P21757 (MSRE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Macrophage scavenger receptor types I and II Alternative name(s): Macrophage acetylated LDL receptor I and II Scavenger receptor class A member 1 CD_antigen=CD204 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 451 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL. |
| Subunit structure | Homotrimer. |
| Subcellular location | |
| Tissue specificity | Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages. Ref.2 |
| Involvement in disease | Prostate cancer (PC) [MIM:176807]: A malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Barrett esophagus (BE) [MIM:614266]: A condition characterized by a metaplastic change in which normal esophageal squamous epithelium is replaced by a columnar and intestinal-type epithelium. Patients with Barrett esophagus have an increased risk of esophageal adenocarcinoma. The main cause of Barrett esophagus is gastroesophageal reflux. The retrograde movement of acid and bile salts from the stomach into the esophagus causes prolonged injury to the esophageal epithelium and induces chronic esophagitis, which in turn is believed to trigger the pathologic changes. |
| Sequence similarities | Contains 1 collagen-like domain. Contains 1 SRCR domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HOOK3 | Q86VS8 | 4 | EBI-1776976,EBI-1777078 | |
| Hook3 | Q7TQ77 | 2 | EBI-1776976,EBI-1777000 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform I (identifier: P21757-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform II (identifier: P21757-2) The sequence of this isoform differs from the canonical sequence as follows: 345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS 359-451: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform III (identifier: P21757-3) The sequence of this isoform differs from the canonical sequence as follows: 345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 451 | 451 | Macrophage scavenger receptor types I and II | PRO_0000181627 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 50 | 50 | Cytoplasmic Potential | ||||||||
| Transmembrane | 51 – 76 | 26 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 77 – 451 | 375 | Extracellular Potential | ||||||||
| Domain | 273 – 341 | 69 | Collagen-like | ||||||||
| Domain | 350 – 450 | 101 | SRCR | ||||||||
| Region | 77 – 109 | 33 | Spacer Probable | ||||||||
| Coiled coil | 171 – 255 | 85 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 27 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 29 | 1 | Phosphothreonine By similarity | ||||||||
| Glycosylation | 82 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 184 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 221 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 249 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 375 ↔ 439 | Ref.8 | |||||||||
| Disulfide bond | 388 ↔ 449 | Ref.8 | |||||||||
| Disulfide bond | 419 ↔ 429 | Ref.8 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 345 – 408 | 64 | TPFTK…HFGQG → S in isoform III. | VSP_036842 | |||||||
| Alternative sequence | 345 – 358 | 14 | TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. | VSP_006229 | |||||||
| Alternative sequence | 359 – 451 | 93 | Missing in isoform II. | VSP_006230 | |||||||
| Natural variant | 23 | 1 | F → C. Ref.3 Corresponds to variant rs35175081 [ dbSNP | Ensembl ]. | VAR_025190 | |||||||
| Natural variant | 36 | 1 | P → A Found in a family with prostate cancer. Ref.9 | VAR_066581 | |||||||
| Natural variant | 41 | 1 | S → Y Found in patients with prostate cancer. Ref.9 Corresponds to variant rs145597376 [ dbSNP | Ensembl ]. | VAR_066582 | |||||||
| Natural variant | 113 | 1 | V → A Found in patients with prostate cancer. Ref.9 Corresponds to variant rs117359034 [ dbSNP | Ensembl ]. | VAR_066583 | |||||||
| Natural variant | 174 | 1 | D → Y Found in patients with prostate cancer. Ref.9 Corresponds to variant rs72552387 [ dbSNP | Ensembl ]. | VAR_066584 | |||||||
| Natural variant | 254 | 1 | L → V Found in patients with Barrett esophagus. Ref.12 | VAR_066585 | |||||||
| Natural variant | 269 | 1 | T → I. Corresponds to variant rs13306543 [ dbSNP | Ensembl ]. | VAR_052061 | |||||||
| Natural variant | 275 | 1 | P → A. Ref.3 Ref.9 Corresponds to variant rs3747531 [ dbSNP | Ensembl ]. | VAR_025191 | |||||||
| Natural variant | 369 | 1 | G → S Found in a family with prostate cancer. Ref.9 | VAR_066586 | |||||||
| Natural variant | 441 | 1 | H → R Found in patients with prostate cancer. Ref.9 Corresponds to variant rs138749399 [ dbSNP | Ensembl ]. | VAR_066587 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human macrophage scavenger receptors: primary structure, expression, and localization in atherosclerotic lesions." Matsumoto A., Naito M., Itakura H., Ikemoto S., Asaoka H., Hayakawa I., Kanamori H., Aburatani H., Takaku F., Suzuki H., Kobari Y., Miyai T., Takahashi K., Cohen E.H., Wydro R., Housman D.E., Kodama T. Proc. Natl. Acad. Sci. U.S.A. 87:9133-9137(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II). |
| [2] | "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake." Gough P.J., Greaves D.R., Gordon S. J. Lipid Res. 39:531-543(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM III), TISSUE SPECIFICITY. |
| [3] | NIEHS SNPs program Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-23 AND ALA-275. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I). Tissue: Testis. |
| [7] | "Structure, organization, and chromosomal mapping of the human macrophage scavenger receptor gene." Emi M., Asaoka H., Matsumoto A., Itakura H., Kurihara Y., Wada Y., Kanamori H., Yazaki Y., Takahashi E., Lepert M. J. Biol. Chem. 268:2120-2125(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 155-272. |
| [8] | "Structures of class A macrophage scavenger receptors. Electron microscopic study of flexible, multidomain, fibrous proteins and determination of the disulfide bond pattern of the scavenger receptor cysteine-rich domain." Resnick D., Chatterton J.E., Schwartz K., Slayter H., Krieger M. J. Biol. Chem. 271:26924-26930(1996) [PubMed] [Europe PMC] [Abstract] Cited for: DISULFIDE BONDS IN SRCR DOMAIN. |
| [9] | "Germline mutations and sequence variants of the macrophage scavenger receptor 1 gene are associated with prostate cancer risk." Xu J., Zheng S.L., Komiya A., Mychaleckyj J.C., Isaacs S.D., Hu J.J., Sterling D., Lange E.M., Hawkins G.A., Turner A., Ewing C.M., Faith D.A., Johnson J.R., Suzuki H., Bujnovszky P., Wiley K.E., DeMarzo A.M., Bova G.S. Meyers D.A.Nat. Genet. 32:321-325(2002) [PubMed] [Europe PMC] [Abstract] Cited for: POSSIBLE INVOLVEMENT IN PC, VARIANTS ALA-36; TYR-41; ALA-113; TYR-174; ALA-275; SER-369 AND ARG-441. |
| [10] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [11] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-221, MASS SPECTROMETRY. Tissue: Liver. |
| [12] | "Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma." Orloff M., Peterson C., He X., Ganapathi S., Heald B., Yang Y.R., Bebek G., Romigh T., Song J.H., Wu W., David S., Cheng Y., Meltzer S.J., Eng C. JAMA 306:410-419(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN BE, VARIANT VAL-254. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D90187 mRNA. Translation: BAA14208.1. D90188 mRNA. Translation: BAA14209.1. AF037351 mRNA. Translation: AAC09251.1. DQ144993 Genomic DNA. Translation: AAZ38715.1. AC023396 Genomic DNA. No translation available. CH471080 Genomic DNA. Translation: EAW63832.1. CH471080 Genomic DNA. Translation: EAW63830.1. CH471080 Genomic DNA. Translation: EAW63833.1. CH471080 Genomic DNA. Translation: EAW63834.1. BC063878 mRNA. Translation: AAH63878.1. D13263 Genomic DNA. No translation available. |
| IPI | IPI00012740. IPI00071002. IPI00939301. |
| PIR | A38415. B38415. |
| RefSeq | NP_002436.1. NM_002445.3. NP_619729.1. NM_138715.2. NP_619730.1. NM_138716.2. |
| UniGene | Hs.147635. |
3D structure databases | |
| ProteinModelPortal | P21757. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P21757. 3 interactions. |
| STRING | 9606.ENSP00000262101. |
PTM databases | |
| PhosphoSite | P21757. |
Polymorphism databases | |
| DMDM | 127357. |
Proteomic databases | |
| PaxDb | P21757. |
| PRIDE | P21757. |
Protocols and materials databases | |
| DNASU | 4481. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262101; ENSP00000262101; ENSG00000038945. ENST00000350896; ENSP00000262100; ENSG00000038945. ENST00000355282; ENSP00000347430; ENSG00000038945. ENST00000381998; ENSP00000371428; ENSG00000038945. |
| GeneID | 4481. |
| KEGG | hsa:4481. |
| UCSC | uc003wwz.3. human. uc003wxa.3. human. uc003wxb.3. human. |
Organism-specific databases | |
| CTD | 4481. |
| GeneCards | GC08M016009. |
| HGNC | HGNC:7376. MSR1. |
| HPA | HPA000272. |
| MIM | 153622. gene. 176807. phenotype. 614266. phenotype. |
| neXtProt | NX_P21757. |
| Orphanet | 1232. Barrett esophagus. |
| PharmGKB | PA31181. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG150350. |
| HOGENOM | HOG000085659. |
| HOVERGEN | HBG002473. |
| InParanoid | P21757. |
| KO | K06558. |
| OrthoDB | EOG4RJG1J. |
| PhylomeDB | P21757. |
Gene expression databases | |
| ArrayExpress | P21757. |
| Bgee | P21757. |
| CleanEx | HS_MSR1. |
| Genevestigator | P21757. |
| GermOnline | ENSG00000038945. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. IPR003543. Macro_scav_rcpt. IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF01391. Collagen. 1 hit. PF03523. Macscav_rec. 1 hit. PF00530. SRCR. 1 hit. [Graphical view] |
| PRINTS | PR01408. MACSCAVRCPTR. PR00258. SPERACTRCPTR. |
| SMART | SM00202. SR. 1 hit. [Graphical view] |
| SUPFAM | SSF56487. Srcr_receptor. 1 hit. |
| PROSITE | PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P21757. |
| ChEMBL | CHEMBL5811. |
| GenomeRNAi | 4481. |
| NextBio | 17337. |
| SOURCE | Search... |
Entry information
| Entry name | MSRE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P21757 Secondary accession number(s): D3DSP3 Q45F10 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
