Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P21757

- MSRE_HUMAN

UniProt

P21757 - MSRE_HUMAN

Protein

Macrophage scavenger receptor types I and II

Gene

MSR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 1 (01 May 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize acetylated LDL.

    GO - Molecular functioni

    1. low-density lipoprotein particle binding Source: BHF-UCL
    2. protein binding Source: IntAct
    3. scavenger receptor activity Source: ProtInc

    GO - Biological processi

    1. cholesterol transport Source: BHF-UCL
    2. lipoprotein transport Source: Ensembl
    3. plasma lipoprotein particle clearance Source: BHF-UCL
    4. positive regulation of cholesterol storage Source: BHF-UCL
    5. positive regulation of macrophage derived foam cell differentiation Source: BHF-UCL
    6. receptor-mediated endocytosis Source: ProtInc

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Endocytosis

    Enzyme and pathway databases

    ReactomeiREACT_163699. Scavenging by Class A Receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Macrophage scavenger receptor types I and II
    Alternative name(s):
    Macrophage acetylated LDL receptor I and II
    Scavenger receptor class A member 1
    CD_antigen: CD204
    Gene namesi
    Name:MSR1
    Synonyms:SCARA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:7376. MSR1.

    Subcellular locationi

    GO - Cellular componenti

    1. collagen trimer Source: UniProtKB-KW
    2. cytosol Source: Ensembl
    3. endocytic vesicle membrane Source: Reactome
    4. integral component of plasma membrane Source: ProtInc
    5. low-density lipoprotein particle Source: UniProtKB-KW
    6. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    LDL, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Prostate cancer (PC) [MIM:176807]: A malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.1 Publication
    Note: The disease may be caused by mutations affecting the gene represented in this entry. MSR1 variants may play a role in susceptibility to prostate cancer. MSR1 variants have been found in individuals with prostate cancer and co-segregate with the disease in some families.
    Barrett esophagus (BE) [MIM:614266]: A condition characterized by a metaplastic change in which normal esophageal squamous epithelium is replaced by a columnar and intestinal-type epithelium. Patients with Barrett esophagus have an increased risk of esophageal adenocarcinoma. The main cause of Barrett esophagus is gastroesophageal reflux. The retrograde movement of acid and bile salts from the stomach into the esophagus causes prolonged injury to the esophageal epithelium and induces chronic esophagitis, which in turn is believed to trigger the pathologic changes.1 Publication
    Note: The disease may be caused by mutations affecting the gene represented in this entry. Genetic variants in MSR1 have been found in individuals with Barrett esophagus and are thought to contribute to disease susceptibility.

    Organism-specific databases

    MIMi176807. phenotype.
    614266. phenotype.
    Orphaneti1232. Barrett esophagus.
    1331. Familial prostate cancer.
    PharmGKBiPA31181.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 451451Macrophage scavenger receptor types I and IIPRO_0000181627Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei27 – 271PhosphoserineBy similarity
    Glycosylationi82 – 821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi221 – 2211N-linked (GlcNAc...)1 Publication
    Glycosylationi249 – 2491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi375 ↔ 4391 PublicationPROSITE-ProRule annotation
    Disulfide bondi388 ↔ 4491 PublicationPROSITE-ProRule annotation
    Disulfide bondi419 ↔ 4291 PublicationPROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP21757.
    PRIDEiP21757.

    PTM databases

    PhosphoSiteiP21757.

    Expressioni

    Tissue specificityi

    Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.1 Publication

    Gene expression databases

    ArrayExpressiP21757.
    BgeeiP21757.
    CleanExiHS_MSR1.
    GenevestigatoriP21757.

    Organism-specific databases

    HPAiHPA000272.

    Interactioni

    Subunit structurei

    Homotrimer.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    HOOK3Q86VS84EBI-1776976,EBI-1777078
    Hook3Q7TQ772EBI-1776976,EBI-1777000From a different organism.

    Protein-protein interaction databases

    BioGridi110587. 3 interactions.
    IntActiP21757. 3 interactions.
    STRINGi9606.ENSP00000262101.

    Structurei

    3D structure databases

    ProteinModelPortaliP21757.
    SMRiP21757. Positions 150-197, 349-450.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 5050CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini77 – 451375ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei51 – 7626Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini273 – 34169Collagen-likeAdd
    BLAST
    Domaini350 – 450101SRCRPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni77 – 10933SpacerCuratedAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili171 – 25585Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 collagen-like domain.Curated
    Contains 1 SRCR domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Collagen, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG150350.
    HOGENOMiHOG000085659.
    HOVERGENiHBG002473.
    InParanoidiP21757.
    KOiK06558.
    OrthoDBiEOG7V1FQV.
    PhylomeDBiP21757.
    TreeFamiTF330855.

    Family and domain databases

    Gene3Di3.10.250.10. 1 hit.
    InterProiIPR008160. Collagen.
    IPR003543. Macro_scav_rcpt.
    IPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view]
    PfamiPF01391. Collagen. 1 hit.
    PF03523. Macscav_rec. 1 hit.
    PF00530. SRCR. 1 hit.
    [Graphical view]
    PRINTSiPR01408. MACSCAVRCPTR.
    PR00258. SPERACTRCPTR.
    SMARTiSM00202. SR. 1 hit.
    [Graphical view]
    SUPFAMiSSF56487. SSF56487. 1 hit.
    PROSITEiPS00420. SRCR_1. 1 hit.
    PS50287. SRCR_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform I (identifier: P21757-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEQWDHFHNQ QEDTDSCSES VKFDARSMTA LLPPNPKNSP SLQEKLKSFK    50
    AALIALYLLV FAVLIPLIGI VAAQLLKWET KNCSVSSTNA NDITQSLTGK 100
    GNDSEEEMRF QEVFMEHMSN MEKRIQHILD MEANLMDTEH FQNFSMTTDQ 150
    RFNDILLQLS TLFSSVQGHG NAIDEISKSL ISLNTTLLDL QLNIENLNGK 200
    IQENTFKQQE EISKLEERVY NVSAEIMAMK EEQVHLEQEI KGEVKVLNNI 250
    TNDLRLKDWE HSQTLRNITL IQGPPGPPGE KGDRGPTGES GPRGFPGPIG 300
    PPGLKGDRGA IGFPGSRGLP GYAGRPGNSG PKGQKGEKGS GNTLTPFTKV 350
    RLVGGSGPHE GRVEILHSGQ WGTICDDRWE VRVGQVVCRS LGYPGVQAVH 400
    KAAHFGQGTG PIWLNEVFCF GRESSIEECK IRQWGTRACS HSEDAGVTCT 450
    L 451
    Length:451
    Mass (Da):49,762
    Last modified:May 1, 1991 - v1
    Checksum:i915C03B56653BB41
    GO
    Isoform II (identifier: P21757-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         345-358: TPFTKVRLVGGSGP → RPVQLTDHIRAGPS
         359-451: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:358
    Mass (Da):39,584
    Checksum:i5F8593EF21189917
    GO
    Isoform III (identifier: P21757-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         345-408: TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQG → S

    Show »
    Length:388
    Mass (Da):42,942
    Checksum:iD6A20BCE57BFBC46
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti23 – 231F → C.1 Publication
    Corresponds to variant rs35175081 [ dbSNP | Ensembl ].
    VAR_025190
    Natural varianti36 – 361P → A Found in a family with prostate cancer. 1 Publication
    VAR_066581
    Natural varianti41 – 411S → Y Found in patients with prostate cancer. 1 Publication
    Corresponds to variant rs145597376 [ dbSNP | Ensembl ].
    VAR_066582
    Natural varianti113 – 1131V → A Found in patients with prostate cancer. 1 Publication
    Corresponds to variant rs117359034 [ dbSNP | Ensembl ].
    VAR_066583
    Natural varianti174 – 1741D → Y Found in patients with prostate cancer. 1 Publication
    Corresponds to variant rs72552387 [ dbSNP | Ensembl ].
    VAR_066584
    Natural varianti254 – 2541L → V Found in patients with Barrett esophagus. 1 Publication
    VAR_066585
    Natural varianti269 – 2691T → I.
    Corresponds to variant rs13306543 [ dbSNP | Ensembl ].
    VAR_052061
    Natural varianti275 – 2751P → A.2 Publications
    Corresponds to variant rs3747531 [ dbSNP | Ensembl ].
    VAR_025191
    Natural varianti369 – 3691G → S Found in a family with prostate cancer. 1 Publication
    VAR_066586
    Natural varianti441 – 4411H → R Found in patients with prostate cancer. 1 Publication
    Corresponds to variant rs138749399 [ dbSNP | Ensembl ].
    VAR_066587

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei345 – 40864TPFTK…HFGQG → S in isoform III. 1 PublicationVSP_036842Add
    BLAST
    Alternative sequencei345 – 35814TPFTK…GGSGP → RPVQLTDHIRAGPS in isoform II. 1 PublicationVSP_006229Add
    BLAST
    Alternative sequencei359 – 45193Missing in isoform II. 1 PublicationVSP_006230Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90187 mRNA. Translation: BAA14208.1.
    D90188 mRNA. Translation: BAA14209.1.
    AF037351 mRNA. Translation: AAC09251.1.
    DQ144993 Genomic DNA. Translation: AAZ38715.1.
    AC023396 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63832.1.
    CH471080 Genomic DNA. Translation: EAW63830.1.
    CH471080 Genomic DNA. Translation: EAW63833.1.
    CH471080 Genomic DNA. Translation: EAW63834.1.
    BC063878 mRNA. Translation: AAH63878.1.
    D13263 Genomic DNA. No translation available.
    CCDSiCCDS5995.1. [P21757-1]
    CCDS5996.1. [P21757-3]
    CCDS5997.1. [P21757-2]
    PIRiA38415.
    B38415.
    RefSeqiNP_002436.1. NM_002445.3. [P21757-2]
    NP_619729.1. NM_138715.2. [P21757-1]
    NP_619730.1. NM_138716.2. [P21757-3]
    UniGeneiHs.147635.

    Genome annotation databases

    EnsembliENST00000262101; ENSP00000262101; ENSG00000038945. [P21757-1]
    ENST00000350896; ENSP00000262100; ENSG00000038945. [P21757-3]
    ENST00000355282; ENSP00000347430; ENSG00000038945. [P21757-3]
    ENST00000381998; ENSP00000371428; ENSG00000038945. [P21757-2]
    GeneIDi4481.
    KEGGihsa:4481.
    UCSCiuc003wwz.3. human. [P21757-1]
    uc003wxa.3. human. [P21757-3]
    uc003wxb.3. human. [P21757-2]

    Polymorphism databases

    DMDMi127357.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90187 mRNA. Translation: BAA14208.1 .
    D90188 mRNA. Translation: BAA14209.1 .
    AF037351 mRNA. Translation: AAC09251.1 .
    DQ144993 Genomic DNA. Translation: AAZ38715.1 .
    AC023396 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63832.1 .
    CH471080 Genomic DNA. Translation: EAW63830.1 .
    CH471080 Genomic DNA. Translation: EAW63833.1 .
    CH471080 Genomic DNA. Translation: EAW63834.1 .
    BC063878 mRNA. Translation: AAH63878.1 .
    D13263 Genomic DNA. No translation available.
    CCDSi CCDS5995.1. [P21757-1 ]
    CCDS5996.1. [P21757-3 ]
    CCDS5997.1. [P21757-2 ]
    PIRi A38415.
    B38415.
    RefSeqi NP_002436.1. NM_002445.3. [P21757-2 ]
    NP_619729.1. NM_138715.2. [P21757-1 ]
    NP_619730.1. NM_138716.2. [P21757-3 ]
    UniGenei Hs.147635.

    3D structure databases

    ProteinModelPortali P21757.
    SMRi P21757. Positions 150-197, 349-450.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110587. 3 interactions.
    IntActi P21757. 3 interactions.
    STRINGi 9606.ENSP00000262101.

    Chemistry

    BindingDBi P21757.
    ChEMBLi CHEMBL5811.

    PTM databases

    PhosphoSitei P21757.

    Polymorphism databases

    DMDMi 127357.

    Proteomic databases

    PaxDbi P21757.
    PRIDEi P21757.

    Protocols and materials databases

    DNASUi 4481.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262101 ; ENSP00000262101 ; ENSG00000038945 . [P21757-1 ]
    ENST00000350896 ; ENSP00000262100 ; ENSG00000038945 . [P21757-3 ]
    ENST00000355282 ; ENSP00000347430 ; ENSG00000038945 . [P21757-3 ]
    ENST00000381998 ; ENSP00000371428 ; ENSG00000038945 . [P21757-2 ]
    GeneIDi 4481.
    KEGGi hsa:4481.
    UCSCi uc003wwz.3. human. [P21757-1 ]
    uc003wxa.3. human. [P21757-3 ]
    uc003wxb.3. human. [P21757-2 ]

    Organism-specific databases

    CTDi 4481.
    GeneCardsi GC08M016009.
    HGNCi HGNC:7376. MSR1.
    HPAi HPA000272.
    MIMi 153622. gene.
    176807. phenotype.
    614266. phenotype.
    neXtProti NX_P21757.
    Orphaneti 1232. Barrett esophagus.
    1331. Familial prostate cancer.
    PharmGKBi PA31181.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG150350.
    HOGENOMi HOG000085659.
    HOVERGENi HBG002473.
    InParanoidi P21757.
    KOi K06558.
    OrthoDBi EOG7V1FQV.
    PhylomeDBi P21757.
    TreeFami TF330855.

    Enzyme and pathway databases

    Reactomei REACT_163699. Scavenging by Class A Receptors.

    Miscellaneous databases

    GeneWikii MSR1.
    GenomeRNAii 4481.
    NextBioi 17337.
    PROi P21757.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P21757.
    Bgeei P21757.
    CleanExi HS_MSR1.
    Genevestigatori P21757.

    Family and domain databases

    Gene3Di 3.10.250.10. 1 hit.
    InterProi IPR008160. Collagen.
    IPR003543. Macro_scav_rcpt.
    IPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view ]
    Pfami PF01391. Collagen. 1 hit.
    PF03523. Macscav_rec. 1 hit.
    PF00530. SRCR. 1 hit.
    [Graphical view ]
    PRINTSi PR01408. MACSCAVRCPTR.
    PR00258. SPERACTRCPTR.
    SMARTi SM00202. SR. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56487. SSF56487. 1 hit.
    PROSITEi PS00420. SRCR_1. 1 hit.
    PS50287. SRCR_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II).
    2. "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake."
      Gough P.J., Greaves D.R., Gordon S.
      J. Lipid Res. 39:531-543(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM III), TISSUE SPECIFICITY.
    3. NIEHS SNPs program
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-23 AND ALA-275.
    4. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
      Tissue: Testis.
    7. "Structure, organization, and chromosomal mapping of the human macrophage scavenger receptor gene."
      Emi M., Asaoka H., Matsumoto A., Itakura H., Kurihara Y., Wada Y., Kanamori H., Yazaki Y., Takahashi E., Lepert M.
      J. Biol. Chem. 268:2120-2125(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 155-272.
    8. "Structures of class A macrophage scavenger receptors. Electron microscopic study of flexible, multidomain, fibrous proteins and determination of the disulfide bond pattern of the scavenger receptor cysteine-rich domain."
      Resnick D., Chatterton J.E., Schwartz K., Slayter H., Krieger M.
      J. Biol. Chem. 271:26924-26930(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISULFIDE BONDS IN SRCR DOMAIN.
    9. Cited for: POSSIBLE INVOLVEMENT IN PC, VARIANTS ALA-36; TYR-41; ALA-113; TYR-174; ALA-275; SER-369 AND ARG-441.
    10. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    11. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-221.
      Tissue: Liver.
    12. "Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma."
      Orloff M., Peterson C., He X., Ganapathi S., Heald B., Yang Y.R., Bebek G., Romigh T., Song J.H., Wu W., David S., Cheng Y., Meltzer S.J., Eng C.
      JAMA 306:410-419(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN BE, VARIANT VAL-254.

    Entry informationi

    Entry nameiMSRE_HUMAN
    AccessioniPrimary (citable) accession number: P21757
    Secondary accession number(s): D3DSP3
    , O60505, P21759, Q45F10
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 1991
    Last sequence update: May 1, 1991
    Last modified: October 1, 2014
    This is version 150 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3