Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Macrophage scavenger receptor types I and II

Gene

MSR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize acetylated LDL.

GO - Molecular functioni

  1. low-density lipoprotein particle binding Source: BHF-UCL
  2. scavenger receptor activity Source: ProtInc

GO - Biological processi

  1. cellular response to organic cyclic compound Source: Ensembl
  2. cholesterol transport Source: BHF-UCL
  3. lipoprotein transport Source: Ensembl
  4. plasma lipoprotein particle clearance Source: BHF-UCL
  5. positive regulation of cholesterol storage Source: BHF-UCL
  6. positive regulation of macrophage derived foam cell differentiation Source: BHF-UCL
  7. receptor-mediated endocytosis Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Endocytosis

Enzyme and pathway databases

ReactomeiREACT_163699. Scavenging by Class A Receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Macrophage scavenger receptor types I and II
Alternative name(s):
Macrophage acetylated LDL receptor I and II
Scavenger receptor class A member 1
CD_antigen: CD204
Gene namesi
Name:MSR1
Synonyms:SCARA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:7376. MSR1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5050CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei51 – 7626Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini77 – 451375ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. collagen trimer Source: UniProtKB-KW
  2. cytosol Source: Ensembl
  3. endocytic vesicle membrane Source: Reactome
  4. integral component of plasma membrane Source: ProtInc
  5. low-density lipoprotein particle Source: UniProtKB-KW
  6. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

LDL, Membrane

Pathology & Biotechi

Involvement in diseasei

Prostate cancer (PC)1 Publication

The disease may be caused by mutations affecting the gene represented in this entry. MSR1 variants may play a role in susceptibility to prostate cancer. MSR1 variants have been found in individuals with prostate cancer and co-segregate with the disease in some families.

Disease descriptionA malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.

See also OMIM:176807
Barrett esophagus (BE)1 Publication

The disease may be caused by mutations affecting the gene represented in this entry. Genetic variants in MSR1 have been found in individuals with Barrett esophagus and are thought to contribute to disease susceptibility.

Disease descriptionA condition characterized by a metaplastic change in which normal esophageal squamous epithelium is replaced by a columnar and intestinal-type epithelium. Patients with Barrett esophagus have an increased risk of esophageal adenocarcinoma. The main cause of Barrett esophagus is gastroesophageal reflux. The retrograde movement of acid and bile salts from the stomach into the esophagus causes prolonged injury to the esophageal epithelium and induces chronic esophagitis, which in turn is believed to trigger the pathologic changes.

See also OMIM:614266

Organism-specific databases

MIMi176807. phenotype.
614266. phenotype.
Orphaneti1232. Barrett esophagus.
1331. Familial prostate cancer.
PharmGKBiPA31181.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 451451Macrophage scavenger receptor types I and IIPRO_0000181627Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei27 – 271PhosphoserineBy similarity
Glycosylationi82 – 821N-linked (GlcNAc...)Sequence Analysis
Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis
Glycosylationi221 – 2211N-linked (GlcNAc...)1 Publication
Glycosylationi249 – 2491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi375 ↔ 439PROSITE-ProRule annotation1 Publication
Disulfide bondi388 ↔ 449PROSITE-ProRule annotation1 Publication
Disulfide bondi419 ↔ 429PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP21757.
PRIDEiP21757.

PTM databases

PhosphoSiteiP21757.

Expressioni

Tissue specificityi

Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.1 Publication

Gene expression databases

BgeeiP21757.
CleanExiHS_MSR1.
ExpressionAtlasiP21757. baseline and differential.
GenevestigatoriP21757.

Organism-specific databases

HPAiCAB032491.
HPA000272.

Interactioni

Subunit structurei

Homotrimer.

Binary interactionsi

WithEntry#Exp.IntActNotes
HOOK3Q86VS84EBI-1776976,EBI-1777078
Hook3Q7TQ772EBI-1776976,EBI-1777000From a different organism.

Protein-protein interaction databases

BioGridi110587. 8 interactions.
IntActiP21757. 3 interactions.
STRINGi9606.ENSP00000262101.

Structurei

3D structure databases

ProteinModelPortaliP21757.
SMRiP21757. Positions 295-323, 349-450.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini273 – 34169Collagen-likeAdd
BLAST
Domaini350 – 450101SRCRPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni77 – 10933SpacerCuratedAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili171 – 25585Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 collagen-like domain.Curated
Contains 1 SRCR domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Collagen, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG150350.
GeneTreeiENSGT00760000119251.
HOGENOMiHOG000085659.
HOVERGENiHBG002473.
InParanoidiP21757.
KOiK06558.
OrthoDBiEOG7V1FQV.
PhylomeDBiP21757.
TreeFamiTF330855.

Family and domain databases

Gene3Di3.10.250.10. 1 hit.
InterProiIPR008160. Collagen.
IPR003543. Macro_scav_rcpt.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF01391. Collagen. 1 hit.
PF03523. Macscav_rec. 1 hit.
PF00530. SRCR. 1 hit.
[Graphical view]
PRINTSiPR01408. MACSCAVRCPTR.
PR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 1 hit.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 1 hit.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform I (identifier: P21757-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQWDHFHNQ QEDTDSCSES VKFDARSMTA LLPPNPKNSP SLQEKLKSFK
60 70 80 90 100
AALIALYLLV FAVLIPLIGI VAAQLLKWET KNCSVSSTNA NDITQSLTGK
110 120 130 140 150
GNDSEEEMRF QEVFMEHMSN MEKRIQHILD MEANLMDTEH FQNFSMTTDQ
160 170 180 190 200
RFNDILLQLS TLFSSVQGHG NAIDEISKSL ISLNTTLLDL QLNIENLNGK
210 220 230 240 250
IQENTFKQQE EISKLEERVY NVSAEIMAMK EEQVHLEQEI KGEVKVLNNI
260 270 280 290 300
TNDLRLKDWE HSQTLRNITL IQGPPGPPGE KGDRGPTGES GPRGFPGPIG
310 320 330 340 350
PPGLKGDRGA IGFPGSRGLP GYAGRPGNSG PKGQKGEKGS GNTLTPFTKV
360 370 380 390 400
RLVGGSGPHE GRVEILHSGQ WGTICDDRWE VRVGQVVCRS LGYPGVQAVH
410 420 430 440 450
KAAHFGQGTG PIWLNEVFCF GRESSIEECK IRQWGTRACS HSEDAGVTCT

L
Length:451
Mass (Da):49,762
Last modified:April 30, 1991 - v1
Checksum:i915C03B56653BB41
GO
Isoform II (identifier: P21757-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS
     359-451: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:358
Mass (Da):39,584
Checksum:i5F8593EF21189917
GO
Isoform III (identifier: P21757-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S

Show »
Length:388
Mass (Da):42,942
Checksum:iD6A20BCE57BFBC46
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti23 – 231F → C.1 Publication
Corresponds to variant rs35175081 [ dbSNP | Ensembl ].
VAR_025190
Natural varianti36 – 361P → A Found in a family with prostate cancer. 1 Publication
VAR_066581
Natural varianti41 – 411S → Y Found in patients with prostate cancer. 1 Publication
Corresponds to variant rs145597376 [ dbSNP | Ensembl ].
VAR_066582
Natural varianti113 – 1131V → A Found in patients with prostate cancer. 1 Publication
Corresponds to variant rs117359034 [ dbSNP | Ensembl ].
VAR_066583
Natural varianti174 – 1741D → Y Found in patients with prostate cancer. 1 Publication
Corresponds to variant rs72552387 [ dbSNP | Ensembl ].
VAR_066584
Natural varianti254 – 2541L → V Found in patients with Barrett esophagus. 1 Publication
VAR_066585
Natural varianti269 – 2691T → I.
Corresponds to variant rs13306543 [ dbSNP | Ensembl ].
VAR_052061
Natural varianti275 – 2751P → A.2 Publications
Corresponds to variant rs3747531 [ dbSNP | Ensembl ].
VAR_025191
Natural varianti369 – 3691G → S Found in a family with prostate cancer. 1 Publication
VAR_066586
Natural varianti441 – 4411H → R Found in patients with prostate cancer. 1 Publication
Corresponds to variant rs138749399 [ dbSNP | Ensembl ].
VAR_066587

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei345 – 40864TPFTK…HFGQG → S in isoform III. 1 PublicationVSP_036842Add
BLAST
Alternative sequencei345 – 35814TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. 1 PublicationVSP_006229Add
BLAST
Alternative sequencei359 – 45193Missing in isoform II. 1 PublicationVSP_006230Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90187 mRNA. Translation: BAA14208.1.
D90188 mRNA. Translation: BAA14209.1.
AF037351 mRNA. Translation: AAC09251.1.
DQ144993 Genomic DNA. Translation: AAZ38715.1.
AC023396 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63832.1.
CH471080 Genomic DNA. Translation: EAW63830.1.
CH471080 Genomic DNA. Translation: EAW63833.1.
CH471080 Genomic DNA. Translation: EAW63834.1.
BC063878 mRNA. Translation: AAH63878.1.
D13263 Genomic DNA. No translation available.
CCDSiCCDS5995.1. [P21757-1]
CCDS5996.1. [P21757-3]
CCDS5997.1. [P21757-2]
PIRiA38415.
B38415.
RefSeqiNP_002436.1. NM_002445.3. [P21757-2]
NP_619729.1. NM_138715.2. [P21757-1]
NP_619730.1. NM_138716.2. [P21757-3]
UniGeneiHs.147635.

Genome annotation databases

EnsembliENST00000262101; ENSP00000262101; ENSG00000038945. [P21757-1]
ENST00000350896; ENSP00000262100; ENSG00000038945. [P21757-3]
ENST00000355282; ENSP00000347430; ENSG00000038945. [P21757-3]
ENST00000381998; ENSP00000371428; ENSG00000038945. [P21757-2]
GeneIDi4481.
KEGGihsa:4481.
UCSCiuc003wwz.3. human. [P21757-1]
uc003wxa.3. human. [P21757-3]
uc003wxb.3. human. [P21757-2]

Polymorphism databases

DMDMi127357.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90187 mRNA. Translation: BAA14208.1.
D90188 mRNA. Translation: BAA14209.1.
AF037351 mRNA. Translation: AAC09251.1.
DQ144993 Genomic DNA. Translation: AAZ38715.1.
AC023396 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63832.1.
CH471080 Genomic DNA. Translation: EAW63830.1.
CH471080 Genomic DNA. Translation: EAW63833.1.
CH471080 Genomic DNA. Translation: EAW63834.1.
BC063878 mRNA. Translation: AAH63878.1.
D13263 Genomic DNA. No translation available.
CCDSiCCDS5995.1. [P21757-1]
CCDS5996.1. [P21757-3]
CCDS5997.1. [P21757-2]
PIRiA38415.
B38415.
RefSeqiNP_002436.1. NM_002445.3. [P21757-2]
NP_619729.1. NM_138715.2. [P21757-1]
NP_619730.1. NM_138716.2. [P21757-3]
UniGeneiHs.147635.

3D structure databases

ProteinModelPortaliP21757.
SMRiP21757. Positions 295-323, 349-450.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110587. 8 interactions.
IntActiP21757. 3 interactions.
STRINGi9606.ENSP00000262101.

Chemistry

BindingDBiP21757.
ChEMBLiCHEMBL5811.

PTM databases

PhosphoSiteiP21757.

Polymorphism databases

DMDMi127357.

Proteomic databases

PaxDbiP21757.
PRIDEiP21757.

Protocols and materials databases

DNASUi4481.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262101; ENSP00000262101; ENSG00000038945. [P21757-1]
ENST00000350896; ENSP00000262100; ENSG00000038945. [P21757-3]
ENST00000355282; ENSP00000347430; ENSG00000038945. [P21757-3]
ENST00000381998; ENSP00000371428; ENSG00000038945. [P21757-2]
GeneIDi4481.
KEGGihsa:4481.
UCSCiuc003wwz.3. human. [P21757-1]
uc003wxa.3. human. [P21757-3]
uc003wxb.3. human. [P21757-2]

Organism-specific databases

CTDi4481.
GeneCardsiGC08M016009.
HGNCiHGNC:7376. MSR1.
HPAiCAB032491.
HPA000272.
MIMi153622. gene.
176807. phenotype.
614266. phenotype.
neXtProtiNX_P21757.
Orphaneti1232. Barrett esophagus.
1331. Familial prostate cancer.
PharmGKBiPA31181.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG150350.
GeneTreeiENSGT00760000119251.
HOGENOMiHOG000085659.
HOVERGENiHBG002473.
InParanoidiP21757.
KOiK06558.
OrthoDBiEOG7V1FQV.
PhylomeDBiP21757.
TreeFamiTF330855.

Enzyme and pathway databases

ReactomeiREACT_163699. Scavenging by Class A Receptors.

Miscellaneous databases

GeneWikiiMSR1.
GenomeRNAii4481.
NextBioi17337.
PROiP21757.
SOURCEiSearch...

Gene expression databases

BgeeiP21757.
CleanExiHS_MSR1.
ExpressionAtlasiP21757. baseline and differential.
GenevestigatoriP21757.

Family and domain databases

Gene3Di3.10.250.10. 1 hit.
InterProiIPR008160. Collagen.
IPR003543. Macro_scav_rcpt.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF01391. Collagen. 1 hit.
PF03523. Macscav_rec. 1 hit.
PF00530. SRCR. 1 hit.
[Graphical view]
PRINTSiPR01408. MACSCAVRCPTR.
PR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 1 hit.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 1 hit.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II).
  2. "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake."
    Gough P.J., Greaves D.R., Gordon S.
    J. Lipid Res. 39:531-543(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM III), TISSUE SPECIFICITY.
  3. NIEHS SNPs program
    Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-23 AND ALA-275.
  4. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
    Tissue: Testis.
  7. "Structure, organization, and chromosomal mapping of the human macrophage scavenger receptor gene."
    Emi M., Asaoka H., Matsumoto A., Itakura H., Kurihara Y., Wada Y., Kanamori H., Yazaki Y., Takahashi E., Lepert M.
    J. Biol. Chem. 268:2120-2125(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 155-272.
  8. "Structures of class A macrophage scavenger receptors. Electron microscopic study of flexible, multidomain, fibrous proteins and determination of the disulfide bond pattern of the scavenger receptor cysteine-rich domain."
    Resnick D., Chatterton J.E., Schwartz K., Slayter H., Krieger M.
    J. Biol. Chem. 271:26924-26930(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BONDS IN SRCR DOMAIN.
  9. Cited for: POSSIBLE INVOLVEMENT IN PC, VARIANTS ALA-36; TYR-41; ALA-113; TYR-174; ALA-275; SER-369 AND ARG-441.
  10. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  11. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-221.
    Tissue: Liver.
  12. "Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma."
    Orloff M., Peterson C., He X., Ganapathi S., Heald B., Yang Y.R., Bebek G., Romigh T., Song J.H., Wu W., David S., Cheng Y., Meltzer S.J., Eng C.
    JAMA 306:410-419(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN BE, VARIANT VAL-254.

Entry informationi

Entry nameiMSRE_HUMAN
AccessioniPrimary (citable) accession number: P21757
Secondary accession number(s): D3DSP3
, O60505, P21759, Q45F10
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 30, 1991
Last sequence update: April 30, 1991
Last modified: March 3, 2015
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.