 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 565 – 567 | 3 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 161 – 178 | 18 | Heparin-binding | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 626 | 1 | Proton acceptor Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 517 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 571 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 448 | 1 | Phosphothreonine Ref.37 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 449 | 1 | Phosphothreonine Ref.37 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 466 | 1 | Phosphotyrosine; by autocatalysis Ref.35 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 586 | 1 | Phosphotyrosine; by autocatalysis Ref.35 Ref.48 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 588 | 1 | Phosphotyrosine; by autocatalysis Ref.35 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 656 | 1 | Phosphotyrosine; by autocatalysis Ref.35 Ref.48 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 657 | 1 | Phosphotyrosine; by autocatalysis Ref.35 Ref.48 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 769 | 1 | Phosphotyrosine; by autocatalysis Ref.29 Ref.50 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 123 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 228 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 241 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 265 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 297 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 318 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 331 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 62 ↔ 107 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 179 ↔ 231 | Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 278 ↔ 342 | Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 37 – 152 | 116 | EPPTK…SNNKR → G in isoform 20. | VSP_019608 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 37 – 125 | 89 | Missing in isoform 4, isoform 21 and isoform 22. | VSP_002964 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 250 – 361 | 112 | Missing in isoform 23. | VSP_041914 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 250 – 254 | 5 | ERSPH → GSQGL in isoform 14. | VSP_002965 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 255 – 821 | 567 | Missing in isoform 14. | VSP_002966 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 313 | 1 | K → KVTK in isoform 16. | VSP_002967 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 314 – 429 | 116 | Missing in isoform 15. | VSP_002968 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 314 – 330 | 17 | AAGVN…VLYIR → HSGINSSNAEVLALF in isoform 3, isoform 4, isoform 7, isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 17, isoform 18, isoform 19 and isoform 22. | VSP_002969 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 334 – 335 | 2 | FE → EA in isoform 3, isoform 4, isoform 7, isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 17, isoform 18, isoform 19 and isoform 22. | VSP_002970 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 341 – 353 | 13 | TCLAG…GISFH → ICKVSNYIGQANQ in isoform 3, isoform 4, isoform 7, isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 17, isoform 18, isoform 19 and isoform 22. | VSP_002971 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 361 | 1 | P → PKQQ in isoform 3, isoform 4, isoform 7, isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 17, isoform 18, isoform 19 and isoform 22. | VSP_002972 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 362 – 365 | 4 | APGR → GRRC in isoform 19. | VSP_002973 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 366 – 821 | 456 | Missing in isoform 19. | VSP_002974 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 428 – 429 | 2 | Missing in isoform 4, isoform 5, isoform 6, isoform 8, isoform 16 and isoform 18. | VSP_002975 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 429 – 430 | 2 | Missing in isoform 20. | VSP_019609 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 761 – 821 | 61 | LTLTT…GSVKT → PPNPSLMSIFRK in isoform 4. | VSP_002976 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → SFQSSLKSSSTGIPGWPPGS EVFSEVAFRGILNYDIERPI LCAGSKKIYDI in isoform 10. | VSP_002981 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → GRLPAWASQEKENSQTSLFA ISHVTLSSISKTRSSAKRDE KPGSSPHLALVRSQGLPQSV VP in isoform 11. | VSP_002982 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → PLS in isoform 12. | VSP_002983 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | Missing in isoform 13. | VSP_002977 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → I in isoform 2, isoform 8, isoform 17 and isoform 22. | VSP_002978 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → RYKLLPCPDKHNKRCKPEER GDLTEAGAAGSSRCVDSRKR VRQEKISTG in isoform 7. | VSP_002979 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 768 – 821 | 54 | EYLDL…GSVKT → RILTLTTNENFQSTSGREGT EIHALQCLRSEVTPAISCES PLADTGSKVPN in isoform 9. | VSP_002980 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 769 – 821 | 53 | YLDLS…GSVKT → EKKVSGAVDCHKPPCNPSHL PCVLAVDQ in isoform 21. | VSP_041915 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 778 – 821 | 44 | QYSPS…GSVKT → PYSPCYPDPR in isoform 6. | VSP_002984 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 6 | 1 | R → P. Ref.15 Corresponds to variant rs3750819 [ dbSNP | Ensembl ]. | VAR_017258 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 57 | 1 | S → L. Ref.84 Corresponds to variant rs56226109 [ dbSNP | Ensembl ]. | VAR_042204 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 105 | 1 | Y → C in CS. Ref.60 Ref.79 | VAR_004112 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 172 | 1 | A → F in PS; requires 2 nucleotide substitutions. Ref.79 | VAR_017259 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 186 | 1 | M → T. Ref.15 Ref.79 Ref.84 Corresponds to variant rs755793 [ dbSNP | Ensembl ]. | VAR_017260 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 203 | 1 | R → C in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. Ref.83 Ref.84 | VAR_036380 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 – 253 | 2 | SP → FS in PS. | VAR_004116 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | S → F in APRS; requires 2 nucleotide substitutions. Ref.65 | VAR_004114 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | S → L in CS. Ref.65 | VAR_004113 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | S → W in APRS and PS; common mutation. Ref.21 Ref.28 Ref.45 Ref.57 Ref.67 Ref.69 Ref.71 Ref.79 | VAR_004115 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 253 | 1 | P → R in APRS; common mutation. Ref.21 Ref.45 Ref.57 Ref.67 Ref.69 Ref.79 | VAR_004117 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | P → L in CS. Ref.75 | VAR_017261 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | S → P in CS. Ref.79 | VAR_004118 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 268 | 1 | T → TG in CS. Ref.59 | VAR_004119 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 272 | 1 | G → V in an ovarian serous carcinoma sample; somatic mutation. Ref.84 | VAR_042205 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | Missing in PS; type 2. | VAR_017262 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 276 | 1 | F → V in CS. Ref.68 Ref.75 Ref.79 | VAR_004120 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | C → F in CS, JWS and PS; forms disulfide-linked dimers with constitutive kinase activity, is retained in an intracellular compartment and not detected at the cell surface. Ref.31 Ref.59 Ref.67 Ref.75 Ref.79 | VAR_004121 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | C → Y in CS. Ref.75 | VAR_017263 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 281 | 1 | Y → C in CS. Ref.78 Ref.79 | VAR_017264 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 283 | 1 | D → N in a lung squamous cell carcinoma sample; somatic mutation. Ref.84 | VAR_042206 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 287 – 289 | 3 | Missing in CS. | VAR_004122 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | I → S in CS. Ref.75 | VAR_017265 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 289 | 1 | Q → P in CS and JWS. Ref.24 Ref.59 Ref.75 Ref.78 Ref.79 | VAR_004123 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 290 | 1 | W → C in PS; severe; also in a lung squamous cell carcinoma sample; somatic mutation. Ref.63 Ref.79 Ref.84 | VAR_004124 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 290 | 1 | W → G in CS. Ref.55 | VAR_017266 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 290 | 1 | W → R in CS. | VAR_004125 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | K → E in CS. Ref.66 | VAR_004126 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 301 | 1 | Y → C in CS. Ref.68 | VAR_004127 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 314 | 1 | A → S in craniosynostosis. Ref.68 | VAR_004128 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 315 | 1 | A → S in a non-syndromic craniosynostosis patient with abnormal intrauterine history; confers predisposition to craniosynostosis. Ref.76 Ref.79 | VAR_017267 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 321 | 1 | D → A in PS. Ref.56 | VAR_004129 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 328 | 1 | Y → C in CS. Ref.53 | VAR_004130 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 331 | 1 | N → I in CS. Ref.61 | VAR_004131 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 337 | 1 | A → ANA in CS. | VAR_004132 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 337 | 1 | A → P in CS. Ref.67 | VAR_017268 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 338 | 1 | G → E in CS. Ref.60 | VAR_004133 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 338 | 1 | G → R in CS. Ref.24 Ref.67 Ref.79 | VAR_015011 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 340 | 1 | Y → C in PS. Ref.73 Ref.79 | VAR_017269 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 340 | 1 | Y → H in CS. Ref.52 Ref.79 | VAR_004134 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 341 | 1 | T → P in PS and CS. Ref.58 Ref.75 Ref.79 | VAR_004135 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → F in CS. Ref.59 Ref.67 Ref.79 | VAR_004136 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → G in PS. Ref.73 | VAR_017270 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → R in CS, JWS, PS and ABS2. Ref.52 Ref.55 Ref.58 Ref.59 Ref.67 Ref.75 Ref.77 Ref.78 Ref.79 | VAR_004137 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → S in CS, JWS, PS and ABS2. Ref.10 Ref.24 Ref.52 Ref.59 Ref.64 Ref.75 Ref.77 Ref.79 | VAR_004138 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → W in CS. Ref.55 Ref.75 Ref.79 | VAR_017271 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | C → Y in CS and PS. Ref.24 Ref.52 Ref.58 Ref.59 Ref.67 Ref.75 Ref.78 Ref.79 | VAR_004139 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 344 | 1 | A → G in CS and JWS. Ref.24 Ref.53 | VAR_004140 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 344 | 1 | A → P in CS and PS. Ref.59 | VAR_004141 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | S → C in CS. Ref.53 Ref.79 | VAR_004142 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 351 | 1 | S → C in CS, PS and ABS2. Ref.60 Ref.70 Ref.77 | VAR_004143 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 354 | 1 | S → C in CS. Ref.24 Ref.52 Ref.55 Ref.75 Ref.79 | VAR_004144 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 354 | 1 | S → Y in CS. Ref.75 | VAR_017272 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 356 – 358 | 3 | Missing in CS. | VAR_004145 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 359 | 1 | V → F in CS and PS. Ref.59 Ref.75 | VAR_004146 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 362 | 1 | A → S in CS. Ref.72 | VAR_017273 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 372 | 1 | S → C in Beare-Stevenson cutis gyrata syndrome. Ref.62 | VAR_017274 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 375 | 1 | Y → C in PS and Beare-Stevenson cutis gyrata syndrome. Ref.62 Ref.79 Ref.80 | VAR_017275 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 384 | 1 | G → R in CS. Ref.60 | VAR_004147 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 526 | 1 | K → E in FSPC; constitutive kinase activity. Ref.48 Ref.81 | VAR_023788 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 549 | 1 | N → H in CS; constitutive kinase activity. Ref.48 Ref.79 | VAR_017276 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 565 | 1 | E → G in PS; constitutive kinase activity. Ref.48 Ref.79 | VAR_017277 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 612 | 1 | R → T in a lung adenocarcinoma sample; somatic mutation. Ref.84 | VAR_046071 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 613 | 1 | G → R. Ref.7 Ref.11 | VAR_015012 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 628 | 1 | A → T in LADDS; strongly reduced kinase activity. Ref.49 Ref.82 | VAR_029884 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | K → R in PS; constitutive kinase activity. Ref.48 Ref.79 | VAR_017278 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 648 | 1 | A → T in LADDS. Ref.82 | VAR_029885 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 649 – 650 | 2 | RD → S in LADDS. | VAR_029886 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 659 | 1 | K → N in craniosynostosis; constitutive kinase activity. Ref.48 Ref.79 | VAR_017279 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 663 | 1 | G → E in PS. Ref.79 | VAR_017280 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 678 | 1 | R → G in CS. Ref.79 | VAR_017281 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 265 | 1 | N → Q: Reduced N-glycosylation. Reduced expression at the cell surface. Ref.31 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 549 | 1 | N → T: Constitutive kinase activity. Ref.48 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 565 | 1 | E → A: Constitutive kinase activity. Ref.48 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 656 – 657 | 2 | Missing: Loss of kinase activity. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 769 | 1 | Y → F: Increases fibroblast proliferation. Decreases phosphorylation of PLCG1 and FRS2. Decreases activation of MAP kinases. Ref.29 Ref.36 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 246 | 1 | L → P in BAG57383. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 310 | 1 | K → N in BAG57383. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 153 – 157 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 160 – 162 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 170 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 178 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 185 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 193 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 211 – 213 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 215 – 218 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 225 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 235 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 238 – 249 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 269 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 277 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 287 – 293 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 309 – 314 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 325 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 326 – 329 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 338 – 345 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 360 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 472 – 474 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 478 – 480 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 481 – 489 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 491 – 501 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 511 – 518 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 525 – 541 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 550 – 554 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 556 – 559 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 561 – 565 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 572 – 578 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 600 – 619 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 632 – 634 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 640 – 642 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 657 – 659 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 667 – 669 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 672 – 676 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 682 – 697 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 709 – 718 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 730 – 739 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 744 – 746 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 750 – 762 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of two distinct high-affinity receptors cross-reacting with acidic and basic fibroblast growth factors." Dionne C.A., Crumley G.R., Bellot F., Kaplow J.M., Searfoss G., Ruta M., Burgess W.H., Jaye M., Schlessinger J. EMBO J. 9:2685-2692(1990) [PubMed: 1697263] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Neonatal brain stem. |
| [2] | "Related fibroblast growth factor receptor genes exist in the human genome." Houssaint E., Blanquet P.R., Champion-Arnaud P., Gesnel M.-C., Torriglia A., Courtois Y., Breathnach R. Proc. Natl. Acad. Sci. U.S.A. 87:8180-8184(1990) [PubMed: 2172978] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 16). |
| [3] | "Two cDNAs encoding novel human FGF receptor." Seno M., Sasada R., Watanabe T., Ishimaru K., Igarashi K. Biochim. Biophys. Acta 1089:244-246(1991) [PubMed: 1647213] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 17). |
| [4] | "K-sam, an amplified gene in stomach cancer, is a member of the heparin-binding growth factor receptor genes." Hattori Y., Odagiri H., Nakatani H., Miyagawa K., Naito K., Sakamoto H., Katoh O., Yoshida T., Sugimura T., Terada M. Proc. Natl. Acad. Sci. U.S.A. 87:5983-5987(1990) [PubMed: 2377625] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Stomach cancer. |
| [5] | "K-sam gene encodes secreted as well as transmembrane receptor tyrosine kinase." Katoh M., Hattori Y., Sasaki H., Tanaka M., Sugano K., Yazaki Y., Sugimura T., Terada M. Proc. Natl. Acad. Sci. U.S.A. 89:2960-2964(1992) [PubMed: 1313574] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 14 AND 15). |
| [6] | "A novel form of fibroblast growth factor receptor 2. Alternative splicing of the third immunoglobulin-like domain confers ligand binding specificity." Dell K.R., Williams L.T. J. Biol. Chem. 267:21225-21229(1992) [PubMed: 1400433] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), DOMAIN, SUBUNIT. Tissue: Placenta. |
| [7] | "Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene." Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M.-L., Aaronson S.A. Proc. Natl. Acad. Sci. U.S.A. 89:246-250(1992) [PubMed: 1309608] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 19), SUBUNIT, DOMAIN, VARIANT ARG-613. Tissue: Mammary gland. |
| [8] | "Hepatocyte growth factor (HGF), keratinocyte growth factor (KGF), and their receptors in human breast cells and tissues: alternative receptors." Wilson S.E., Weng J., Chwang E.L., Gollahon L., Leitch A.M., Shay J.W. Cell. Mol. Biol. Res. 40:337-350(1994) [PubMed: 7866434] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 19). Tissue: Cornea and Mammary gland. |
| [9] | Erratum Wilson S.E., Weng J., Chwang E.L., Gollahon L., Leitch A.M., Shay J.W. Cell. Mol. Biol. Res. 40:707-707(1994) |
| [10] | Steinberger D., Mueller U. Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT CS SER-342. Tissue: Blood. |
| [11] | "Deletion of the carboxyl-terminal exons of K-sam/FGFR2 by short homology-mediated recombination, generating preferential expression of specific messenger RNAs." Ueda T., Sasaki H., Kuwahara Y., Nezu M., Shibuya T., Sakamoto H., Ishii H., Yanagihara K., Mafune K., Makuuchi M., Terada M. Cancer Res. 59:6080-6086(1999) [PubMed: 10626794] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 7; 9; 10; 11; 12 AND 13), VARIANT ARG-613. |
| [12] | "Fibroblast growth factor receptor 2 (FGFR2): genomic sequence and variations." Ingersoll R.G., Paznekas W.A., Tran A.K., Scott A.F., Jiang G., Jabs E.W. Cytogenet. Cell Genet. 94:121-126(2001) [PubMed: 11856867] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 5; 6; 8; 14 AND 18). |
| [13] | "Sequence and polymorphisms in fibroblast growth factor receptor 2 (FGFR2) gene in humans." Lind D.L., Cox D.R. Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3). |
| [14] | "Identification of a novel variant of FGFR2." Jang J. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 23). |
| [15] | NIEHS SNPs program Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-6 AND THR-186. |
| [16] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 21). Tissue: Cerebellum. |
| [17] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [18] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 20). Tissue: Brain. |
| [19] | "Paternal origin of FGFR2 mutations in sporadic cases of Crouzon syndrome and Pfeiffer syndrome." Glaser R.L., Jiang W., Boyadjiev S.A., Tran A.K., Zachary A.A., Van Maldergem L., Johnson D., Walsh S., Oldridge M., Wall S.A., Wilkie A.O.M., Jabs E.W. Am. J. Hum. Genet. 66:768-777(2000) [PubMed: 10712195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 314-427. |
| [20] | "Genomic organization of the human fibroblast growth factor receptor 2 (FGFR2) gene and comparative analysis of the human FGFR gene family." Zhang Y., Gorry M.C., Post J.C., Ehrlich G.D. Gene 230:69-79(1999) [PubMed: 10196476] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-209; 212-767 AND 771-821 (ISOFORMS 5; 14 AND 18). |
| [21] | "Analysis of phenotypic features and FGFR2 mutations in Apert syndrome." Park W.-J., Theda C., Maestri N.E., Meyers G.A., Fryburg J.S., Dufresne C., Cohen M.M. Jr., Jabs E.W. Am. J. Hum. Genet. 57:321-328(1995) [PubMed: 7668257] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 249-313, VARIANTS APRS TRP-252 AND ARG-253. |
| [22] | "Nucleotide sequences at intron 6 and exon 7 junction of fibroblast growth factor receptor 2 and rapid mutational analysis in Apert syndrome." Wada C., Ishigaki M., Toyo-oka Y., Yamabe H., Ohnuki Y., Takada F., Yamazaki Y., Ohtani H. Rinsho Byori 44:435-438(1996) [PubMed: 8676562] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-259. |
| [23] | "Exclusive paternal origin of new mutations in Apert syndrome." Moloney D.M., Slaney S.F., Oldridge M., Wall S.A., Sahlin P., Stenman G., Wilkie A.O.M. Nat. Genet. 13:48-53(1996) [PubMed: 8673103] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-318. |
| [24] | "Crouzon syndrome: mutations in two spliceoforms of FGFR2 and a common point mutation shared with Jackson-Weiss syndrome." Gorry M.C., Preston R.A., White G.J., Zhang Y., Singhal V.K., Losken H.W., Parker M.G., Nwokoro N.A., Post J.C., Ehrlich G.D. Hum. Mol. Genet. 4:1387-1390(1995) [PubMed: 7581378] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 263-361, VARIANTS CS PRO-289; ARG-338; SER-342; TYR-342; GLY-344 AND CYS-354. |
| [25] | "Asparagine-344 is a key residue for ligand binding in keratinocyte growth factor receptor." Gray T.E., Eisenstein M., Yayon A., Givol D. Biochemistry 35:15640-15645(1996) [PubMed: 8961926] [Abstract] Cited for: FUNCTION (ISOFORM 3), SUBUNIT, DOMAIN. |
| [26] | "Receptor specificity of the fibroblast growth factor family." Ornitz D.M., Xu J., Colvin J.S., McEwen D.G., MacArthur C.A., Coulier F., Gao G., Goldfarb M. J. Biol. Chem. 271:15292-15297(1996) [PubMed: 8663044] [Abstract] Cited for: INTERACTION WITH FGF1; FGF2; FGF3; FGF4; FGF6; FGF7 AND FGF9, FUNCTION IN CELL PROLIFERATION. |
| [27] | "p21-activated protein kinase 4 (PAK4) interacts with the keratinocyte growth factor receptor and participates in keratinocyte growth factor-mediated inhibition of oxidant-induced cell death." Lu Y., Pan Z.-Z., Devaux Y., Ray P. J. Biol. Chem. 278:10374-10380(2003) [PubMed: 12529371] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF PAK4; REGULATION OF CELL PROLIFERATION AND APOPTOSIS, INTERACTION WITH GRB2 AND PAK4. |
| [28] | "Cbl-mediated degradation of Lyn and Fyn induced by constitutive fibroblast growth factor receptor-2 activation supports osteoblast differentiation." Kaabeche K., Lemonnier J., Le Mee S., Caverzasio J., Marie P.J. J. Biol. Chem. 279:36259-36267(2004) [PubMed: 15190072] [Abstract] Cited for: FUNCTION IN OSTEOBLAST DIFFERENTIATION AND IN PHOSPHORYLATION OF CBL, INTERACTION WITH CBL, UBIQUITINATION, CHARACTERIZATION OF VARIANT APRS TRP-252. |
| [29] | "Tyrosine 769 of the keratinocyte growth factor receptor is required for receptor signaling but not endocytosis." Ceridono M., Belleudi F., Ceccarelli S., Torrisi M.R. Biochem. Biophys. Res. Commun. 327:523-532(2005) [PubMed: 15629145] [Abstract] Cited for: FUNCTION IN CELL PROLIFERATION AND ACTIVATION OF SIGNALING PATHWAYS, MUTAGENESIS OF TYR-769, PHOSPHORYLATION AT TYR-769, INTERACTION WITH PLCG1. |
| [30] | "Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family." Zhang X., Ibrahimi O.A., Olsen S.K., Umemori H., Mohammadi M., Ornitz D.M. J. Biol. Chem. 281:15694-15700(2006) [PubMed: 16597617] [Abstract] Cited for: INTERACTION WITH FGF1; FGF7; FGF8; FGF9; FGF10; FGF19; FGF21; FGF22 AND FGF23, FUNCTION IN STIMULATION OF CELL PROLIFERATION. |
| [31] | "Intracellular retention, degradation, and signaling of glycosylation-deficient FGFR2 and craniosynostosis syndrome-associated FGFR2C278F." Hatch N.E., Hudson M., Seto M.L., Cunningham M.L., Bothwell M. J. Biol. Chem. 281:27292-27305(2006) [PubMed: 16844695] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF PLCG1 (ISOFORM 1), CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, GLYCOSYLATION, INTERACTION WITH PLCG1, SUBCELLULAR LOCATION, MUTAGENESIS OF ASN-265 AND 656-TYR-TYR-657, UBIQUITINATION, CHARACTERIZATION OF VARIANT PS PHE-278. |
| [32] | "Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21." Kurosu H., Choi M., Ogawa Y., Dickson A.S., Goetz R., Eliseenkova A.V., Mohammadi M., Rosenblatt K.P., Kliewer S.A., Kuro-o M. J. Biol. Chem. 282:26687-26695(2007) [PubMed: 17623664] [Abstract] Cited for: INTERACTION WITH FGF19; FGF21 AND KLB, FUNCTION IN PHOSPHORYLATION OF FRS2 AND ACTIVATION OF MAP KINASES. |
| [33] | "Fibroblast growth factor receptor-induced phosphorylation of STAT1 at the Golgi apparatus without translocation to the nucleus." Citores L., Bai L., Sorensen V., Olsnes S. J. Cell. Physiol. 212:148-156(2007) [PubMed: 17311277] [Abstract] Cited for: FUNCTION IN STAT1 PHOSPHORYLATION, GLYCOSYLATION, SUBCELLULAR LOCATION, PHOSPHORYLATION. |
| [34] | "FGFR2-Cbl interaction in lipid rafts triggers attenuation of PI3K/Akt signaling and osteoblast survival." Dufour C., Guenou H., Kaabeche K., Bouvard D., Sanjay A., Marie P.J. Bone 42:1032-1039(2008) [PubMed: 18374639] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [35] | "Novel phosphotyrosine targets of FGFR2IIIb signaling." Luo Y., Yang C., Jin C., Xie R., Wang F., McKeehan W.L. Cell. Signal. 21:1370-1378(2009) [PubMed: 19410646] [Abstract] Cited for: FUNCTION AS FGF7 RECEPTOR AND IN PHOSPHORYLATION OF PLCG1 AND FRS2, CATALYTIC ACTIVITY, PHOSPHORYLATION AT TYR-466; TYR-586; TYR-588; TYR-656 AND TYR-657, MASS SPECTROMETRY. |
| [36] | "Aberrant receptor internalization and enhanced FRS2-dependent signaling contribute to the transforming activity of the fibroblast growth factor receptor 2 IIIb C3 isoform." Cha J.Y., Maddileti S., Mitin N., Harden T.K., Der C.J. J. Biol. Chem. 284:6227-6240(2009) [PubMed: 19103595] [Abstract] Cited for: FUNCTION IN FIBROBLAST PROLIFERATION; ACTIVATION OF MAP KINASES AND PHOSPHORYLATION OF PLCG1 AND FRS2, INTERACTION WITH PLCG1 AND FRS2, SUBCELLULAR LOCATION, MUTAGENESIS OF TYR-769. |
| [37] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-448 AND THR-449, MASS SPECTROMETRY. |
| [38] | "The Casitas B lineage lymphoma (Cbl) mutant G306E enhances osteogenic differentiation in human mesenchymal stromal cells in part by decreased Cbl-mediated platelet-derived growth factor receptor alpha and fibroblast growth factor receptor 2 ubiquitination." Severe N., Miraoui H., Marie P.J. J. Biol. Chem. 286:24443-24450(2011) [PubMed: 21596750] [Abstract] Cited for: FUNCTION, UBIQUITINATION. |
| [39] | "Cellular signaling by fibroblast growth factor receptors." Eswarakumar V.P., Lax I., Schlessinger J. Cytokine Growth Factor Rev. 16:139-149(2005) [PubMed: 15863030] [Abstract] Cited for: REVIEW ON LIGAND SPECIFICITY, ALTERNATIVE SPLICING, SIGNALING. |
| [40] | "FGFR2 abnormalities underlie a spectrum of bone, skin, and cancer pathologies." Katoh M. J. Invest. Dermatol. 129:1861-1867(2009) [PubMed: 19387476] [Abstract] Cited for: REVIEW ON LIGAND SPECIFICITY, ALTERNATIVE SPLICING, SIGNALING, ROLE IN DISEASE. |
| [41] | "Fibroblast growth factor signalling: from development to cancer." Turner N., Grose R. Nat. Rev. Cancer 10:116-129(2010) [PubMed: 20094046] [Abstract] Cited for: REVIEW ON FUNCTION IN FGF SIGNALING. |
| [42] | "Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity." Plotnikov A.N., Hubbard S.R., Schlessinger J., Mohammadi M. Cell 101:413-424(2000) [PubMed: 10830168] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 147-366 IN COMPLEX WITH FGF2. |
| [43] | "Crystal structure of fibroblast growth factor receptor ectodomain bound to ligand and heparin." Pellegrini L., Burke D.F., von Delft F., Mulloy B., Blundell T.L. Nature 407:1029-1034(2000) [PubMed: 11069186] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 148-366 IN COMPLEX WITH FGF1 AND HEPARIN, INTERACTION WITH FGF1 AND HEPARIN. |
| [44] | "Structural interactions of fibroblast growth factor receptor with its ligands." Stauber D.J., DiGabriele A.D., Hendrickson W.A. Proc. Natl. Acad. Sci. U.S.A. 97:49-54(2000) [PubMed: 10618369] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 147-362 IN COMPLEX WITH FGF1. |
| [45] | "Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome." Ibrahimi O.A., Eliseenkova A.V., Plotnikov A.N., Yu K., Ornitz D.M., Mohammadi M. Proc. Natl. Acad. Sci. U.S.A. 98:7182-7187(2001) [PubMed: 11390973] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 147-366 OF VARIANTS APRS TRP-252 AND ARG-253 IN COMPLEX WITH FGF2. |
| [46] | "Structural basis by which alternative splicing confers specificity in fibroblast growth factor receptors." Yeh B.K., Igarashi M., Eliseenkova A.V., Plotnikov A.N., Sher I., Ron D., Aaronson S.A., Mohammadi M. Proc. Natl. Acad. Sci. U.S.A. 100:2266-2271(2003) [PubMed: 12591959] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 140-371 IN COMPLEX WITH FGF10. |
| [47] | "Structural basis by which alternative splicing modulates the organizer activity of FGF8 in the brain." Olsen S.K., Li J.Y.H., Bromleigh C., Eliseenkova A.V., Ibrahimi O.A., Lao Z., Zhang F., Linhardt R.J., Joyner A.L., Mohammadi M. Genes Dev. 20:185-198(2006) [PubMed: 16384934] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.28 ANGSTROMS) OF 149-368 IN COMPLEX WITH FGF8, FUNCTION AS FGF8 RECEPTOR, INTERACTION WITH FGF8, DISULFIDE BONDS. |
| [48] | "A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases." Chen H., Ma J., Li W., Eliseenkova A.V., Xu C., Neubert T.A., Miller W.T., Mohammadi M. Mol. Cell 27:717-730(2007) [PubMed: 17803937] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 458-778 IN COMPLEX WITH ATP ANALOG; PEPTIDE SUBSTRATE AND MAGNESIUM, ENZYME REGULATION, PHOSPHORYLATION AT TYR-586; TYR-656 AND TYR-657, MUTAGENESIS OF ASN-549 AND GLU-565, CHARACTERIZATION OF VARIANT FSPC GLU-526, CHARACTERIZATION OF VARIANT CS HIS-549, CHARACTERIZATION OF VARIANTS PS GLY-565 AND ARG-641, CHARACTERIZATION OF VARIANT CRANIOSYNOSTOSIS ASN-659. |
| [49] | "Structural basis for reduced FGFR2 activity in LADD syndrome: Implications for FGFR autoinhibition and activation." Lew E.D., Bae J.H., Rohmann E., Wollnik B., Schlessinger J. Proc. Natl. Acad. Sci. U.S.A. 104:19802-19807(2007) [PubMed: 18056630] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 458-766 OF VARIANT LADDS THR-628 IN COMPLEX WITH ATP ANALOG, CATALYTIC ACTIVITY, SUBUNIT, AUTOPHOSPHORYLATION. |
| [50] | "A crystallographic snapshot of tyrosine trans-phosphorylation in action." Chen H., Xu C.F., Ma J., Eliseenkova A.V., Li W., Pollock P.M., Pitteloud N., Miller W.T., Neubert T.A., Mohammadi M. Proc. Natl. Acad. Sci. U.S.A. 105:19660-19665(2008) [PubMed: 19060208] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 458-778 IN COMPLEX WITH ATP, ACTIVE SITE, MASS SPECTROMETRY, AUTOPHOSPHORYLATION, PHOSPHORYLATION AT TYR-466; TYR-586; TYR-588; TYR-656; TYR-657 AND TYR-769. |
| [51] | "A novel mode of protein kinase inhibition exploiting hydrophobic motifs of autoinhibited kinases: discovery of ATP-independent inhibitors of fibroblast growth factor receptor." Eathiraj S., Palma R., Hirschi M., Volckova E., Nakuci E., Castro J., Chen C.R., Chan T.C., France D.S., Ashwell M.A. J. Biol. Chem. 286:20677-20687(2011) [PubMed: 21454610] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 458-768 IN COMPLEX WITH INHIBITOR, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, ENZYME REGULATION. |
| [52] | "Mutations in the fibroblast growth factor receptor 2 gene cause Crouzon syndrome." Reardon W., Winter R.M., Rutland P., Pulleyn L.J., Jones B.M., Malcolm S. Nat. Genet. 8:98-103(1994) [PubMed: 7987400] [Abstract] Cited for: VARIANTS CS HIS-340; ARG-342; SER-342; TYR-342 AND CYS-354. |
| [53] | "Jackson-Weiss and Crouzon syndromes are allelic with mutations in fibroblast growth factor receptor 2." Jabs E.W., Li X., Scott A.F., Meyers G.A., Chen W., Eccles M., Mao J., Charnas L.R., Jackson C.E., Jaye M. Nat. Genet. 8:275-279(1994) [PubMed: 7874170] [Abstract] Cited for: VARIANTS CS CYS-328 AND CYS-347, VARIANT JWS GLY-344. |
| [54] | "Mutations in the third immunoglobulin domain of the fibroblast growth factor receptor-2 gene in Crouzon syndrome." Oldridge M., Wilkie A.O.M., Slaney S.F., Poole M.D., Pulleyn L.J., Rutland P., Hockley A.D., Wake M.J.C., Goldin J.H., Winter R.M., Reardon W., Malcolm S. Hum. Mol. Genet. 4:1077-1082(1995) [PubMed: 7655462] [Abstract] Cited for: VARIANTS CS. |
| [55] | "Novel FGFR2 mutations in Crouzon and Jackson-Weiss syndromes show allelic heterogeneity and phenotypic variability." Park W.-J., Meyers G.A., Li X., Theda C., Day D., Orlow S.J., Jones M.C., Jabs E.W. Hum. Mol. Genet. 4:1229-1233(1995) [PubMed: 8528214] [Abstract] Cited for: VARIANTS CS GLY-290; TRP-342 AND CYS-354, VARIANT JWS ARG-342. |
| [56] | "FGFR2 mutations in Pfeiffer syndrome." Lajeunie E., Wei M.H., Bonaventure J., Munnich A., le Merrer M., Renier D. Nat. Genet. 9:108-108(1995) [PubMed: 7719333] [Abstract] Cited for: VARIANT PS ALA-321. |
| [57] | "Apert syndrome results from localized mutations of FGFR2 and is allelic with Crouzon syndrome." Wilkie A.O.M., Slaney S.F., Oldridge M., Poole M.D., Ashworth G.J., Hockley A.D., Hayward R.D., David D.J., Pulleyn L.J., Rutland P., Malcolm S., Winter R.M., Reardon W. Nat. Genet. 9:165-172(1995) [PubMed: 7719344] [Abstract] Cited for: VARIANTS APRS TRP-252 AND ARG-253. |
| [58] | "Identical mutations in the FGFR2 gene cause both Pfeiffer and Crouzon syndrome phenotypes." Rutland P., Pulleyn L.J., Reardon W., Baraister M., Hayward R., Jones B.M., Malcolm S., Winter R.M., Oldridge M., Slaney S.F., Poole M.D., Wilkie A.O.M. Nat. Genet. 9:173-176(1995) [PubMed: 7719345] [Abstract] Cited for: VARIANTS PS PRO-341; ARG-342 AND TYR-342. |
| [59] | "FGFR2 exon IIIa and IIIc mutations in Crouzon, Jackson-Weiss, and Pfeiffer syndromes: evidence for missense changes, insertions, and a deletion due to alternative RNA splicing." Meyers G.A., Day D., Goldberg R., Daentl D.L., Przylepa K.A., Abrams L.J., Graham J.M. Jr., Feingold M., Moeschler J.B., Rawnsley E., Scott A.F., Jabs E.W. Am. J. Hum. Genet. 58:491-498(1996) [PubMed: 8644708] [Abstract] Cited for: VARIANTS CS GLY-268 INS; PHE-342 AND TYR-342, VARIANTS PS PHE-278; ARG-342; SER-342; PRO-344 AND PHE-359, VARIANT JWS PRO-289. |
| [60] | "Spectrum of craniosynostosis phenotypes associated with novel mutations at the fibroblast growth factor receptor 2 locus." Pulleyn L.J., Reardon W., Wilkes D., Rutland P., Jones B.M., Hayward R., Hall C.M., Brueton L., Chun N., Lammer E., Malcolm S., Winter R.M. Eur. J. Hum. Genet. 4:283-291(1996) [PubMed: 8946174] [Abstract] Cited for: VARIANTS CS CYS-105; GLU-338; CYS-351 AND ARG-384. |
| [61] | "Crouzon syndrome: previously unrecognized deletion, duplication, and point mutation within FGFR2 gene." Steinberger D., Mulliken J.B., Mueller U. Hum. Mutat. 8:386-390(1996) [PubMed: 8956050] [Abstract] Cited for: VARIANTS CS ILE-331; ASN-ALA-337 INS AND 356-TRP--THR-358 DEL. |
| [62] | "Fibroblast growth factor receptor 2 mutations in Beare-Stevenson cutis gyrata syndrome." Przylepa K.A., Paznekas W.A., Zhang M., Golabi M., Bias W., Bamshad M.J., Carey J.C., Hall B.D., Stevenson R., Orlow S.J., Cohen M.M. Jr., Jabs E.W. Nat. Genet. 13:492-494(1996) [PubMed: 8696350] [Abstract] Cited for: VARIANTS BSCGS CYS-372 AND CYS-375. |
| [63] | "Trp290Cys mutation in exon IIIa of the fibroblast growth factor receptor 2 (FGFR2) gene is associated with Pfeiffer syndrome." Tartaglia M., Valeri S., Velardi F., di Rocco C., Battaglia P.A. Hum. Genet. 99:602-606(1997) [PubMed: 9150725] [Abstract] Cited for: VARIANT PS CYS-290. |
| [64] | "Jackson-Weiss syndrome: identification of two novel FGFR2 missense mutations shared with Crouzon and Pfeiffer craniosynostotic disorders." Tartaglia M., Di Rocco C., Lajeunie E., Valeri S., Velardi F., Battaglia P.A. Hum. Genet. 101:47-50(1997) [PubMed: 9385368] [Abstract] Cited for: VARIANT JWS SER-342. |
| [65] | "Genotype-phenotype correlation for nucleotide substitutions in the IgII-IgIII linker of FGFR2." Oldridge M., Lunt P.W., Zackai E.H., McDonald-Mcginn D.M., Muenke M., Moloney D.M., Twigg S.R.F., Heath J.K., Howard T.D., Hoganson G., Gagnon D.M., Jabs E.W., Wilkie A.O.M. Hum. Mol. Genet. 6:137-143(1997) [PubMed: 9002682] [Abstract] Cited for: VARIANT CS LEU-252, VARIANT APRS PHE-252, VARIANT PS 252-PHE-SER-253. |
| [66] | "A novel mutation (a886g) in exon 5 of FGFR2 in members of a family with Crouzon phenotype and plagiocephaly." Steinberger D., Collmann H., Schmalenberger B., Mueller U. J. Med. Genet. 34:420-422(1997) [PubMed: 9152842] [Abstract] Cited for: VARIANT CS GLU-292. |
| [67] | "Description of a new mutation and characterization of FGFR1, FGFR2, and FGFR3 mutations among Brazilian patients with syndromic craniosynostoses." Passos-Bueno M.R., Sertie A.L., Richieri-Costa A., Alonso L.G., Zatz M., Alonso N., Brunoni D., Ribeiro S.F.M. Am. J. Med. Genet. 78:237-241(1998) [PubMed: 9677057] [Abstract] Cited for: VARIANTS CS PHE-278; PRO-337; ARG-338; ARG-342; PHE-342 AND TYR-342, VARIANTS APRS TRP-252 AND ARG-253, VARIANT JWS PHE-278. |
| [68] | "The mutations in FGFR2-associated craniosynostoses are clustered in five structural elements of immunoglobulin-like domain III of the receptor." Steinberger D., Vriend G., Mulliken J.B., Mueller U. Hum. Genet. 102:145-150(1998) [PubMed: 9521581] [Abstract] Cited for: VARIANTS CS VAL-276 AND CYS-301, VARIANT CRANIOSYNOSTOSIS SER-314. |
| [69] | "Two common mutations 934C to G and 937C to G of fibroblast growth factor receptor 2 (FGFR2) gene in Chinese patients with Apert syndrome." Tsai F.-J., Hwu W.-L., Lin S.-P., Chang J.-G., Wang T.-R., Tsai C.-H. Hum. Mutat. Suppl. 1:S18-S19(1998) [PubMed: 9452027] [Abstract] Cited for: VARIANTS APRS TRP-252 AND ARG-253. |
| [70] | "Pfeiffer's syndrome resulting from an S351C mutation in the fibroblast growth factor receptor-2 gene." Mathijssen I.M., Vaandrager J.M., Hoogeboom A.J., Hesseling-Janssen A.L.W., van den Ouweland A.M.W. J. Craniofac. Surg. 9:207-209(1998) [PubMed: 9693549] [Abstract] Cited for: VARIANT PS CYS-351. |
| [71] | "Presence of the Apert canonical S252W FGFR2 mutation in a patient without severe syndactyly." Passos-Bueno M.R., Richieri-Costa A., Sertie A.L., Kneppers A. J. Med. Genet. 35:677-679(1998) [PubMed: 9719378] [Abstract] Cited for: VARIANT PS TRP-252. |
| [72] | "A novel FGFR2 gene mutation in Crouzon syndrome associated with apparent nonpenetrance." Everett E.T., Britto D.A., Ward R.E., Hartsfield J.K. Jr. Cleft Palate Craniofac. J. 36:533-541(1999) [PubMed: 10574673] [Abstract] Cited for: VARIANT CS SER-362. |
| [73] | "Analysis of the mutational spectrum of the FGFR2 gene in Pfeiffer syndrome." Cornejo-Roldan L.R., Roessler E., Muenke M. Hum. Genet. 104:425-431(1999) [PubMed: 10394936] [Abstract] Cited for: VARIANTS PS CYS-340 AND GLY-342. |
| [74] | "Pfeiffer syndrome type 2 associated with a single amino acid deletion in the FGFR2 gene." Priolo M., Lerone M., Baffico M., Baldi M., Ravazzolo R., Cama A., Capra V., Silengo M. Clin. Genet. 58:81-83(2000) [PubMed: 10945669] [Abstract] Cited for: VARIANT PS ASP-273 DEL. |
| [75] | "Clustering of FGFR2 gene mutations inpatients with Pfeiffer and Crouzon syndromes (FGFR2-associated craniosynostoses)." Kress W., Collmann H., Buesse M., Halliger-Keller B., Mueller C.R. Cytogenet. Cell Genet. 91:134-137(2000) [PubMed: 11173845] [Abstract] Cited for: VARIANTS CS/PS ARG-342 AND TYR-342, VARIANTS CS LEU-263; VAL-276; PHE-278; TYR-278; SER-288; PRO-289; PRO-341; TRP-342; CYS-354; TYR-354 AND PHE-359, VARIANT PS SER-342. |
| [76] | "A novel mutation, Ala315Ser, in FGFR2: a gene-environment interaction leading to craniosynostosis?" Johnson D., Wall S.A., Mann S., Wilkie A.O.M. Eur. J. Hum. Genet. 8:571-577(2000) [PubMed: 10951518] [Abstract] Cited for: VARIANT SER-315. |
| [77] | "Evidence for digenic inheritance in some cases of Antley-Bixler syndrome?" Reardon W., Smith A., Honour J.W., Hindmarsh P., Das D., Rumsby G., Nelson I., Malcolm S., Ades L., Sillence D., Kumar D., DeLozier-Blanchet C., McKee S., Kelly T., McKeehan W.L., Baraitser M., Winter R.M. J. Med. Genet. 37:26-32(2000) [PubMed: 10633130] [Abstract] Cited for: VARIANTS ABS2 ARG-342; SER-342 AND CYS-351. |
| [78] | "Mutation analysis of Crouzon syndrome and identification of one novel mutation in Taiwanese patients." Tsai F.-J., Yang C.-F., Wu J.-Y., Tsai C.-H., Lee C.-C. Pediatr. Int. 43:263-266(2001) [PubMed: 11380921] [Abstract] Cited for: VARIANTS CS CYS-281; PRO-289; ARG-342 AND TYR-342. |
| [79] | "Genomic screening of fibroblast growth-factor receptor 2 reveals a wide spectrum of mutations in patients with syndromic craniosynostosis." Kan S.-H., Elanko N., Johnson D., Cornejo-Roldan L.R., Cook J., Reich E.W., Tomkins S., Verloes A., Twigg S.R.F., Rannan-Eliya S., McDonald-McGinn D.M., Zackai E.H., Wall S.A., Muenke M., Wilkie A.O.M. Am. J. Hum. Genet. 70:472-486(2002) [PubMed: 11781872] [Abstract] Cited for: VARIANTS CS CYS-105; PRO-267; VAL-276; CYS-281; PRO-289; ARG-338; HIS-340; PHE-342; TRP-342; CYS-347; CYS-354; HIS-549 AND GLY-678, VARIANTS PS PHE-172; 252-PHE-SER-253; CYS-290; CYS-340; PRO-341; ARG-342; SER-342; CYS-375; GLY-565; ARG-641 AND GLU-663, VARIANTS APRS TRP-252 AND ARG-253, VARIANTS CS/PS PHE-278 AND TYR-342, VARIANT CRANIOSYNOSTOSIS ASN-659, VARIANTS THR-186 AND SER-315. |
| [80] | "Mutation in the FGFR2 gene in a Taiwanese patient with Beare-Stevenson cutis gyrata syndrome." Wang T.-J., Huang C.-B., Tsai F.-J., Wu J.-Y., Lai R.-B., Hsiao M. Clin. Genet. 61:218-221(2002) [PubMed: 12000365] [Abstract] Cited for: VARIANT BSCGS CYS-375. |
| [81] | "Familial scaphocephaly syndrome caused by a novel mutation in the FGFR2 tyrosine kinase domain." McGillivray G., Savarirayan R., Cox T.C., Stojkoski C., McNeil R., Bankier A., Bateman J.F., Roscioli T., Gardner R.J.M., Lamande S.R. J. Med. Genet. 42:656-662(2005) [PubMed: 16061565] [Abstract] Cited for: VARIANT FSPC GLU-526. |
| [82] | "Mutations in different components of FGF signaling in LADD syndrome." Rohmann E., Brunner H.G., Kayserili H., Uyguner O., Nuernberg G., Lew E.D., Dobbie A., Eswarakumar V.P., Uzumcu A., Ulubil-Emeroglu M., Leroy J.G., Li Y., Becker C., Lehnerdt K., Cremers C.W.R.J., Yueksel-Apak M., Nuernberg P., Kubisch C. Wollnik B.Nat. Genet. 38:414-417(2006) [PubMed: 16501574] [Abstract] Cited for: VARIANTS LADDS THR-628; THR-648 AND 649-ARG-ASP-650 DELINS SER. |
| [83] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-203. |
| [84] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-57; THR-186; CYS-203; VAL-272; ASN-283; CYS-290 AND THR-612. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X52832 mRNA. Translation: CAA37014.1. M55614 mRNA. Translation: AAA61188.1. X56191 mRNA. Translation: CAA39654.1. M35718 mRNA. Translation: AAA36152.1. M87770 mRNA. Translation: AAA59470.1. M87771 mRNA. Translation: AAA59471.1. M87772 mRNA. Translation: AAA59472.1. M97193 mRNA. Translation: AAA52449.1. U11814 mRNA. Translation: AAA68514.1. M80634 mRNA. Translation: AAA36147.1. Z71929 mRNA. Translation: CAA96492.1. AB030073 mRNA. Translation: BAA89296.1. AB030074 mRNA. Translation: BAA89297.1. AB030075 mRNA. Translation: BAA89298.1. AB030076 mRNA. Translation: BAA89299.1. AB030077 mRNA. Translation: BAA89300.1. AB030078 mRNA. Translation: BAA89301.1. AF360695, AF410480 Genomic DNA. Translation: AAK94205.1. AF360695, AF410480 Genomic DNA. Translation: AAK94206.1. AF360695, AF410480 Genomic DNA. Translation: AAK94207.1. AF360695, AF410480 Genomic DNA. Translation: AAK94208.1. AF360695, AF410480 Genomic DNA. Translation: AAK94209.1. AF487553 Genomic DNA. Translation: AAM74056.1. AB084153 mRNA. Translation: BAC45037.1. DQ493927 Genomic DNA. Translation: ABE96832.1. AK294026 mRNA. Translation: BAG57383.1. Different initiation. AC009988 Genomic DNA. No translation available. BC039243 mRNA. Translation: AAH39243.2. AF169399 Genomic DNA. Translation: AAF43273.1. AF169399 Genomic DNA. Translation: AAF43274.1. AF097353 AF097352 Genomic DNA. Translation: AAD31560.1.AF097353 AF097352 Genomic DNA. Translation: AAD31561.1.AF097340 AF097339 Genomic DNA. Translation: AAD31562.1.AF097354 Genomic DNA. Translation: AAD31565.1. AF097341 Genomic DNA. Translation: AAD31567.1. S82438 Genomic DNA. Translation: AAD14392.1. Y17131 Genomic DNA. Translation: CAA76643.1. L49237 Genomic DNA. Translation: AAC41933.1. L49242 Genomic DNA. Translation: AAC41934.1. L49238 Genomic DNA. Translation: AAC41935.1. L49239 Genomic DNA. Translation: AAC41936.1. L49240 Genomic DNA. Translation: AAC41937.1. L49241 Genomic DNA. Translation: AAC41938.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00216602. IPI00216603. IPI00216604. IPI00216605. IPI00218416. IPI00218417. IPI00218418. IPI00218419. IPI00218420. IPI00218421. IPI00218422. IPI00218423. IPI00218424. IPI00218425. IPI00384713. IPI00386650. IPI00647907. IPI00759837. IPI00873362. IPI00942110. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A35969. TVHUF2. A42691. A45081. C42691. S16236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000132.3. NM_000141.4. NP_001138385.1. NM_001144913.1. NP_001138386.1. NM_001144914.1. NP_001138387.1. NM_001144915.1. NP_001138388.1. NM_001144916.1. NP_001138389.1. NM_001144917.1. NP_001138390.1. NM_001144918.1. NP_001138391.1. NM_001144919.1. NP_075259.4. NM_022970.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.533683. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P21802. Positions 4-364, 467-765. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-3788N. DIP-4011N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P21802. 5 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-118359. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 120049. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000357555; ENSP00000350166; ENSG00000066468. ENST00000358487; ENSP00000351276; ENSG00000066468. ENST00000360144; ENSP00000353262; ENSG00000066468. ENST00000369061; ENSP00000358057; ENSG00000066468. ENST00000369062; ENSP00000358058; ENSG00000066468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2263. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2263. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001lfj.2. human. uc001lfm.1. human. uc001lfo.1. human. uc009xzo.1. human. uc009xzp.1. human. uc009xzq.1. human. uc009xzr.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2263. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC10M123223. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0009266. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3689. FGFR2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010886. HPA035305. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 101200. phenotype. 101600. phenotype. 123150. phenotype. 123500. phenotype. 123790. phenotype. 149730. phenotype. 176943. gene. 207410. phenotype. 609579. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 263476. Antley-Bixler syndrome type 1. 87. Apert syndrome. 207. Crouzon disease. 1555. Cutis gyrata - acanthosis nigricans - craniosynostosis. 168624. Familial scaphocephaly syndrome, McGillivray type. 1540. Jackson-Weiss syndrome. 2363. Lacrimo-auriculo-dento-digital syndrome. 93258. Pfeiffer syndrome type 1. 794. Saethre-Chotzen syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28128. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG07516. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000345. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4640BC. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.1. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | fgf_pathway. FGF signaling pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P21802. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000066468. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR016248. Tyr_kinase_fibroblast_GF_rcpt. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K05093. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF07679. I-set. 2 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000628. FGFR. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00408. IGc2. 3 hits. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 3 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00039. Palifermin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FGFR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P21802 Secondary accession number(s): B4DFC2 Q9UQI0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with