Reviewed,
UniProtKB/Swiss-Prot P21757 (MSRE_HUMAN)
Last modified
June 16, 2009.
Version 97.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Macrophage scavenger receptor types I and II Alternative name(s): Macrophage acetylated LDL receptor I and II Scavenger receptor class A member 1 CD_antigen=CD204 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 451 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL. |
| Subunit structure | Homotrimer. |
| Subcellular location | |
| Tissue specificity | Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages. Ref.2 |
| Sequence similarities | Contains 1 collagen-like domain. Contains 1 SRCR domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HOOK3 | Q86VS8 | 2 | EBI-1776976,EBI-1777078 | |
| Hook3 | Q7TQ77 | 1 | EBI-1776976,EBI-1777000 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform I (identifier: P21757-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform II (identifier: P21757-2) The sequence of this isoform differs from the canonical sequence as follows: 345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS 359-451: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform III (identifier: P21757-3) The sequence of this isoform differs from the canonical sequence as follows: 345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 451 | 451 | Macrophage scavenger receptor types I and II | PRO_0000181627 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 50 | 50 | Cytoplasmic Potential | ||||||||
| Transmembrane | 51 – 76 | 26 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 77 – 451 | 375 | Extracellular Potential | ||||||||
| Domain | 273 – 341 | 69 | Collagen-like | ||||||||
| Domain | 350 – 450 | 101 | SRCR | ||||||||
| Region | 77 – 109 | 33 | Spacer Probable | ||||||||
| Coiled coil | 171 – 255 | 85 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 27 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 29 | 1 | Phosphothreonine By similarity | ||||||||
| Glycosylation | 82 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 184 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 221 | 1 | N-linked (GlcNAc...) | ||||||||
| Glycosylation | 249 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 375 ↔ 439 | Ref.8 | |||||||||
| Disulfide bond | 388 ↔ 449 | Ref.8 | |||||||||
| Disulfide bond | 419 ↔ 429 | Ref.8 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 345 – 408 | 64 | TPFTK…HFGQG → S in isoform III. | VSP_036842 | |||||||
| Alternative sequence | 345 – 358 | 14 | TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. | VSP_006229 | |||||||
| Alternative sequence | 359 – 451 | 93 | Missing in isoform II. | VSP_006230 | |||||||
| Natural variant | 23 | 1 | F → C Ref.3 | VAR_025190 | |||||||
| Natural variant | 269 | 1 | T → I: dbSNP rs13306543. | VAR_052061 | |||||||
| Natural variant | 275 | 1 | P → A: dbSNP rs3747531. Ref.3 | VAR_025191 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human macrophage scavenger receptors: primary structure, expression, and localization in atherosclerotic lesions." Matsumoto A., Naito M., Itakura H., Ikemoto S., Asaoka H., Hayakawa I., Kanamori H., Aburatani H., Takaku F., Suzuki H., Kobari Y., Miyai T., Takahashi K., Cohen E.H., Wydro R., Housman D.E., Kodama T. Proc. Natl. Acad. Sci. U.S.A. 87:9133-9137(1990) [PubMed: 2251254] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II). |
| [2] | "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake." Gough P.J., Greaves D.R., Gordon S. J. Lipid Res. 39:531-543(1998) [PubMed: 9548586] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM III), TISSUE SPECIFICITY. |
| [3] | NIEHS SNPs program Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-23 AND ALA-275. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I). Tissue: Testis. |
| [7] | "Structure, organization, and chromosomal mapping of the human macrophage scavenger receptor gene." Emi M., Asaoka H., Matsumoto A., Itakura H., Kurihara Y., Wada Y., Kanamori H., Yazaki Y., Takahashi E., Lepert M. J. Biol. Chem. 268:2120-2125(1993) [PubMed: 8093617] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 155-272. |
| [8] | "Structures of class A macrophage scavenger receptors. Electron microscopic study of flexible, multidomain, fibrous proteins and determination of the disulfide bond pattern of the scavenger receptor cysteine-rich domain." Resnick D., Chatterton J.E., Schwartz K., Slayter H., Krieger M. J. Biol. Chem. 271:26924-26930(1996) [PubMed: 8900177] [Abstract] Cited for: DISULFIDE BONDS IN SRCR DOMAIN. |
| [9] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [10] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-221, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| D90187 mRNA. Translation: BAA14208.1. D90188 mRNA. Translation: BAA14209.1. AF037351 mRNA. Translation: AAC09251.1. DQ144993 Genomic DNA. Translation: AAZ38715.1. AC023396 Genomic DNA. No translation available. CH471080 Genomic DNA. Translation: EAW63832.1. BC063878 mRNA. Translation: AAH63878.1. D13263 Genomic DNA. No translation available. | |
| IPI | IPI00010351. IPI00012740. IPI00071002. |
| PIR | A38415. B38415. |
| RefSeq | NP_002436.1. NP_619729.1. NP_619730.1. |
| UniGene | Hs.147635 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P21757. |
Proteomic databases | |
| PRIDE | P21757. |
Genome annotation databases | |
| Ensembl | ENSG00000038945. Homo sapiens. [Contig view] |
| GeneID | 4481. |
| KEGG | hsa:4481. |
Organism-specific databases | |
| GeneCards | GC08M016009. |
| H-InvDB | HIX0034246. |
| HGNC | HGNC:7376. MSR1. |
| HPA | HPA000272. |
| MIM | 153622. gene. |
| PharmGKB | PA31181. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P21757. |
| HOVERGEN | P21757. |
| OMA | P21757. EVKVLNN. |
Gene expression databases | |
| ArrayExpress | P21757. |
| Bgee | P21757. |
| CleanEx | HS_MSR1. |
| GermOnline | ENSG00000038945. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. IPR003543. Macro_scav_rcpt. IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF01391. Collagen. 1 hit. PF03523. Macscav_rec. 1 hit. PF00530. SRCR. 1 hit. [Graphical view] |
| PRINTS | PR01408. MACSCAVRCPTR. |
| ProDom | PD000007. Clg_helix. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00202. SR. 1 hit. [Graphical view] |
| PROSITE | PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 17337. |
| SOURCE | Search... |
Entry information
| Entry name | MSRE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P21757 Secondary accession number(s): O60505, P21759, Q45F10 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


