P21675 (TAF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 152.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription initiation factor TFIID subunit 1 EC=2.7.11.1 Alternative name(s): Cell cycle gene 1 protein TBP-associated factor 250 kDa Short name=p250 Transcription initiation factor TFIID 250 kDa subunit Short name=TAF(II)250 Short name=TAFII-250 Short name=TAFII250 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1872 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle. Ref.1 Ref.8 Ref.9 Ref.11 Ref.12 Ref.14 Ref.17 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Autophosphorylates on Ser residues. Inhibited by retinoblastoma tumor suppressor protein, RB1. |
| Subunit structure | TAF1 is the largest component of transcription factor TFIID that is composed of TBP and a variety of TBP-associated factors. TAF1, when part of the TFIID complex, interacts with C-terminus of TP53. Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. RB1 interacts with the N-terminal domain of TAF1. Interacts with ASF1A and ASF1B. Interacts with SV40 Large T antigen. Interacts (via bromo domains) with acetylated lysine residues on the N-terminus of histone H1.4, H2A, H2B, H3 and H4 (in vitro). Ref.3 Ref.10 Ref.12 Ref.13 Ref.15 Ref.16 Ref.17 Ref.18 Ref.24 |
| Subcellular location | |
| Post-translational modification | Phosphorylated by casein kinase II in vitro. Ref.9 |
| Involvement in disease | Dystonia 3 (DYT3) [MIM:314250]: A X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. It has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease. |
| Sequence similarities | Belongs to the TAF1 family. Contains 2 bromo domains. Contains 1 HMG box DNA-binding domain. Contains 2 protein kinase domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GTF2F1 | P35269 | 3 | EBI-491289,EBI-457886 | |
| TBP | P20226 | 5 | EBI-491289,EBI-355371 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P21675-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P21675-2) The sequence of this isoform differs from the canonical sequence as follows: 177-177: G → GVSENGEGIILPSIIAPSSLAS | ||||||
| Isoform 3 (identifier: P21675-3) The sequence of this isoform differs from the canonical sequence as follows: 1684-1686: Missing. 1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP | ||||||
| Note: Contains a phosphoserine at position 1697. | ||||||
| Isoform 4 (identifier: P21675-4) The sequence of this isoform differs from the canonical sequence as follows: 1687-1687: Q → QMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTPAP | ||||||
| Note: Contains a phosphoserine at position 1700. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1872 | 1872 | Transcription initiation factor TFIID subunit 1 | PRO_0000211215 | ||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 414 | 414 | Protein kinase 1 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 1397 – 1467 | 71 | Bromo 1 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 1425 – 1872 | 448 | Protein kinase 2 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 1520 – 1590 | 71 | Bromo 2 | |||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 1195 – 1273 | 79 | HMG box | |||||||||||||||||||||||||||||||||||||||||||
| Region | 1342 – 1629 | 288 | Interaction with ASF1A and ASF1B | |||||||||||||||||||||||||||||||||||||||||||
| Motif | 1351 – 1358 | 8 | Nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 157 – 165 | 9 | Pro-rich | |||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1627 – 1872 | 246 | Asp/Glu-rich (acidic tail) | |||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 137 | 1 | Phosphoserine; by autocatalysis Ref.9 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 307 | 1 | Phosphoserine; by autocatalysis Ref.9 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1826 | 1 | Phosphoserine Ref.20 | |||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1364 ↔ 1619 | |||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 177 | 1 | G → GVSENGEGIILPSIIAPSSL AS in isoform 2. | VSP_012362 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1684 – 1686 | 3 | Missing in isoform 3. | VSP_023318 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1687 | 1 | Q → QMRQGRGRLGEEDSDVDIEG YDDEEEDGKPKTPAP in isoform 3 and isoform 4. | VSP_023319 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 269 | 1 | L → V. Ref.4 Ref.25 Corresponds to variant rs28382158 [ dbSNP | Ensembl ]. | VAR_020678 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 297 | 1 | A → G. Ref.25 Corresponds to variant rs35317750 [ dbSNP | Ensembl ]. | VAR_041930 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 453 | 1 | G → D in a colorectal adenocarcinoma sample; somatic mutation. Ref.25 | VAR_041931 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 651 | 1 | E → K in a metastatic melanoma sample; somatic mutation. Ref.25 | VAR_041932 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 691 | 1 | M → I in a lung bronchoalveolar carcinoma sample; somatic mutation. Ref.25 | VAR_041933 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1383 | 1 | V → I. Corresponds to variant rs7050748 [ dbSNP | Ensembl ]. | VAR_048433 | ||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 137 | 1 | S → A: No decrease in kinase activity. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 145 | 1 | D → A: Reduces kinase activity; when associated with A-147; A-149; A-150; A-152 and A-154. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 147 | 1 | D → A: Reduces kinase activity; when associated with A-145; A-149; A-150; A-152 and A-154. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 149 | 1 | E → A: Reduces kinase activity; when associated with A-145; A-147; A-150; A-152 and A-154. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 150 | 1 | D → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-152 and A-154. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 152 | 1 | D → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-150 and A-154. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 154 | 1 | K → A: Reduces kinase activity; when associated with A-145; A-147; A-149; A-150 and A-152. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 305 | 1 | C → A: Reduces kinase activity; when associated with A-307; A-308; A-309 and A-310. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 307 | 1 | S → A: Reduces kinase activity; when associated with A-305; A-308; A-309 and A-310. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 308 | 1 | D → A: Reduces kinase activity; when associated with A-305; A-307; A-309 and A-310. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 309 | 1 | D → A: Reduces kinase activity; when associated with A-305; A-307; A-308 and A-310. | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 310 | 1 | E → A: Reduces kinase activity; when associated with A-305; A-307; A-308 and A-309. | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1525 – 1528 | 4 | SWPF → IITK in CAM98557. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1585 – 1591 | 7 | PESQYTK → YMCTTCR in CAD87528. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1645 | 1 | Q → QAK in CAD87527. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1799 | 1 | S → R in CAD70490. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1799 | 1 | S → R in CAD70491. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1799 | 1 | S → R in CAD70492. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1799 | 1 | S → R in CAD70493. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1799 | 1 | S → R in CAD87527. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1801 | 1 | G → Q in CAD70491. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1801 | 1 | G → Q in CAD70492. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1801 | 1 | G → Q in CAD70493. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1801 | 1 | G → Q in CAD87527. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1381 – 1397 | 17 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1403 – 1405 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1406 – 1408 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1411 – 1413 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1417 – 1420 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1427 – 1435 | 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1442 – 1460 | 19 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1462 – 1464 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1465 – 1483 | 19 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1485 – 1495 | 11 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1497 – 1500 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1502 – 1517 | 16 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1518 – 1521 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1526 – 1528 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1534 – 1536 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1540 – 1543 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1550 – 1558 | 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1565 – 1583 | 19 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1588 – 1606 | 19 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1608 – 1621 | 14 | ||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human CCG1 gene, essential for progression of the G1 phase, encodes a 210-kilodalton nuclear DNA-binding protein." Sekiguchi T., Nohiro Y., Nakamura Y., Hisamoto N., Nishimoto T. Mol. Cell. Biol. 11:3317-3325(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. Tissue: Laryngeal carcinoma. |
| [2] | "Molecular cloning of the cDNA of human X chromosomal gene (CCG1) which complements the temperature-sensitive G1 mutants, tsBN462 and ts13, of the BHK cell line." Sekiguchi T., Miyata T., Nishimoto T. EMBO J. 7:1683-1687(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Cloning and expression of human TAFII250: a TBP-associated factor implicated in cell-cycle regulation." Ruppert S., Wang E.H., Tjian R. Nature 362:175-179(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TBP AND TAFS. |
| [4] | NIEHS SNPs program Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-269. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 837-1872 (ISOFORM 4). Tissue: Brain. |
| [6] | "Specific sequence changes in multiple transcript system DYT3 are associated with X-linked dystonia parkinsonism." Nolte D., Niemann S., Muller U. Proc. Natl. Acad. Sci. U.S.A. 100:10347-10352(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1347-1801 (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1498-1801 (ISOFORM 3), INVOLVEMENT IN DYT3. Tissue: Fetal brain. |
| [7] | Nolte D. Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [8] | "The p250 subunit of native TATA box-binding factor TFIID is the cell-cycle regulatory protein CCG1." Hisatake K., Hasegawa S., Takada R., Nakatani Y., Horikoshi M., Roeder R.G. Nature 362:179-181(1993) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "TAFII250 is a bipartite protein kinase that phosphorylates the base transcription factor RAP74." Dikstein R., Ruppert S., Tjian R. Cell 84:781-790(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-137 AND SER-307, ATP-BINDING. |
| [10] | "TAF-like function of SV40 large T antigen." Damania B., Alwine J.C. Genes Dev. 10:1369-1381(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SV40 LARGE T ANTIGEN. |
| [11] | "Functional analysis of the human TAFII250 N-terminal kinase domain." O'Brien T., Tjian R. Mol. Cell 1:905-911(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS. |
| [12] | "Rb inhibits the intrinsic kinase activity of TATA-binding protein-associated factor TAFII250." Siegert J.L., Robbins P.D. Mol. Cell. Biol. 19:846-854(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RB1, ATP-BINDING. |
| [13] | "A human homologue of yeast anti-silencing factor has histone chaperone activity." Munakata T., Adachi N., Yokoyama N., Kuzuhara T., Horikoshi M. Genes Cells 5:221-233(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ASF1A. |
| [14] | "Taf(II) 250 phosphorylates human transcription factor IIA on serine residues important for TBP binding and transcription activity." Solow S., Salunek M., Ryan R., Lieberman P.M. J. Biol. Chem. 276:15886-15892(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "Identification and characterization of CIA/ASF1 as an interactor of bromodomains associated with TFIID." Chimura T., Kuzuhara T., Horikoshi M. Proc. Natl. Acad. Sci. U.S.A. 99:9334-9339(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ASF1A. |
| [16] | "Transcription initiation factor IID-interactive histone chaperone CIA-II implicated in mammalian spermatogenesis." Umehara T., Horikoshi M. J. Biol. Chem. 278:35660-35667(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ASF1A AND ASF1B. |
| [17] | "Phosphorylation on Thr-55 by TAF1 mediates degradation of p53: a role for TAF1 in cell G1 progression." Li H.-H., Li A.G., Sheppard H.M., Liu X. Mol. Cell 13:867-878(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TP53. |
| [18] | "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF." Dou Y., Milne T.A., Tackett A.J., Smith E.R., Fukuda A., Wysocka J., Allis C.D., Chait B.T., Hess J.L., Roeder R.G. Cell 121:873-885(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE MLL1/MLL COMPLEX. |
| [19] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [20] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1826, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [21] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1697 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1700 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "Structure and function of a human TAFII250 double bromodomain module." Jacobson R.H., Ladurner A.G., King D.S., Tjian R. Science 288:1422-1425(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 1359-1638. |
| [23] | "Reduced neuron-specific expression of the TAF1 gene is associated with X-linked dystonia-parkinsonism." Makino S., Kaji R., Ando S., Tomizawa M., Yasuno K., Goto S., Matsumoto S., Tabuena M.D., Maranon E., Dantes M., Lee L.V., Ogasawara K., Tooyama I., Akatsu H., Nishimura M., Tamiya G. Am. J. Hum. Genet. 80:393-406(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN DYT3. |
| [24] | "Histone recognition and large-scale structural analysis of the human bromodomain family." Filippakopoulos P., Picaud S., Mangos M., Keates T., Lambert J.P., Barsyte-Lovejoy D., Felletar I., Volkmer R., Muller S., Pawson T., Gingras A.C., Arrowsmith C.H., Knapp S. Cell 149:214-231(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.89 ANGSTROMS) OF 1501-1635, SUBUNIT. |
| [25] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-269; GLY-297; ASP-453; LYS-651 AND ILE-691. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D90359 mRNA. Translation: BAA14374.1. X07024 mRNA. Translation: CAA30073.1. Sequence problems. AY623109 Genomic DNA. Translation: AAT38105.1. AB209316 mRNA. Translation: BAD92553.1. AJ549247 mRNA. Translation: CAD70490.1. AJ549248 mRNA. Translation: CAD70491.3. AJ549249 mRNA. Translation: CAD70492.2. AJ549250 mRNA. Translation: CAD70493.3. AJ555148 mRNA. Translation: CAD87527.2. AJ555149 mRNA. Translation: CAD87528.2. AM711894 mRNA. Translation: CAM98557.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00009891. IPI00645793. IPI00828032. IPI00939191. | ||||||||||||||||||||||||||||||
| PIR | A40262. | ||||||||||||||||||||||||||||||
| RefSeq | NP_004597.2. NM_004606.3. NP_620278.1. NM_138923.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.158560. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P21675. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-147N. DIP-24198N. | ||||||||||||||||||||||||||||||
| IntAct | P21675. 23 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-1211825. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P21675. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 115942. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | P21675. | ||||||||||||||||||||||||||||||
| PRIDE | P21675. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000276072; ENSP00000276072; ENSG00000147133. ENST00000373790; ENSP00000362895; ENSG00000147133. ENST00000449580; ENSP00000389000; ENSG00000147133. | ||||||||||||||||||||||||||||||
| GeneID | 6872. | ||||||||||||||||||||||||||||||
| KEGG | hsa:6872. | ||||||||||||||||||||||||||||||
| UCSC | uc004dzt.4. human. uc004dzu.4. human. uc004dzv.4. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 6872. | ||||||||||||||||||||||||||||||
| GeneCards | GC0XP070586. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:11535. TAF1. | ||||||||||||||||||||||||||||||
| HPA | CAB016283. HPA001075. | ||||||||||||||||||||||||||||||
| MIM | 313650. gene. 314250. phenotype. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P21675. | ||||||||||||||||||||||||||||||
| Orphanet | 53351. X-linked dystonia-parkinsonism. | ||||||||||||||||||||||||||||||
| PharmGKB | PA36310. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG5076. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG050223. | ||||||||||||||||||||||||||||||
| KO | K03125. | ||||||||||||||||||||||||||||||
| OMA | DEFYYPK. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4K3KVC. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_116125. Disease. REACT_1788. Transcription. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P21675. | ||||||||||||||||||||||||||||||
| Bgee | P21675. | ||||||||||||||||||||||||||||||
| Genevestigator | P21675. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000147133. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 1.10.1100.10. 1 hit. 1.20.920.10. 2 hits. | ||||||||||||||||||||||||||||||
| InterPro | IPR001487. Bromodomain. IPR018359. Bromodomain_CS. IPR011177. TAF1_animal. IPR009067. TAF_II_230-bd. IPR022591. TFIID_sub1_DUF3591. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00439. Bromodomain. 2 hits. PF12157. DUF3591. 1 hit. PF09247. TBP-binding. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PIRSF | PIRSF003047. TAF1_animal. 1 hit. | ||||||||||||||||||||||||||||||
| PRINTS | PR00503. BROMODOMAIN. | ||||||||||||||||||||||||||||||
| SMART | SM00297. BROMO. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF47370. Bromodomain. 2 hits. SSF47055. TAF_II_230. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS00633. BROMODOMAIN_1. 2 hits. PS50014. BROMODOMAIN_2. 2 hits. PS50118. HMG_BOX_2. False negative. PS50011. PROTEIN_KINASE_DOM. False negative. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| EvolutionaryTrace | P21675. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 6872. | ||||||||||||||||||||||||||||||
| NextBio | 26827. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | TAF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P21675 Secondary accession number(s): A5CVD0 Q70T03 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
